diff --git a/Gruntfile.js b/Gruntfile.js deleted file mode 100644 index 48b5b41..0000000 --- a/Gruntfile.js +++ /dev/null @@ -1,105 +0,0 @@ -module.exports = function(grunt) { - - // Project configuration. - grunt.initConfig({ - pkg: grunt.file.readJSON('package.json'), - concat: { - options: { - separator: ';' - }, - basic: { - src: [ - 'bower_components/jquery/dist/jquery.js', - 'bower_components/d3/d3.min.js', - 'bower_components/bootstrap/js/tooltip.js', - 'bower_components/bootstrap/js/popover.js', - 'src/feature-viewer.js' - ], - dest: 'dist/feature-viewer.bundle.js' - }, - nextP: { - src: [ - 'dist/feature-viewer.bundle.js', - 'bower_components/nextprot/src/nextprot-core.js', - 'bower_components/nextprot/src/nextprot-utils.js', - 'src/fv.nextprot.js' - ], - dest: 'dist/feature-viewer.nextprot.js' - }, - css: { - src: [ - 'bower_components/bootstrap/dist/css/bootstrap.min.css', - 'css/style.css' - ], - dest: 'dist/feature-viewer.min.css' - } - - }, - bump: { - options: { - files: ['package.json'], - updateConfigs: [], - commit: true, - commitMessage: 'Release v%VERSION%', - commitFiles: ['package.json'], - createTag: true, - tagName: 'v%VERSION%', - tagMessage: 'Version %VERSION%', - push: true, - pushTo: 'https://github.com/calipho-sib/feature-viewer.git', - gitDescribeOptions: '--tags --always --abbrev=1 --dirty=-d', - globalReplace: false, - prereleaseName: false, - regExp: false - } - }, - uglify: { - options: { - banner: '/*! <%= pkg.name %> <%= grunt.template.today("yyyy-mm-dd") %> */\n' - }, - basic: { - src: 'src/feature-viewer.js', - dest: 'dist/feature-viewer.min.js' - }, - nextprot: { - src: 'dist/feature-viewer.nextprot.js', - dest: 'dist/feature-viewer.nextprot.js' - }, - bundle: { - src: 'dist/feature-viewer.bundle.js', - dest: 'dist/feature-viewer.bundle.js' - } - }, - connect: { - server: { - options: { - port: 9000, - livereload: true, - base: '.' - } - } - }, - watch: { - all: { - options: {livereload: true}, - files: ['*.js'] - } - } - }); - - - - // Load the plugin that provides the "uglify" task. - grunt.loadNpmTasks('grunt-contrib-concat'); - grunt.loadNpmTasks('grunt-contrib-uglify'); - grunt.loadNpmTasks('grunt-contrib-connect'); - grunt.loadNpmTasks('grunt-contrib-watch'); - grunt.loadNpmTasks('grunt-bump'); - - // Default task(s). - grunt.registerTask('default', ['uglify']); - grunt.registerTask('concating', ['concat']); - grunt.registerTask('prod', ['concat','uglify']); - grunt.registerTask('serve', ['connect:server','watch']); - -}; \ No newline at end of file diff --git a/README.md b/README.md index caae4e9..ce0907f 100644 --- a/README.md +++ b/README.md @@ -18,25 +18,23 @@ This version is made in Javascript using the D3 library. For the TypeScript vers ## Getting Started -**1.** You can get the library in your project using bower or npm +**1.** You can get the library in your project using NPM/Yarn ``` -//BOWER// -bower install feature-viewer - -//NODE// +//NPM// npm install feature-viewer + +//Yarn// +yarn add feature-viewer ``` -Or Include the feature-viewer **JS** and **CSS** from rawgit CDN in the header of your html +Or Include the feature-viewer from rawgit CDN in the header of your html ```html - - - + ``` **NOTE** : If you already got the dependencies (D3, Bootstrap & Jquery) in your project, use the simple minified version instead of the bundle : ```html - + ``` **2.** Specify a div in your html @@ -44,11 +42,10 @@ Or Include the feature-viewer **JS** and **CSS** from rawgit CDN in the header o
``` -**3.** Create an instance of FeatureViewer in javascript with the sequence (or a length), the div in which it will be display and the rendering options of your choice. +**3.** Create an instance of FeatureViewer in JavaScript with the sequence (or a length), the div in which it will be display and the rendering options of your choice. ```javascript -//For Node add before : var FeatureViewer = require("feature-viewer"); -var ft = new FeatureViewer('MALWMRLLPLLALLALWGPGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLE', +var ft = new FeatureViewer.createFeature('MALWMRLLPLLALLALWGPGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLE', '#fv1', { showAxis: true, @@ -60,7 +57,17 @@ var ft = new FeatureViewer('MALWMRLLPLLALLALWGPGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLY }); //Instead of a sequence, you can also initialize the feature viewer with a length (integer) : -var ft = new FeatureViewer(213,'#fv1'); +var ft = new FeatureViewer.createFeature(213,'#fv1'); +``` + +To import Feature Viewer into an ES2015 application, you can import specific symbols from specific Feature Viewer modules: +```javascript +import { createFeature } from "feature-viewer"; +``` + +In Node: +```javascript +const { createFeature } = require("feature-viewer"); ``` **4.** Finally, add the features @@ -126,6 +133,9 @@ It is possible to fill the feature viewer with protein features from [NeXtProt]( //initalize nextprot Client var applicationName = 'demo app'; //please provide a name for your application var clientInfo='calipho group at sib'; //please provide some information about you + +const { nxFeatureViewer, Nextprot } = FeatureViewer; + var nx = new Nextprot.Client(applicationName, clientInfo); //var entry = "NX_P01308"; @@ -170,15 +180,11 @@ If you have any problem or suggestion please open an issue [here](https://github `npm install` (will install the development dependencies) -`bower install` (will install the browser dependencies) +`npm start` (will start the development server on localhost:8080) ...make your changes and modifications... -`npm run dist` (will create the min & bundle versions in dist/) - -`npm run build` (will create the bundle js & css in build/ for node) - -`grunt bump` (will push and add a new release) +`npm run build` (will create the bundle js & css in build/) `npm publish` (will publish in npm) diff --git a/bower.json b/bower.json deleted file mode 100644 index 2839407..0000000 --- a/bower.json +++ /dev/null @@ -1,32 +0,0 @@ -{ - "name": "feature-viewer", - "version": "1.0.5", - "main": "dist/feature-viewer.min.js", - "ignore": [ - "**/.*", - "node_modules", - "bower_components" - ], - "dependencies": { - "jquery": "x.x.x", - "bootstrap": "3.x.x", - "d3" : "3.5.6", - "nextprot": "x.x.x" - }, - "keywords": [ - "feature", - "protein", - "nextprot", - "uniprot", - "viewer" - ], - "license": "GNU GPL v2", - "authors": [ - "Mathieu Schaeffer ", - "Calipho Team " - ], - "repository": { - "type": "git", - "url": "https://github.com/calipho-sib/feature-viewer.git" - } -} diff --git a/build/bundle.css b/build/bundle.css deleted file mode 100644 index c49080c..0000000 --- a/build/bundle.css +++ /dev/null @@ -1,13700 +0,0 @@ -/*! - * Bootstrap v3.3.6 (http://getbootstrap.com) - * Copyright 2011-2015 Twitter, Inc. - * Licensed under MIT (https://github.com/twbs/bootstrap/blob/master/LICENSE) - */ -/*! normalize.css v3.0.3 | MIT License | github.com/necolas/normalize.css */ -html { - font-family: sans-serif; - -webkit-text-size-adjust: 100%; - -ms-text-size-adjust: 100%; -} -body { - margin: 0; -} -article, -aside, -details, -figcaption, -figure, -footer, -header, -hgroup, -main, -menu, -nav, -section, -summary { - display: block; -} -audio, -canvas, -progress, -video { - display: inline-block; - vertical-align: baseline; -} -audio:not([controls]) { - display: none; - height: 0; -} -[hidden], -template { - display: none; -} -a { - background-color: transparent; -} -a:active, -a:hover { - outline: 0; -} -abbr[title] { - border-bottom: 1px dotted; -} -b, -strong { - font-weight: bold; -} -dfn { - font-style: italic; -} -h1 { - margin: .67em 0; - font-size: 2em; -} -mark { - color: #000; - background: #ff0; -} -small { - font-size: 80%; -} -sub, -sup { - position: relative; - font-size: 75%; - line-height: 0; - vertical-align: baseline; -} -sup { - top: -.5em; -} -sub { - bottom: -.25em; -} -img { - border: 0; -} -svg:not(:root) { - overflow: hidden; -} -figure { - margin: 1em 40px; -} -hr { - height: 0; - -webkit-box-sizing: content-box; - -moz-box-sizing: content-box; - box-sizing: content-box; -} -pre { - overflow: auto; -} -code, -kbd, -pre, -samp { - font-family: monospace, monospace; - font-size: 1em; -} -button, -input, -optgroup, -select, -textarea { - margin: 0; - font: inherit; - color: inherit; -} -button { - overflow: visible; -} -button, -select { - text-transform: none; -} -button, -html input[type="button"], -input[type="reset"], -input[type="submit"] { - -webkit-appearance: button; - cursor: pointer; -} -button[disabled], -html input[disabled] { - cursor: default; -} -button::-moz-focus-inner, -input::-moz-focus-inner { - padding: 0; - border: 0; -} -input { - line-height: normal; -} -input[type="checkbox"], -input[type="radio"] { - -webkit-box-sizing: border-box; - -moz-box-sizing: border-box; - box-sizing: border-box; - padding: 0; -} -input[type="number"]::-webkit-inner-spin-button, -input[type="number"]::-webkit-outer-spin-button { - height: auto; -} -input[type="search"] { - -webkit-box-sizing: content-box; - -moz-box-sizing: content-box; - box-sizing: content-box; - -webkit-appearance: textfield; -} -input[type="search"]::-webkit-search-cancel-button, -input[type="search"]::-webkit-search-decoration { - -webkit-appearance: none; -} -fieldset { - padding: .35em .625em .75em; - margin: 0 2px; - border: 1px solid #c0c0c0; -} -legend { - padding: 0; - border: 0; -} -textarea { - overflow: auto; -} -optgroup { - font-weight: bold; -} -table { - border-spacing: 0; - border-collapse: collapse; -} -td, -th { - padding: 0; -} -/*! Source: https://github.com/h5bp/html5-boilerplate/blob/master/src/css/main.css */ -@media print { - *, - *:before, - *:after { - color: #000 !important; - text-shadow: none !important; - background: transparent !important; - -webkit-box-shadow: none !important; - box-shadow: none !important; - } - a, - a:visited { - text-decoration: underline; - } - a[href]:after { - content: " (" attr(href) ")"; - } - abbr[title]:after { - content: " (" attr(title) ")"; - } - a[href^="#"]:after, - a[href^="javascript:"]:after { - content: ""; - } - pre, - blockquote { - border: 1px solid #999; - - page-break-inside: avoid; - } - thead { - display: table-header-group; - } - tr, - img { - page-break-inside: avoid; - } - img { - max-width: 100% !important; - } - p, - h2, - h3 { - orphans: 3; - widows: 3; - } - h2, - h3 { - page-break-after: avoid; - } - .navbar { - display: none; - } - .btn > .caret, - .dropup > .btn > .caret { - border-top-color: #000 !important; - } - .label { - border: 1px solid #000; - } - .table { - border-collapse: collapse !important; - } - .table td, - .table th { - background-color: #fff !important; - } - .table-bordered th, - .table-bordered td { - border: 1px solid #ddd !important; - } -} -@font-face { - font-family: 'Glyphicons Halflings'; - - src: url('../fonts/glyphicons-halflings-regular.eot'); - src: url('../fonts/glyphicons-halflings-regular.eot?#iefix') format('embedded-opentype'), url('../fonts/glyphicons-halflings-regular.woff2') format('woff2'), url('../fonts/glyphicons-halflings-regular.woff') format('woff'), url('../fonts/glyphicons-halflings-regular.ttf') format('truetype'), url('../fonts/glyphicons-halflings-regular.svg#glyphicons_halflingsregular') format('svg'); -} -.glyphicon { - position: relative; - top: 1px; - display: inline-block; - font-family: 'Glyphicons Halflings'; - font-style: normal; - font-weight: normal; - line-height: 1; - - -webkit-font-smoothing: antialiased; - -moz-osx-font-smoothing: grayscale; -} -.glyphicon-asterisk:before { - content: "\002a"; -} -.glyphicon-plus:before { - content: "\002b"; -} -.glyphicon-euro:before, -.glyphicon-eur:before { - content: "\20ac"; -} -.glyphicon-minus:before { - content: "\2212"; -} -.glyphicon-cloud:before { - content: "\2601"; -} -.glyphicon-envelope:before { - content: "\2709"; -} -.glyphicon-pencil:before { - content: "\270f"; -} -.glyphicon-glass:before { - content: "\e001"; -} -.glyphicon-music:before { - content: "\e002"; -} -.glyphicon-search:before { - content: "\e003"; -} -.glyphicon-heart:before { - content: "\e005"; -} -.glyphicon-star:before { - content: "\e006"; -} -.glyphicon-star-empty:before { - content: "\e007"; -} -.glyphicon-user:before { - content: "\e008"; -} -.glyphicon-film:before { - content: "\e009"; -} -.glyphicon-th-large:before { - content: "\e010"; -} -.glyphicon-th:before { - content: "\e011"; -} -.glyphicon-th-list:before { - content: "\e012"; -} -.glyphicon-ok:before { - content: "\e013"; -} -.glyphicon-remove:before { - content: "\e014"; -} -.glyphicon-zoom-in:before { - content: "\e015"; -} -.glyphicon-zoom-out:before { - content: "\e016"; -} -.glyphicon-off:before { - content: "\e017"; -} -.glyphicon-signal:before { - content: "\e018"; -} -.glyphicon-cog:before { - content: "\e019"; -} -.glyphicon-trash:before { - content: "\e020"; -} -.glyphicon-home:before { - content: "\e021"; -} -.glyphicon-file:before { - content: "\e022"; -} -.glyphicon-time:before { - content: "\e023"; -} -.glyphicon-road:before { - content: "\e024"; -} -.glyphicon-download-alt:before { - content: "\e025"; -} -.glyphicon-download:before { - content: "\e026"; -} -.glyphicon-upload:before { - content: "\e027"; -} -.glyphicon-inbox:before { - content: "\e028"; -} -.glyphicon-play-circle:before { - content: "\e029"; -} -.glyphicon-repeat:before { - content: "\e030"; -} -.glyphicon-refresh:before { - content: "\e031"; -} -.glyphicon-list-alt:before { - content: "\e032"; -} -.glyphicon-lock:before { - content: "\e033"; -} -.glyphicon-flag:before { - content: "\e034"; -} -.glyphicon-headphones:before { - content: "\e035"; -} -.glyphicon-volume-off:before { - content: "\e036"; -} -.glyphicon-volume-down:before { - content: "\e037"; -} -.glyphicon-volume-up:before { - content: "\e038"; -} -.glyphicon-qrcode:before { - content: "\e039"; -} -.glyphicon-barcode:before { - content: "\e040"; -} -.glyphicon-tag:before { - content: "\e041"; -} -.glyphicon-tags:before { - content: "\e042"; -} -.glyphicon-book:before { - content: "\e043"; -} -.glyphicon-bookmark:before { - content: "\e044"; -} -.glyphicon-print:before { - content: "\e045"; -} -.glyphicon-camera:before { - content: "\e046"; -} -.glyphicon-font:before { - content: "\e047"; -} -.glyphicon-bold:before { - content: "\e048"; -} -.glyphicon-italic:before { - content: "\e049"; -} -.glyphicon-text-height:before { - content: "\e050"; -} -.glyphicon-text-width:before { - content: "\e051"; -} -.glyphicon-align-left:before { - content: "\e052"; -} -.glyphicon-align-center:before { - content: "\e053"; -} -.glyphicon-align-right:before { - content: "\e054"; -} -.glyphicon-align-justify:before { - content: "\e055"; -} -.glyphicon-list:before { - content: "\e056"; -} -.glyphicon-indent-left:before { - content: "\e057"; -} -.glyphicon-indent-right:before { - content: "\e058"; -} -.glyphicon-facetime-video:before { - content: "\e059"; -} -.glyphicon-picture:before { - content: "\e060"; -} -.glyphicon-map-marker:before { - content: "\e062"; -} -.glyphicon-adjust:before { - content: "\e063"; -} -.glyphicon-tint:before { - content: "\e064"; -} -.glyphicon-edit:before { - content: "\e065"; -} -.glyphicon-share:before { - content: "\e066"; -} -.glyphicon-check:before { - content: "\e067"; -} -.glyphicon-move:before { - content: "\e068"; -} -.glyphicon-step-backward:before { - content: "\e069"; -} -.glyphicon-fast-backward:before { - content: "\e070"; -} -.glyphicon-backward:before { - content: "\e071"; -} -.glyphicon-play:before { - content: "\e072"; -} -.glyphicon-pause:before { - content: "\e073"; -} -.glyphicon-stop:before { - content: "\e074"; -} -.glyphicon-forward:before { - content: "\e075"; -} -.glyphicon-fast-forward:before { - content: "\e076"; -} -.glyphicon-step-forward:before { - content: "\e077"; -} -.glyphicon-eject:before { - content: "\e078"; -} -.glyphicon-chevron-left:before { - content: "\e079"; -} -.glyphicon-chevron-right:before { - content: "\e080"; -} -.glyphicon-plus-sign:before { - content: "\e081"; -} -.glyphicon-minus-sign:before { - content: "\e082"; -} -.glyphicon-remove-sign:before { - content: "\e083"; -} -.glyphicon-ok-sign:before { - content: "\e084"; -} -.glyphicon-question-sign:before { - content: "\e085"; -} -.glyphicon-info-sign:before { - content: "\e086"; -} -.glyphicon-screenshot:before { - content: "\e087"; -} -.glyphicon-remove-circle:before { - content: "\e088"; -} -.glyphicon-ok-circle:before { - content: "\e089"; -} -.glyphicon-ban-circle:before { - content: "\e090"; -} -.glyphicon-arrow-left:before { - content: "\e091"; -} -.glyphicon-arrow-right:before { - content: "\e092"; -} -.glyphicon-arrow-up:before { - content: "\e093"; -} -.glyphicon-arrow-down:before { - content: "\e094"; -} -.glyphicon-share-alt:before { - content: "\e095"; -} -.glyphicon-resize-full:before { - content: "\e096"; -} -.glyphicon-resize-small:before { - content: "\e097"; -} -.glyphicon-exclamation-sign:before { - content: "\e101"; -} -.glyphicon-gift:before { - content: "\e102"; -} -.glyphicon-leaf:before { - content: "\e103"; -} -.glyphicon-fire:before { - content: "\e104"; -} -.glyphicon-eye-open:before { - content: "\e105"; -} -.glyphicon-eye-close:before { - content: "\e106"; -} -.glyphicon-warning-sign:before { - content: "\e107"; -} -.glyphicon-plane:before { - content: "\e108"; -} -.glyphicon-calendar:before { - content: "\e109"; -} -.glyphicon-random:before { - content: "\e110"; -} -.glyphicon-comment:before { - content: "\e111"; -} -.glyphicon-magnet:before { - content: "\e112"; -} -.glyphicon-chevron-up:before { - content: "\e113"; -} -.glyphicon-chevron-down:before { - content: "\e114"; -} -.glyphicon-retweet:before { - content: "\e115"; -} -.glyphicon-shopping-cart:before { - content: "\e116"; -} -.glyphicon-folder-close:before { - content: "\e117"; -} -.glyphicon-folder-open:before { - content: "\e118"; -} -.glyphicon-resize-vertical:before { - content: "\e119"; -} -.glyphicon-resize-horizontal:before { - content: "\e120"; -} -.glyphicon-hdd:before { - content: "\e121"; -} -.glyphicon-bullhorn:before { - content: "\e122"; -} -.glyphicon-bell:before { - content: "\e123"; -} -.glyphicon-certificate:before { - content: "\e124"; -} -.glyphicon-thumbs-up:before { - content: "\e125"; -} -.glyphicon-thumbs-down:before { - content: "\e126"; -} -.glyphicon-hand-right:before { - content: "\e127"; -} -.glyphicon-hand-left:before { - content: "\e128"; -} -.glyphicon-hand-up:before { - content: "\e129"; -} -.glyphicon-hand-down:before { - content: "\e130"; -} -.glyphicon-circle-arrow-right:before { - content: "\e131"; -} -.glyphicon-circle-arrow-left:before { - content: "\e132"; -} -.glyphicon-circle-arrow-up:before { - content: "\e133"; -} -.glyphicon-circle-arrow-down:before { - content: "\e134"; -} -.glyphicon-globe:before { - content: "\e135"; -} -.glyphicon-wrench:before { - content: "\e136"; -} -.glyphicon-tasks:before { - content: "\e137"; -} -.glyphicon-filter:before { - content: "\e138"; -} -.glyphicon-briefcase:before { - content: "\e139"; -} -.glyphicon-fullscreen:before { - content: "\e140"; -} -.glyphicon-dashboard:before { - content: "\e141"; -} -.glyphicon-paperclip:before { - content: "\e142"; -} -.glyphicon-heart-empty:before { - content: "\e143"; -} -.glyphicon-link:before { - content: "\e144"; -} -.glyphicon-phone:before { - content: "\e145"; -} -.glyphicon-pushpin:before { - content: "\e146"; -} -.glyphicon-usd:before { - content: "\e148"; -} -.glyphicon-gbp:before { - content: "\e149"; -} -.glyphicon-sort:before { - content: "\e150"; -} -.glyphicon-sort-by-alphabet:before { - content: "\e151"; -} -.glyphicon-sort-by-alphabet-alt:before { - content: "\e152"; -} -.glyphicon-sort-by-order:before { - content: "\e153"; -} -.glyphicon-sort-by-order-alt:before { - content: "\e154"; -} -.glyphicon-sort-by-attributes:before { - content: "\e155"; -} -.glyphicon-sort-by-attributes-alt:before { - content: "\e156"; -} -.glyphicon-unchecked:before { - content: "\e157"; -} -.glyphicon-expand:before { - content: "\e158"; -} -.glyphicon-collapse-down:before { - content: "\e159"; -} -.glyphicon-collapse-up:before { - content: "\e160"; -} -.glyphicon-log-in:before { - content: "\e161"; -} -.glyphicon-flash:before { - content: "\e162"; -} -.glyphicon-log-out:before { - content: "\e163"; -} -.glyphicon-new-window:before { - content: "\e164"; -} -.glyphicon-record:before { - content: "\e165"; -} -.glyphicon-save:before { - content: "\e166"; -} -.glyphicon-open:before { - content: "\e167"; -} -.glyphicon-saved:before { - content: "\e168"; -} -.glyphicon-import:before { - content: "\e169"; -} -.glyphicon-export:before { - content: "\e170"; -} -.glyphicon-send:before { - content: "\e171"; -} -.glyphicon-floppy-disk:before { - content: "\e172"; -} -.glyphicon-floppy-saved:before { - content: "\e173"; -} -.glyphicon-floppy-remove:before { - content: "\e174"; -} -.glyphicon-floppy-save:before { - content: "\e175"; -} -.glyphicon-floppy-open:before { - content: "\e176"; -} -.glyphicon-credit-card:before { - content: "\e177"; -} -.glyphicon-transfer:before { - content: "\e178"; -} -.glyphicon-cutlery:before { - content: "\e179"; -} -.glyphicon-header:before { - content: "\e180"; -} -.glyphicon-compressed:before { - content: "\e181"; -} -.glyphicon-earphone:before { - content: "\e182"; -} -.glyphicon-phone-alt:before { - content: "\e183"; -} -.glyphicon-tower:before { - content: "\e184"; -} -.glyphicon-stats:before { - content: "\e185"; -} -.glyphicon-sd-video:before { - content: "\e186"; -} -.glyphicon-hd-video:before { - content: "\e187"; -} -.glyphicon-subtitles:before { - content: "\e188"; -} -.glyphicon-sound-stereo:before { - content: "\e189"; -} -.glyphicon-sound-dolby:before { - content: "\e190"; -} -.glyphicon-sound-5-1:before { - content: "\e191"; -} -.glyphicon-sound-6-1:before { - content: "\e192"; -} -.glyphicon-sound-7-1:before { - content: "\e193"; -} -.glyphicon-copyright-mark:before { - content: "\e194"; -} -.glyphicon-registration-mark:before { - content: "\e195"; -} -.glyphicon-cloud-download:before { - content: "\e197"; -} -.glyphicon-cloud-upload:before { - content: "\e198"; -} -.glyphicon-tree-conifer:before { - content: "\e199"; -} -.glyphicon-tree-deciduous:before { - content: "\e200"; -} -.glyphicon-cd:before { - content: "\e201"; -} -.glyphicon-save-file:before { - content: "\e202"; -} -.glyphicon-open-file:before { - content: "\e203"; -} -.glyphicon-level-up:before { - content: "\e204"; -} -.glyphicon-copy:before { - content: "\e205"; -} -.glyphicon-paste:before { - content: "\e206"; -} -.glyphicon-alert:before { - content: "\e209"; -} -.glyphicon-equalizer:before { - content: "\e210"; -} -.glyphicon-king:before { - content: "\e211"; -} -.glyphicon-queen:before { - content: "\e212"; -} -.glyphicon-pawn:before { - content: "\e213"; -} -.glyphicon-bishop:before { - content: "\e214"; -} -.glyphicon-knight:before { - content: "\e215"; -} -.glyphicon-baby-formula:before { - content: "\e216"; -} -.glyphicon-tent:before { - content: "\26fa"; -} -.glyphicon-blackboard:before { - content: "\e218"; -} -.glyphicon-bed:before { - content: "\e219"; -} -.glyphicon-apple:before { - content: "\f8ff"; -} -.glyphicon-erase:before { - content: "\e221"; -} -.glyphicon-hourglass:before { - content: "\231b"; -} -.glyphicon-lamp:before { - content: "\e223"; -} -.glyphicon-duplicate:before { - content: "\e224"; -} -.glyphicon-piggy-bank:before { - content: "\e225"; -} -.glyphicon-scissors:before { - content: "\e226"; -} -.glyphicon-bitcoin:before { - content: "\e227"; -} -.glyphicon-btc:before { - content: "\e227"; -} -.glyphicon-xbt:before { - content: "\e227"; -} -.glyphicon-yen:before { - content: "\00a5"; -} -.glyphicon-jpy:before { - content: "\00a5"; -} -.glyphicon-ruble:before { - content: "\20bd"; -} -.glyphicon-rub:before { - content: "\20bd"; -} -.glyphicon-scale:before { - content: "\e230"; -} -.glyphicon-ice-lolly:before { - content: "\e231"; -} -.glyphicon-ice-lolly-tasted:before { - content: "\e232"; -} -.glyphicon-education:before { - content: "\e233"; -} -.glyphicon-option-horizontal:before { - content: "\e234"; -} -.glyphicon-option-vertical:before { - content: "\e235"; -} -.glyphicon-menu-hamburger:before { - content: "\e236"; -} -.glyphicon-modal-window:before { - content: "\e237"; -} -.glyphicon-oil:before { - content: "\e238"; -} -.glyphicon-grain:before { - content: "\e239"; -} -.glyphicon-sunglasses:before { - content: "\e240"; -} -.glyphicon-text-size:before { - content: "\e241"; -} -.glyphicon-text-color:before { - content: "\e242"; -} -.glyphicon-text-background:before { - content: "\e243"; -} -.glyphicon-object-align-top:before { - content: "\e244"; -} -.glyphicon-object-align-bottom:before { - content: "\e245"; -} -.glyphicon-object-align-horizontal:before { - content: "\e246"; -} -.glyphicon-object-align-left:before { - content: "\e247"; -} -.glyphicon-object-align-vertical:before { - content: "\e248"; -} -.glyphicon-object-align-right:before { - content: "\e249"; -} -.glyphicon-triangle-right:before { - content: "\e250"; -} -.glyphicon-triangle-left:before { - content: "\e251"; -} -.glyphicon-triangle-bottom:before { - content: "\e252"; -} -.glyphicon-triangle-top:before { - content: "\e253"; -} -.glyphicon-console:before { - content: "\e254"; -} -.glyphicon-superscript:before { - content: "\e255"; -} -.glyphicon-subscript:before { - content: "\e256"; -} -.glyphicon-menu-left:before { - content: "\e257"; -} -.glyphicon-menu-right:before { - content: "\e258"; -} -.glyphicon-menu-down:before { - content: "\e259"; -} -.glyphicon-menu-up:before { - content: "\e260"; -} -* { - -webkit-box-sizing: border-box; - -moz-box-sizing: border-box; - box-sizing: border-box; -} -*:before, -*:after { - -webkit-box-sizing: border-box; - -moz-box-sizing: border-box; - box-sizing: border-box; -} -html { - font-size: 10px; - - -webkit-tap-highlight-color: rgba(0, 0, 0, 0); -} -body { - font-family: "Helvetica Neue", Helvetica, Arial, sans-serif; - font-size: 14px; - line-height: 1.42857143; - color: #333; - background-color: #fff; -} -input, -button, -select, -textarea { - font-family: inherit; - font-size: inherit; - line-height: inherit; -} -a { - color: #337ab7; - text-decoration: none; -} -a:hover, -a:focus { - color: #23527c; - text-decoration: underline; -} -a:focus { - outline: thin dotted; - outline: 5px auto -webkit-focus-ring-color; - outline-offset: -2px; -} -figure { - margin: 0; -} -img { - vertical-align: middle; -} -.img-responsive, -.thumbnail > img, -.thumbnail a > img, -.carousel-inner > .item > img, -.carousel-inner > .item > a > img { - display: block; - max-width: 100%; - height: auto; -} -.img-rounded { - border-radius: 6px; -} -.img-thumbnail { - display: inline-block; - max-width: 100%; - height: auto; - padding: 4px; - line-height: 1.42857143; - background-color: #fff; - border: 1px solid #ddd; - border-radius: 4px; - -webkit-transition: all .2s ease-in-out; - -o-transition: all .2s ease-in-out; - transition: all .2s ease-in-out; -} -.img-circle { - border-radius: 50%; -} -hr { - margin-top: 20px; - margin-bottom: 20px; - border: 0; - border-top: 1px solid #eee; -} -.sr-only { - position: absolute; - width: 1px; - height: 1px; - padding: 0; - margin: -1px; - overflow: hidden; - clip: rect(0, 0, 0, 0); - border: 0; -} -.sr-only-focusable:active, -.sr-only-focusable:focus { - position: static; - width: auto; - height: auto; - margin: 0; - overflow: visible; - clip: auto; -} -[role="button"] { - cursor: pointer; -} -h1, -h2, -h3, -h4, -h5, -h6, -.h1, -.h2, -.h3, -.h4, -.h5, -.h6 { - font-family: inherit; - font-weight: 500; - line-height: 1.1; - color: inherit; -} -h1 small, -h2 small, -h3 small, -h4 small, -h5 small, -h6 small, -.h1 small, -.h2 small, -.h3 small, -.h4 small, -.h5 small, -.h6 small, -h1 .small, -h2 .small, -h3 .small, -h4 .small, -h5 .small, -h6 .small, -.h1 .small, -.h2 .small, -.h3 .small, -.h4 .small, -.h5 .small, -.h6 .small { - font-weight: normal; - line-height: 1; - color: #777; -} -h1, -.h1, -h2, -.h2, -h3, -.h3 { - margin-top: 20px; - margin-bottom: 10px; -} -h1 small, -.h1 small, -h2 small, -.h2 small, -h3 small, -.h3 small, -h1 .small, -.h1 .small, -h2 .small, -.h2 .small, -h3 .small, -.h3 .small { - font-size: 65%; -} -h4, -.h4, -h5, -.h5, -h6, -.h6 { - margin-top: 10px; - margin-bottom: 10px; -} -h4 small, -.h4 small, -h5 small, -.h5 small, -h6 small, -.h6 small, -h4 .small, -.h4 .small, -h5 .small, -.h5 .small, -h6 .small, -.h6 .small { - font-size: 75%; -} -h1, -.h1 { - font-size: 36px; -} -h2, -.h2 { - font-size: 30px; -} -h3, -.h3 { - font-size: 24px; -} -h4, -.h4 { - font-size: 18px; -} -h5, -.h5 { - font-size: 14px; -} -h6, -.h6 { - font-size: 12px; -} -p { - margin: 0 0 10px; -} -.lead { - margin-bottom: 20px; - font-size: 16px; - font-weight: 300; - line-height: 1.4; -} -@media (min-width: 768px) { - .lead { - font-size: 21px; - } -} -small, -.small { - font-size: 85%; -} -mark, -.mark { - padding: .2em; - background-color: #fcf8e3; -} -.text-left { - text-align: left; -} -.text-right { - text-align: right; -} -.text-center { - text-align: center; -} -.text-justify { - text-align: justify; -} -.text-nowrap { - white-space: nowrap; -} -.text-lowercase { - text-transform: lowercase; -} -.text-uppercase { - text-transform: uppercase; -} -.text-capitalize { - text-transform: capitalize; -} -.text-muted { - color: #777; -} -.text-primary { - color: #337ab7; -} -a.text-primary:hover, -a.text-primary:focus { - color: #286090; -} -.text-success { - color: #3c763d; -} -a.text-success:hover, -a.text-success:focus { - color: #2b542c; -} -.text-info { - color: #31708f; -} -a.text-info:hover, -a.text-info:focus { - color: #245269; -} -.text-warning { - color: #8a6d3b; -} -a.text-warning:hover, -a.text-warning:focus { - color: #66512c; -} -.text-danger { - color: #a94442; -} -a.text-danger:hover, -a.text-danger:focus { - color: #843534; -} -.bg-primary { - color: #fff; - background-color: #337ab7; -} -a.bg-primary:hover, -a.bg-primary:focus { - background-color: #286090; -} -.bg-success { - background-color: #dff0d8; -} -a.bg-success:hover, -a.bg-success:focus { - background-color: #c1e2b3; -} -.bg-info { - background-color: #d9edf7; -} -a.bg-info:hover, -a.bg-info:focus { - background-color: #afd9ee; -} -.bg-warning { - background-color: #fcf8e3; -} -a.bg-warning:hover, -a.bg-warning:focus { - background-color: #f7ecb5; -} -.bg-danger { - background-color: #f2dede; -} -a.bg-danger:hover, -a.bg-danger:focus { - background-color: #e4b9b9; -} -.page-header { - padding-bottom: 9px; - margin: 40px 0 20px; - border-bottom: 1px solid #eee; -} -ul, -ol { - margin-top: 0; - margin-bottom: 10px; -} -ul ul, -ol ul, -ul ol, -ol ol { - margin-bottom: 0; -} -.list-unstyled { - padding-left: 0; - list-style: none; -} -.list-inline { - padding-left: 0; - margin-left: -5px; - list-style: none; -} -.list-inline > li { - display: inline-block; - padding-right: 5px; - padding-left: 5px; -} -dl { - margin-top: 0; - margin-bottom: 20px; -} -dt, -dd { - line-height: 1.42857143; -} -dt { - font-weight: bold; -} -dd { - margin-left: 0; -} -@media (min-width: 768px) { - .dl-horizontal dt { - float: left; - width: 160px; - overflow: hidden; - clear: left; - text-align: right; - text-overflow: ellipsis; - white-space: nowrap; - } - .dl-horizontal dd { - margin-left: 180px; - } -} -abbr[title], -abbr[data-original-title] { - cursor: help; - border-bottom: 1px dotted #777; -} -.initialism { - font-size: 90%; - text-transform: uppercase; -} -blockquote { - padding: 10px 20px; - margin: 0 0 20px; - font-size: 17.5px; - border-left: 5px solid #eee; -} -blockquote p:last-child, -blockquote ul:last-child, -blockquote ol:last-child { - margin-bottom: 0; -} -blockquote footer, -blockquote small, -blockquote .small { - display: block; - font-size: 80%; - line-height: 1.42857143; - color: #777; -} -blockquote footer:before, -blockquote small:before, -blockquote .small:before { - content: '\2014 \00A0'; -} -.blockquote-reverse, -blockquote.pull-right { - padding-right: 15px; - padding-left: 0; - text-align: right; - border-right: 5px solid #eee; - border-left: 0; -} -.blockquote-reverse footer:before, -blockquote.pull-right footer:before, -.blockquote-reverse small:before, -blockquote.pull-right small:before, -.blockquote-reverse .small:before, -blockquote.pull-right .small:before { - content: ''; -} -.blockquote-reverse footer:after, -blockquote.pull-right footer:after, -.blockquote-reverse small:after, -blockquote.pull-right small:after, -.blockquote-reverse .small:after, -blockquote.pull-right .small:after { - content: '\00A0 \2014'; -} -address { - margin-bottom: 20px; - font-style: normal; - line-height: 1.42857143; -} -code, -kbd, -pre, -samp { - font-family: Menlo, Monaco, Consolas, "Courier New", monospace; -} -code { - padding: 2px 4px; - font-size: 90%; - color: #c7254e; - background-color: #f9f2f4; - border-radius: 4px; -} -kbd { - padding: 2px 4px; - font-size: 90%; - color: #fff; - background-color: #333; - border-radius: 3px; - -webkit-box-shadow: inset 0 -1px 0 rgba(0, 0, 0, .25); - box-shadow: inset 0 -1px 0 rgba(0, 0, 0, .25); -} -kbd kbd { - padding: 0; - font-size: 100%; - font-weight: bold; - -webkit-box-shadow: none; - box-shadow: none; -} -pre { - display: block; - padding: 9.5px; - margin: 0 0 10px; - font-size: 13px; - line-height: 1.42857143; - color: #333; - word-break: break-all; - word-wrap: break-word; - background-color: #f5f5f5; - border: 1px solid #ccc; - border-radius: 4px; -} -pre code { - padding: 0; - font-size: inherit; - color: inherit; - white-space: pre-wrap; - background-color: transparent; - border-radius: 0; -} -.pre-scrollable { - max-height: 340px; - overflow-y: scroll; -} -.container { - padding-right: 15px; - padding-left: 15px; - margin-right: auto; - margin-left: auto; -} -@media (min-width: 768px) { - .container { - width: 750px; - } -} -@media (min-width: 992px) { - .container { - width: 970px; - } -} -@media (min-width: 1200px) { - .container { - width: 1170px; - } -} -.container-fluid { - padding-right: 15px; - padding-left: 15px; - margin-right: auto; - margin-left: auto; -} -.row { - margin-right: -15px; - margin-left: -15px; -} -.col-xs-1, .col-sm-1, .col-md-1, .col-lg-1, .col-xs-2, .col-sm-2, .col-md-2, .col-lg-2, .col-xs-3, .col-sm-3, .col-md-3, .col-lg-3, .col-xs-4, .col-sm-4, .col-md-4, .col-lg-4, .col-xs-5, .col-sm-5, .col-md-5, .col-lg-5, .col-xs-6, .col-sm-6, .col-md-6, .col-lg-6, .col-xs-7, .col-sm-7, .col-md-7, .col-lg-7, .col-xs-8, .col-sm-8, .col-md-8, .col-lg-8, .col-xs-9, .col-sm-9, .col-md-9, .col-lg-9, .col-xs-10, .col-sm-10, .col-md-10, .col-lg-10, .col-xs-11, .col-sm-11, .col-md-11, .col-lg-11, .col-xs-12, .col-sm-12, .col-md-12, .col-lg-12 { - position: relative; - min-height: 1px; - padding-right: 15px; - padding-left: 15px; -} -.col-xs-1, .col-xs-2, .col-xs-3, .col-xs-4, .col-xs-5, .col-xs-6, .col-xs-7, .col-xs-8, .col-xs-9, .col-xs-10, .col-xs-11, .col-xs-12 { - float: left; -} -.col-xs-12 { - width: 100%; -} -.col-xs-11 { - width: 91.66666667%; -} -.col-xs-10 { - width: 83.33333333%; -} -.col-xs-9 { - width: 75%; -} -.col-xs-8 { - width: 66.66666667%; -} -.col-xs-7 { - width: 58.33333333%; -} -.col-xs-6 { - width: 50%; -} -.col-xs-5 { - width: 41.66666667%; -} -.col-xs-4 { - width: 33.33333333%; -} -.col-xs-3 { - width: 25%; -} -.col-xs-2 { - width: 16.66666667%; -} -.col-xs-1 { - width: 8.33333333%; -} -.col-xs-pull-12 { - right: 100%; -} -.col-xs-pull-11 { - right: 91.66666667%; -} -.col-xs-pull-10 { - right: 83.33333333%; -} -.col-xs-pull-9 { - right: 75%; -} -.col-xs-pull-8 { - right: 66.66666667%; -} -.col-xs-pull-7 { - right: 58.33333333%; -} -.col-xs-pull-6 { - right: 50%; -} -.col-xs-pull-5 { - right: 41.66666667%; -} -.col-xs-pull-4 { - right: 33.33333333%; -} -.col-xs-pull-3 { - right: 25%; -} -.col-xs-pull-2 { - right: 16.66666667%; -} -.col-xs-pull-1 { - right: 8.33333333%; -} -.col-xs-pull-0 { - right: auto; -} -.col-xs-push-12 { - left: 100%; -} -.col-xs-push-11 { - left: 91.66666667%; -} -.col-xs-push-10 { - left: 83.33333333%; -} -.col-xs-push-9 { - left: 75%; -} -.col-xs-push-8 { - left: 66.66666667%; -} -.col-xs-push-7 { - left: 58.33333333%; -} -.col-xs-push-6 { - left: 50%; -} -.col-xs-push-5 { - left: 41.66666667%; -} -.col-xs-push-4 { - left: 33.33333333%; -} -.col-xs-push-3 { - left: 25%; -} -.col-xs-push-2 { - left: 16.66666667%; -} -.col-xs-push-1 { - left: 8.33333333%; -} -.col-xs-push-0 { - left: auto; -} -.col-xs-offset-12 { - margin-left: 100%; -} -.col-xs-offset-11 { - margin-left: 91.66666667%; -} -.col-xs-offset-10 { - margin-left: 83.33333333%; -} -.col-xs-offset-9 { - margin-left: 75%; -} -.col-xs-offset-8 { - margin-left: 66.66666667%; -} -.col-xs-offset-7 { - margin-left: 58.33333333%; -} -.col-xs-offset-6 { - margin-left: 50%; -} -.col-xs-offset-5 { - margin-left: 41.66666667%; -} -.col-xs-offset-4 { - margin-left: 33.33333333%; -} -.col-xs-offset-3 { - margin-left: 25%; -} -.col-xs-offset-2 { - margin-left: 16.66666667%; -} -.col-xs-offset-1 { - margin-left: 8.33333333%; -} -.col-xs-offset-0 { - margin-left: 0; -} -@media (min-width: 768px) { - .col-sm-1, .col-sm-2, .col-sm-3, .col-sm-4, .col-sm-5, .col-sm-6, .col-sm-7, .col-sm-8, .col-sm-9, .col-sm-10, .col-sm-11, .col-sm-12 { - float: left; - } - .col-sm-12 { - width: 100%; - } - .col-sm-11 { - width: 91.66666667%; - } - .col-sm-10 { - width: 83.33333333%; - } - .col-sm-9 { - width: 75%; - } - .col-sm-8 { - width: 66.66666667%; - } - .col-sm-7 { - width: 58.33333333%; - } - .col-sm-6 { - width: 50%; - } - .col-sm-5 { - width: 41.66666667%; - } - .col-sm-4 { - width: 33.33333333%; - } - .col-sm-3 { - width: 25%; - } - .col-sm-2 { - width: 16.66666667%; - } - .col-sm-1 { - width: 8.33333333%; - } - .col-sm-pull-12 { - right: 100%; - } - .col-sm-pull-11 { - right: 91.66666667%; - } - .col-sm-pull-10 { - right: 83.33333333%; - } - .col-sm-pull-9 { - right: 75%; - } - .col-sm-pull-8 { - right: 66.66666667%; - } - .col-sm-pull-7 { - right: 58.33333333%; - } - .col-sm-pull-6 { - right: 50%; - } - .col-sm-pull-5 { - right: 41.66666667%; - } - .col-sm-pull-4 { - right: 33.33333333%; - } - .col-sm-pull-3 { - right: 25%; - } - .col-sm-pull-2 { - right: 16.66666667%; - } - .col-sm-pull-1 { - right: 8.33333333%; - } - .col-sm-pull-0 { - right: auto; - } - .col-sm-push-12 { - left: 100%; - } - .col-sm-push-11 { - left: 91.66666667%; - } - .col-sm-push-10 { - left: 83.33333333%; - } - .col-sm-push-9 { - left: 75%; - } - .col-sm-push-8 { - left: 66.66666667%; - } - .col-sm-push-7 { - left: 58.33333333%; - } - .col-sm-push-6 { - left: 50%; - } - .col-sm-push-5 { - left: 41.66666667%; - } - .col-sm-push-4 { - left: 33.33333333%; - } - .col-sm-push-3 { - left: 25%; - } - .col-sm-push-2 { - left: 16.66666667%; - } - .col-sm-push-1 { - left: 8.33333333%; - } - .col-sm-push-0 { - left: auto; - } - .col-sm-offset-12 { - margin-left: 100%; - } - .col-sm-offset-11 { - margin-left: 91.66666667%; - } - .col-sm-offset-10 { - margin-left: 83.33333333%; - } - .col-sm-offset-9 { - margin-left: 75%; - } - .col-sm-offset-8 { - margin-left: 66.66666667%; - } - .col-sm-offset-7 { - margin-left: 58.33333333%; - } - .col-sm-offset-6 { - margin-left: 50%; - } - .col-sm-offset-5 { - margin-left: 41.66666667%; - } - .col-sm-offset-4 { - margin-left: 33.33333333%; - } - .col-sm-offset-3 { - margin-left: 25%; - } - .col-sm-offset-2 { - margin-left: 16.66666667%; - } - .col-sm-offset-1 { - margin-left: 8.33333333%; - } - .col-sm-offset-0 { - margin-left: 0; - } -} -@media (min-width: 992px) { - .col-md-1, .col-md-2, .col-md-3, .col-md-4, .col-md-5, .col-md-6, .col-md-7, .col-md-8, .col-md-9, .col-md-10, .col-md-11, .col-md-12 { - float: left; - } - .col-md-12 { - width: 100%; - } - .col-md-11 { - width: 91.66666667%; - } - .col-md-10 { - width: 83.33333333%; - } - .col-md-9 { - width: 75%; - } - .col-md-8 { - width: 66.66666667%; - } - .col-md-7 { - width: 58.33333333%; - } - .col-md-6 { - width: 50%; - } - .col-md-5 { - width: 41.66666667%; - } - .col-md-4 { - width: 33.33333333%; - } - .col-md-3 { - width: 25%; - } - .col-md-2 { - width: 16.66666667%; - } - .col-md-1 { - width: 8.33333333%; - } - .col-md-pull-12 { - right: 100%; - } - .col-md-pull-11 { - right: 91.66666667%; - } - .col-md-pull-10 { - right: 83.33333333%; - } - .col-md-pull-9 { - right: 75%; - } - .col-md-pull-8 { - right: 66.66666667%; - } - .col-md-pull-7 { - right: 58.33333333%; - } - .col-md-pull-6 { - right: 50%; - } - .col-md-pull-5 { - right: 41.66666667%; - } - .col-md-pull-4 { - right: 33.33333333%; - } - .col-md-pull-3 { - right: 25%; - } - .col-md-pull-2 { - right: 16.66666667%; - } - .col-md-pull-1 { - right: 8.33333333%; - } - .col-md-pull-0 { - right: auto; - } - .col-md-push-12 { - left: 100%; - } - .col-md-push-11 { - left: 91.66666667%; - } - .col-md-push-10 { - left: 83.33333333%; - } - .col-md-push-9 { - left: 75%; - } - .col-md-push-8 { - left: 66.66666667%; - } - .col-md-push-7 { - left: 58.33333333%; - } - .col-md-push-6 { - left: 50%; - } - .col-md-push-5 { - left: 41.66666667%; - } - .col-md-push-4 { - left: 33.33333333%; - } - .col-md-push-3 { - left: 25%; - } - .col-md-push-2 { - left: 16.66666667%; - } - .col-md-push-1 { - left: 8.33333333%; - } - .col-md-push-0 { - left: auto; - } - .col-md-offset-12 { - margin-left: 100%; - } - .col-md-offset-11 { - margin-left: 91.66666667%; - } - .col-md-offset-10 { - margin-left: 83.33333333%; - } - .col-md-offset-9 { - margin-left: 75%; - } - .col-md-offset-8 { - margin-left: 66.66666667%; - } - .col-md-offset-7 { - margin-left: 58.33333333%; - } - .col-md-offset-6 { - margin-left: 50%; - } - .col-md-offset-5 { - margin-left: 41.66666667%; - } - .col-md-offset-4 { - margin-left: 33.33333333%; - } - .col-md-offset-3 { - margin-left: 25%; - } - .col-md-offset-2 { - margin-left: 16.66666667%; - } - .col-md-offset-1 { - margin-left: 8.33333333%; - } - .col-md-offset-0 { - margin-left: 0; - } -} -@media (min-width: 1200px) { - .col-lg-1, .col-lg-2, .col-lg-3, .col-lg-4, .col-lg-5, .col-lg-6, .col-lg-7, .col-lg-8, .col-lg-9, .col-lg-10, .col-lg-11, .col-lg-12 { - float: left; - } - .col-lg-12 { - width: 100%; - } - .col-lg-11 { - width: 91.66666667%; - } - .col-lg-10 { - width: 83.33333333%; - } - .col-lg-9 { - width: 75%; - } - .col-lg-8 { - width: 66.66666667%; - } - .col-lg-7 { - width: 58.33333333%; - } - .col-lg-6 { - width: 50%; - } - .col-lg-5 { - width: 41.66666667%; - } - .col-lg-4 { - width: 33.33333333%; - } - .col-lg-3 { - width: 25%; - } - .col-lg-2 { - width: 16.66666667%; - } - .col-lg-1 { - width: 8.33333333%; - } - .col-lg-pull-12 { - right: 100%; - } - .col-lg-pull-11 { - right: 91.66666667%; - } - .col-lg-pull-10 { - right: 83.33333333%; - } - .col-lg-pull-9 { - right: 75%; - } - .col-lg-pull-8 { - right: 66.66666667%; - } - .col-lg-pull-7 { - right: 58.33333333%; - } - .col-lg-pull-6 { - right: 50%; - } - .col-lg-pull-5 { - right: 41.66666667%; - } - .col-lg-pull-4 { - right: 33.33333333%; - } - .col-lg-pull-3 { - right: 25%; - } - .col-lg-pull-2 { - right: 16.66666667%; - } - .col-lg-pull-1 { - right: 8.33333333%; - } - .col-lg-pull-0 { - right: auto; - } - .col-lg-push-12 { - left: 100%; - } - .col-lg-push-11 { - left: 91.66666667%; - } - .col-lg-push-10 { - left: 83.33333333%; - } - .col-lg-push-9 { - left: 75%; - } - .col-lg-push-8 { - left: 66.66666667%; - } - .col-lg-push-7 { - left: 58.33333333%; - } - .col-lg-push-6 { - left: 50%; - } - .col-lg-push-5 { - left: 41.66666667%; - } - .col-lg-push-4 { - left: 33.33333333%; - } - .col-lg-push-3 { - left: 25%; - } - .col-lg-push-2 { - left: 16.66666667%; - } - .col-lg-push-1 { - left: 8.33333333%; - } - .col-lg-push-0 { - left: auto; - } - .col-lg-offset-12 { - margin-left: 100%; - } - .col-lg-offset-11 { - margin-left: 91.66666667%; - } - .col-lg-offset-10 { - margin-left: 83.33333333%; - } - .col-lg-offset-9 { - margin-left: 75%; - } - .col-lg-offset-8 { - margin-left: 66.66666667%; - } - .col-lg-offset-7 { - margin-left: 58.33333333%; - } - .col-lg-offset-6 { - margin-left: 50%; - } - .col-lg-offset-5 { - margin-left: 41.66666667%; - } - .col-lg-offset-4 { - margin-left: 33.33333333%; - } - .col-lg-offset-3 { - margin-left: 25%; - } - .col-lg-offset-2 { - margin-left: 16.66666667%; - } - .col-lg-offset-1 { - margin-left: 8.33333333%; - } - .col-lg-offset-0 { - margin-left: 0; - } -} -table { - background-color: transparent; -} -caption { - padding-top: 8px; - padding-bottom: 8px; - color: #777; - text-align: left; -} -th { - text-align: left; -} -.table { - width: 100%; - max-width: 100%; - margin-bottom: 20px; -} -.table > thead > tr > th, -.table > tbody > tr > th, -.table > tfoot > tr > th, -.table > thead > tr > td, -.table > tbody > tr > td, -.table > tfoot > tr > td { - padding: 8px; - line-height: 1.42857143; - vertical-align: top; - border-top: 1px solid #ddd; -} -.table > thead > tr > th { - vertical-align: bottom; - border-bottom: 2px solid #ddd; -} -.table > caption + thead > tr:first-child > th, -.table > colgroup + thead > tr:first-child > th, -.table > thead:first-child > tr:first-child > th, -.table > caption + thead > tr:first-child > td, -.table > colgroup + thead > tr:first-child > td, -.table > thead:first-child > tr:first-child > td { - border-top: 0; -} -.table > tbody + tbody { - border-top: 2px solid #ddd; -} -.table .table { - background-color: #fff; -} -.table-condensed > thead > tr > th, -.table-condensed > tbody > tr > th, -.table-condensed > tfoot > tr > th, -.table-condensed > thead > tr > td, -.table-condensed > tbody > tr > td, -.table-condensed > tfoot > tr > td { - padding: 5px; -} -.table-bordered { - border: 1px solid #ddd; -} -.table-bordered > thead > tr > th, -.table-bordered > tbody > tr > th, -.table-bordered > tfoot > tr > th, -.table-bordered > thead > tr > td, -.table-bordered > tbody > tr > td, -.table-bordered > tfoot > tr > td { - border: 1px solid #ddd; -} -.table-bordered > thead > tr > th, -.table-bordered > thead > tr > td { - border-bottom-width: 2px; -} -.table-striped > tbody > tr:nth-of-type(odd) { - background-color: #f9f9f9; -} -.table-hover > tbody > tr:hover { - background-color: #f5f5f5; -} -table col[class*="col-"] { - position: static; - display: table-column; - float: none; -} -table td[class*="col-"], -table th[class*="col-"] { - position: static; - display: table-cell; - float: none; -} -.table > thead > tr > td.active, -.table > tbody > tr > td.active, -.table > tfoot > tr > td.active, -.table > thead > tr > th.active, -.table > tbody > tr > th.active, -.table > tfoot > tr > th.active, -.table > thead > tr.active > td, -.table > tbody > tr.active > td, -.table > tfoot > tr.active > td, -.table > thead > tr.active > th, -.table > tbody > tr.active > th, -.table > tfoot > tr.active > th { - background-color: #f5f5f5; -} -.table-hover > tbody > tr > td.active:hover, -.table-hover > tbody > tr > th.active:hover, -.table-hover > tbody > tr.active:hover > td, -.table-hover > tbody > tr:hover > .active, -.table-hover > tbody > tr.active:hover > th { - background-color: #e8e8e8; -} -.table > thead > tr > td.success, -.table > tbody > tr > td.success, -.table > tfoot > tr > td.success, -.table > thead > tr > th.success, -.table > tbody > tr > th.success, -.table > tfoot > tr > th.success, -.table > thead > tr.success > td, -.table > tbody > tr.success > td, -.table > tfoot > tr.success > td, -.table > thead > tr.success > th, -.table > tbody > tr.success > th, -.table > tfoot > tr.success > th { - background-color: #dff0d8; -} -.table-hover > tbody > tr > td.success:hover, -.table-hover > tbody > tr > th.success:hover, -.table-hover > tbody > tr.success:hover > td, -.table-hover > tbody > tr:hover > .success, -.table-hover > tbody > tr.success:hover > th { - background-color: #d0e9c6; -} -.table > thead > tr > td.info, -.table > tbody > tr > td.info, -.table > tfoot > tr > td.info, -.table > thead > tr > th.info, -.table > tbody > tr > th.info, -.table > tfoot > tr > th.info, -.table > thead > tr.info > td, -.table > tbody > tr.info > td, -.table > tfoot > tr.info > td, -.table > thead > tr.info > th, -.table > tbody > tr.info > th, -.table > tfoot > tr.info > th { - background-color: #d9edf7; -} -.table-hover > tbody > tr > td.info:hover, -.table-hover > tbody > tr > th.info:hover, -.table-hover > tbody > tr.info:hover > td, -.table-hover > tbody > tr:hover > .info, -.table-hover > tbody > tr.info:hover > th { - background-color: #c4e3f3; -} -.table > thead > tr > td.warning, -.table > tbody > tr > td.warning, -.table > tfoot > tr > td.warning, -.table > thead > tr > th.warning, -.table > tbody > tr > th.warning, -.table > tfoot > tr > th.warning, -.table > thead > tr.warning > td, -.table > tbody > tr.warning > td, -.table > tfoot > tr.warning > td, -.table > thead > tr.warning > th, -.table > tbody > tr.warning > th, -.table > tfoot > tr.warning > th { - background-color: #fcf8e3; -} -.table-hover > tbody > tr > td.warning:hover, -.table-hover > tbody > tr > th.warning:hover, -.table-hover > tbody > tr.warning:hover > td, -.table-hover > tbody > tr:hover > .warning, -.table-hover > tbody > tr.warning:hover > th { - background-color: #faf2cc; -} -.table > thead > tr > td.danger, -.table > tbody > tr > td.danger, -.table > tfoot > tr > td.danger, -.table > thead > tr > th.danger, -.table > tbody > tr > th.danger, -.table > tfoot > tr > th.danger, -.table > thead > tr.danger > td, -.table > tbody > tr.danger > td, -.table > tfoot > tr.danger > td, -.table > thead > tr.danger > th, -.table > tbody > tr.danger > th, -.table > tfoot > tr.danger > th { - background-color: #f2dede; -} -.table-hover > tbody > tr > td.danger:hover, -.table-hover > tbody > tr > th.danger:hover, -.table-hover > tbody > tr.danger:hover > td, -.table-hover > tbody > tr:hover > .danger, -.table-hover > tbody > tr.danger:hover > th { - background-color: #ebcccc; -} -.table-responsive { - min-height: .01%; - overflow-x: auto; -} -@media screen and (max-width: 767px) { - .table-responsive { - width: 100%; - margin-bottom: 15px; - overflow-y: hidden; - -ms-overflow-style: -ms-autohiding-scrollbar; - border: 1px solid #ddd; - } - .table-responsive > .table { - margin-bottom: 0; - } - .table-responsive > .table > thead > tr > th, - .table-responsive > .table > tbody > tr > th, - .table-responsive > .table > tfoot > tr > th, - .table-responsive > .table > thead > tr > td, - .table-responsive > .table > tbody > tr > td, - .table-responsive > .table > tfoot > tr > td { - white-space: nowrap; - } - .table-responsive > .table-bordered { - border: 0; - } - .table-responsive > .table-bordered > thead > tr > th:first-child, - .table-responsive > .table-bordered > tbody > tr > th:first-child, - .table-responsive > .table-bordered > tfoot > tr > th:first-child, - .table-responsive > .table-bordered > thead > tr > td:first-child, - .table-responsive > .table-bordered > tbody > tr > td:first-child, - .table-responsive > .table-bordered > tfoot > tr > td:first-child { - border-left: 0; - } - .table-responsive > .table-bordered > thead > tr > th:last-child, - .table-responsive > .table-bordered > tbody > tr > th:last-child, - .table-responsive > .table-bordered > tfoot > tr > th:last-child, - .table-responsive > .table-bordered > thead > tr > td:last-child, - .table-responsive > .table-bordered > tbody > tr > td:last-child, - .table-responsive > .table-bordered > tfoot > tr > td:last-child { - border-right: 0; - } - .table-responsive > .table-bordered > tbody > tr:last-child > th, - .table-responsive > .table-bordered > tfoot > tr:last-child > th, - .table-responsive > .table-bordered > tbody > tr:last-child > td, - .table-responsive > .table-bordered > tfoot > tr:last-child > td { - border-bottom: 0; - } -} -fieldset { - min-width: 0; - padding: 0; - margin: 0; - border: 0; -} -legend { - display: block; - width: 100%; - padding: 0; - margin-bottom: 20px; - font-size: 21px; - line-height: inherit; - color: #333; - border: 0; - border-bottom: 1px solid #e5e5e5; -} -label { - display: inline-block; - max-width: 100%; - margin-bottom: 5px; - font-weight: bold; -} -input[type="search"] { - -webkit-box-sizing: border-box; - -moz-box-sizing: border-box; - box-sizing: border-box; -} -input[type="radio"], -input[type="checkbox"] { - margin: 4px 0 0; - margin-top: 1px \9; - line-height: normal; -} -input[type="file"] { - display: block; -} -input[type="range"] { - display: block; - width: 100%; -} -select[multiple], -select[size] { - height: auto; -} -input[type="file"]:focus, -input[type="radio"]:focus, -input[type="checkbox"]:focus { - outline: thin dotted; - outline: 5px auto -webkit-focus-ring-color; - outline-offset: -2px; -} -output { - display: block; - padding-top: 7px; - font-size: 14px; - line-height: 1.42857143; - color: #555; -} -.form-control { - display: block; - width: 100%; - height: 34px; - padding: 6px 12px; - font-size: 14px; - line-height: 1.42857143; - color: #555; - background-color: #fff; - background-image: none; - border: 1px solid #ccc; - border-radius: 4px; - -webkit-box-shadow: inset 0 1px 1px rgba(0, 0, 0, .075); - box-shadow: inset 0 1px 1px rgba(0, 0, 0, .075); - -webkit-transition: border-color ease-in-out .15s, -webkit-box-shadow ease-in-out .15s; - -o-transition: border-color ease-in-out .15s, box-shadow ease-in-out .15s; - transition: border-color ease-in-out .15s, box-shadow ease-in-out .15s; -} -.form-control:focus { - border-color: #66afe9; - outline: 0; - -webkit-box-shadow: inset 0 1px 1px rgba(0,0,0,.075), 0 0 8px rgba(102, 175, 233, .6); - box-shadow: inset 0 1px 1px rgba(0,0,0,.075), 0 0 8px rgba(102, 175, 233, .6); -} -.form-control::-moz-placeholder { - color: #999; - opacity: 1; -} -.form-control:-ms-input-placeholder { - color: #999; -} -.form-control::-webkit-input-placeholder { - color: #999; -} -.form-control::-ms-expand { - background-color: transparent; - border: 0; -} -.form-control[disabled], -.form-control[readonly], -fieldset[disabled] .form-control { - background-color: #eee; - opacity: 1; -} -.form-control[disabled], -fieldset[disabled] .form-control { - cursor: not-allowed; -} -textarea.form-control { - height: auto; -} -input[type="search"] { - -webkit-appearance: none; -} -@media screen and (-webkit-min-device-pixel-ratio: 0) { - input[type="date"].form-control, - input[type="time"].form-control, - input[type="datetime-local"].form-control, - input[type="month"].form-control { - line-height: 34px; - } - input[type="date"].input-sm, - input[type="time"].input-sm, - input[type="datetime-local"].input-sm, - input[type="month"].input-sm, - .input-group-sm input[type="date"], - .input-group-sm input[type="time"], - .input-group-sm input[type="datetime-local"], - .input-group-sm input[type="month"] { - line-height: 30px; - } - input[type="date"].input-lg, - input[type="time"].input-lg, - input[type="datetime-local"].input-lg, - input[type="month"].input-lg, - .input-group-lg input[type="date"], - .input-group-lg input[type="time"], - .input-group-lg input[type="datetime-local"], - .input-group-lg input[type="month"] { - line-height: 46px; - } -} -.form-group { - margin-bottom: 15px; -} -.radio, -.checkbox { - position: relative; - display: block; - margin-top: 10px; - margin-bottom: 10px; -} -.radio label, -.checkbox label { - min-height: 20px; - padding-left: 20px; - margin-bottom: 0; - font-weight: normal; - cursor: pointer; -} -.radio input[type="radio"], -.radio-inline input[type="radio"], -.checkbox input[type="checkbox"], -.checkbox-inline input[type="checkbox"] { - position: absolute; - margin-top: 4px \9; - margin-left: -20px; -} -.radio + .radio, -.checkbox + .checkbox { - margin-top: -5px; -} -.radio-inline, -.checkbox-inline { - position: relative; - display: inline-block; - padding-left: 20px; - margin-bottom: 0; - font-weight: normal; - vertical-align: middle; - cursor: pointer; -} -.radio-inline + .radio-inline, -.checkbox-inline + .checkbox-inline { - margin-top: 0; - margin-left: 10px; -} -input[type="radio"][disabled], -input[type="checkbox"][disabled], -input[type="radio"].disabled, -input[type="checkbox"].disabled, -fieldset[disabled] input[type="radio"], -fieldset[disabled] input[type="checkbox"] { - cursor: not-allowed; -} -.radio-inline.disabled, -.checkbox-inline.disabled, -fieldset[disabled] .radio-inline, -fieldset[disabled] .checkbox-inline { - cursor: not-allowed; -} -.radio.disabled label, -.checkbox.disabled label, -fieldset[disabled] .radio label, -fieldset[disabled] .checkbox label { - cursor: not-allowed; -} -.form-control-static { - min-height: 34px; - padding-top: 7px; - padding-bottom: 7px; - margin-bottom: 0; -} -.form-control-static.input-lg, -.form-control-static.input-sm { - padding-right: 0; - padding-left: 0; -} -.input-sm { - height: 30px; - padding: 5px 10px; - font-size: 12px; - line-height: 1.5; - border-radius: 3px; -} -select.input-sm { - height: 30px; - line-height: 30px; -} -textarea.input-sm, -select[multiple].input-sm { - height: auto; -} -.form-group-sm .form-control { - height: 30px; - padding: 5px 10px; - font-size: 12px; - line-height: 1.5; - border-radius: 3px; -} -.form-group-sm select.form-control { - height: 30px; - line-height: 30px; -} -.form-group-sm textarea.form-control, -.form-group-sm select[multiple].form-control { - height: auto; -} -.form-group-sm .form-control-static { - height: 30px; - min-height: 32px; - padding: 6px 10px; - font-size: 12px; - line-height: 1.5; -} -.input-lg { - height: 46px; - padding: 10px 16px; - font-size: 18px; - line-height: 1.3333333; - border-radius: 6px; -} -select.input-lg { - height: 46px; - line-height: 46px; -} -textarea.input-lg, -select[multiple].input-lg { - height: auto; -} -.form-group-lg .form-control { - height: 46px; - padding: 10px 16px; - font-size: 18px; - line-height: 1.3333333; - border-radius: 6px; -} -.form-group-lg select.form-control { - height: 46px; - line-height: 46px; -} -.form-group-lg textarea.form-control, -.form-group-lg select[multiple].form-control { - height: auto; -} -.form-group-lg .form-control-static { - height: 46px; - min-height: 38px; - padding: 11px 16px; - font-size: 18px; - line-height: 1.3333333; -} -.has-feedback { - position: relative; -} -.has-feedback .form-control { - padding-right: 42.5px; -} -.form-control-feedback { - position: absolute; - top: 0; - right: 0; - z-index: 2; - display: block; - width: 34px; - height: 34px; - line-height: 34px; - text-align: center; - pointer-events: none; -} -.input-lg + .form-control-feedback, -.input-group-lg + .form-control-feedback, -.form-group-lg .form-control + .form-control-feedback { - width: 46px; - height: 46px; - line-height: 46px; -} -.input-sm + .form-control-feedback, -.input-group-sm + .form-control-feedback, -.form-group-sm .form-control + .form-control-feedback { - width: 30px; - height: 30px; - line-height: 30px; -} -.has-success .help-block, -.has-success .control-label, -.has-success .radio, -.has-success .checkbox, -.has-success .radio-inline, -.has-success .checkbox-inline, -.has-success.radio label, -.has-success.checkbox label, -.has-success.radio-inline label, -.has-success.checkbox-inline label { - color: #3c763d; -} -.has-success .form-control { - border-color: #3c763d; - -webkit-box-shadow: inset 0 1px 1px rgba(0, 0, 0, .075); - box-shadow: inset 0 1px 1px rgba(0, 0, 0, .075); -} -.has-success .form-control:focus { - border-color: #2b542c; - -webkit-box-shadow: inset 0 1px 1px rgba(0, 0, 0, .075), 0 0 6px #67b168; - box-shadow: inset 0 1px 1px rgba(0, 0, 0, .075), 0 0 6px #67b168; -} -.has-success .input-group-addon { - color: #3c763d; - background-color: #dff0d8; - border-color: #3c763d; -} -.has-success .form-control-feedback { - color: #3c763d; -} -.has-warning .help-block, -.has-warning .control-label, -.has-warning .radio, -.has-warning .checkbox, -.has-warning .radio-inline, -.has-warning .checkbox-inline, -.has-warning.radio label, -.has-warning.checkbox label, -.has-warning.radio-inline label, -.has-warning.checkbox-inline label { - color: #8a6d3b; -} -.has-warning .form-control { - border-color: #8a6d3b; - -webkit-box-shadow: inset 0 1px 1px rgba(0, 0, 0, .075); - box-shadow: inset 0 1px 1px rgba(0, 0, 0, .075); -} -.has-warning .form-control:focus { - border-color: #66512c; - -webkit-box-shadow: inset 0 1px 1px rgba(0, 0, 0, .075), 0 0 6px #c0a16b; - box-shadow: inset 0 1px 1px rgba(0, 0, 0, .075), 0 0 6px #c0a16b; -} -.has-warning .input-group-addon { - color: #8a6d3b; - background-color: #fcf8e3; - border-color: #8a6d3b; -} -.has-warning .form-control-feedback { - color: #8a6d3b; -} -.has-error .help-block, -.has-error .control-label, -.has-error .radio, -.has-error .checkbox, -.has-error .radio-inline, -.has-error .checkbox-inline, -.has-error.radio label, -.has-error.checkbox label, -.has-error.radio-inline label, -.has-error.checkbox-inline label { - color: #a94442; -} -.has-error .form-control { - border-color: #a94442; - -webkit-box-shadow: inset 0 1px 1px rgba(0, 0, 0, .075); - box-shadow: inset 0 1px 1px rgba(0, 0, 0, .075); -} -.has-error .form-control:focus { - border-color: #843534; - -webkit-box-shadow: inset 0 1px 1px rgba(0, 0, 0, .075), 0 0 6px #ce8483; - box-shadow: inset 0 1px 1px rgba(0, 0, 0, .075), 0 0 6px #ce8483; -} -.has-error .input-group-addon { - color: #a94442; - background-color: #f2dede; - border-color: #a94442; -} -.has-error .form-control-feedback { - color: #a94442; -} -.has-feedback label ~ .form-control-feedback { - top: 25px; -} -.has-feedback label.sr-only ~ .form-control-feedback { - top: 0; -} -.help-block { - display: block; - margin-top: 5px; - margin-bottom: 10px; - color: #737373; -} -@media (min-width: 768px) { - .form-inline .form-group { - display: inline-block; - margin-bottom: 0; - vertical-align: middle; - } - .form-inline .form-control { - display: inline-block; - width: auto; - vertical-align: middle; - } - .form-inline .form-control-static { - display: inline-block; - } - .form-inline .input-group { - display: inline-table; - vertical-align: middle; - } - .form-inline .input-group .input-group-addon, - .form-inline .input-group .input-group-btn, - .form-inline .input-group .form-control { - width: auto; - } - .form-inline .input-group > .form-control { - width: 100%; - } - .form-inline .control-label { - margin-bottom: 0; - vertical-align: middle; - } - .form-inline .radio, - .form-inline .checkbox { - display: inline-block; - margin-top: 0; - margin-bottom: 0; - vertical-align: middle; - } - .form-inline .radio label, - .form-inline .checkbox label { - padding-left: 0; - } - .form-inline .radio input[type="radio"], - .form-inline .checkbox input[type="checkbox"] { - position: relative; - margin-left: 0; - } - .form-inline .has-feedback .form-control-feedback { - top: 0; - } -} -.form-horizontal .radio, -.form-horizontal .checkbox, -.form-horizontal .radio-inline, -.form-horizontal .checkbox-inline { - padding-top: 7px; - margin-top: 0; - margin-bottom: 0; -} -.form-horizontal .radio, -.form-horizontal .checkbox { - min-height: 27px; -} -.form-horizontal .form-group { - margin-right: -15px; - margin-left: -15px; -} -@media (min-width: 768px) { - .form-horizontal .control-label { - padding-top: 7px; - margin-bottom: 0; - text-align: right; - } -} -.form-horizontal .has-feedback .form-control-feedback { - right: 15px; -} -@media (min-width: 768px) { - .form-horizontal .form-group-lg .control-label { - padding-top: 11px; - font-size: 18px; - } -} -@media (min-width: 768px) { - .form-horizontal .form-group-sm .control-label { - padding-top: 6px; - font-size: 12px; - } -} -.btn { - display: inline-block; - padding: 6px 12px; - margin-bottom: 0; - font-size: 14px; - font-weight: normal; - line-height: 1.42857143; - text-align: center; - white-space: nowrap; - vertical-align: middle; - -ms-touch-action: manipulation; - touch-action: manipulation; - cursor: pointer; - -webkit-user-select: none; - -moz-user-select: none; - -ms-user-select: none; - user-select: none; - background-image: none; - border: 1px solid transparent; - border-radius: 4px; -} -.btn:focus, -.btn:active:focus, -.btn.active:focus, -.btn.focus, -.btn:active.focus, -.btn.active.focus { - outline: thin dotted; - outline: 5px auto -webkit-focus-ring-color; - outline-offset: -2px; -} -.btn:hover, -.btn:focus, -.btn.focus { - color: #333; - text-decoration: none; -} -.btn:active, -.btn.active { - background-image: none; - outline: 0; - -webkit-box-shadow: inset 0 3px 5px rgba(0, 0, 0, .125); - box-shadow: inset 0 3px 5px rgba(0, 0, 0, .125); -} -.btn.disabled, -.btn[disabled], -fieldset[disabled] .btn { - cursor: not-allowed; - filter: alpha(opacity=65); - -webkit-box-shadow: none; - box-shadow: none; - opacity: .65; -} -a.btn.disabled, -fieldset[disabled] a.btn { - pointer-events: none; -} -.btn-default { - color: #333; - background-color: #fff; - border-color: #ccc; -} -.btn-default:focus, -.btn-default.focus { - color: #333; - background-color: #e6e6e6; - border-color: #8c8c8c; -} -.btn-default:hover { - color: #333; - background-color: #e6e6e6; - border-color: #adadad; -} -.btn-default:active, -.btn-default.active, -.open > .dropdown-toggle.btn-default { - color: #333; - background-color: #e6e6e6; - border-color: #adadad; -} -.btn-default:active:hover, -.btn-default.active:hover, -.open > .dropdown-toggle.btn-default:hover, -.btn-default:active:focus, -.btn-default.active:focus, -.open > .dropdown-toggle.btn-default:focus, -.btn-default:active.focus, -.btn-default.active.focus, -.open > .dropdown-toggle.btn-default.focus { - color: #333; - background-color: #d4d4d4; - border-color: #8c8c8c; -} -.btn-default:active, -.btn-default.active, -.open > .dropdown-toggle.btn-default { - background-image: none; -} -.btn-default.disabled:hover, -.btn-default[disabled]:hover, -fieldset[disabled] .btn-default:hover, -.btn-default.disabled:focus, -.btn-default[disabled]:focus, -fieldset[disabled] .btn-default:focus, -.btn-default.disabled.focus, -.btn-default[disabled].focus, -fieldset[disabled] .btn-default.focus { - background-color: #fff; - border-color: #ccc; -} -.btn-default .badge { - color: #fff; - background-color: #333; -} -.btn-primary { - color: #fff; - background-color: #337ab7; - border-color: #2e6da4; -} -.btn-primary:focus, -.btn-primary.focus { - color: #fff; - background-color: #286090; - border-color: #122b40; -} -.btn-primary:hover { - color: #fff; - background-color: #286090; - border-color: #204d74; -} -.btn-primary:active, -.btn-primary.active, -.open > .dropdown-toggle.btn-primary { - color: #fff; - background-color: #286090; - border-color: #204d74; -} -.btn-primary:active:hover, -.btn-primary.active:hover, -.open > .dropdown-toggle.btn-primary:hover, -.btn-primary:active:focus, -.btn-primary.active:focus, -.open > .dropdown-toggle.btn-primary:focus, -.btn-primary:active.focus, -.btn-primary.active.focus, -.open > .dropdown-toggle.btn-primary.focus { - color: #fff; - background-color: #204d74; - border-color: #122b40; -} -.btn-primary:active, -.btn-primary.active, -.open > .dropdown-toggle.btn-primary { - background-image: none; -} -.btn-primary.disabled:hover, -.btn-primary[disabled]:hover, -fieldset[disabled] .btn-primary:hover, -.btn-primary.disabled:focus, -.btn-primary[disabled]:focus, -fieldset[disabled] .btn-primary:focus, -.btn-primary.disabled.focus, -.btn-primary[disabled].focus, -fieldset[disabled] .btn-primary.focus { - background-color: #337ab7; - border-color: #2e6da4; -} -.btn-primary .badge { - color: #337ab7; - background-color: #fff; -} -.btn-success { - color: #fff; - background-color: #5cb85c; - border-color: #4cae4c; -} -.btn-success:focus, -.btn-success.focus { - color: #fff; - background-color: #449d44; - border-color: #255625; -} -.btn-success:hover { - color: #fff; - background-color: #449d44; - border-color: #398439; -} -.btn-success:active, -.btn-success.active, -.open > .dropdown-toggle.btn-success { - color: #fff; - background-color: #449d44; - border-color: #398439; -} -.btn-success:active:hover, -.btn-success.active:hover, -.open > .dropdown-toggle.btn-success:hover, -.btn-success:active:focus, -.btn-success.active:focus, -.open > .dropdown-toggle.btn-success:focus, -.btn-success:active.focus, -.btn-success.active.focus, -.open > .dropdown-toggle.btn-success.focus { - color: #fff; - background-color: #398439; - border-color: #255625; -} -.btn-success:active, -.btn-success.active, -.open > .dropdown-toggle.btn-success { - background-image: none; -} -.btn-success.disabled:hover, -.btn-success[disabled]:hover, -fieldset[disabled] .btn-success:hover, -.btn-success.disabled:focus, -.btn-success[disabled]:focus, -fieldset[disabled] .btn-success:focus, -.btn-success.disabled.focus, -.btn-success[disabled].focus, -fieldset[disabled] .btn-success.focus { - background-color: #5cb85c; - border-color: #4cae4c; -} -.btn-success .badge { - color: #5cb85c; - background-color: #fff; -} -.btn-info { - color: #fff; - background-color: #5bc0de; - border-color: #46b8da; -} -.btn-info:focus, -.btn-info.focus { - color: #fff; - background-color: #31b0d5; - border-color: #1b6d85; -} -.btn-info:hover { - color: #fff; - background-color: #31b0d5; - border-color: #269abc; -} -.btn-info:active, -.btn-info.active, -.open > .dropdown-toggle.btn-info { - color: #fff; - background-color: #31b0d5; - border-color: #269abc; -} -.btn-info:active:hover, -.btn-info.active:hover, -.open > .dropdown-toggle.btn-info:hover, -.btn-info:active:focus, -.btn-info.active:focus, -.open > .dropdown-toggle.btn-info:focus, -.btn-info:active.focus, -.btn-info.active.focus, -.open > .dropdown-toggle.btn-info.focus { - color: #fff; - background-color: #269abc; - border-color: #1b6d85; -} -.btn-info:active, -.btn-info.active, -.open > .dropdown-toggle.btn-info { - background-image: none; -} -.btn-info.disabled:hover, -.btn-info[disabled]:hover, -fieldset[disabled] .btn-info:hover, -.btn-info.disabled:focus, -.btn-info[disabled]:focus, -fieldset[disabled] .btn-info:focus, -.btn-info.disabled.focus, -.btn-info[disabled].focus, -fieldset[disabled] .btn-info.focus { - background-color: #5bc0de; - border-color: #46b8da; -} -.btn-info .badge { - color: #5bc0de; - background-color: #fff; -} -.btn-warning { - color: #fff; - background-color: #f0ad4e; - border-color: #eea236; -} -.btn-warning:focus, -.btn-warning.focus { - color: #fff; - background-color: #ec971f; - border-color: #985f0d; -} -.btn-warning:hover { - color: #fff; - background-color: #ec971f; - border-color: #d58512; -} -.btn-warning:active, -.btn-warning.active, -.open > .dropdown-toggle.btn-warning { - color: #fff; - background-color: #ec971f; - border-color: #d58512; -} -.btn-warning:active:hover, -.btn-warning.active:hover, -.open > .dropdown-toggle.btn-warning:hover, -.btn-warning:active:focus, -.btn-warning.active:focus, -.open > .dropdown-toggle.btn-warning:focus, -.btn-warning:active.focus, -.btn-warning.active.focus, -.open > .dropdown-toggle.btn-warning.focus { - color: #fff; - background-color: #d58512; - border-color: #985f0d; -} -.btn-warning:active, -.btn-warning.active, -.open > .dropdown-toggle.btn-warning { - background-image: none; -} -.btn-warning.disabled:hover, -.btn-warning[disabled]:hover, -fieldset[disabled] .btn-warning:hover, -.btn-warning.disabled:focus, -.btn-warning[disabled]:focus, -fieldset[disabled] .btn-warning:focus, -.btn-warning.disabled.focus, -.btn-warning[disabled].focus, -fieldset[disabled] .btn-warning.focus { - background-color: #f0ad4e; - border-color: #eea236; -} -.btn-warning .badge { - color: #f0ad4e; - background-color: #fff; -} -.btn-danger { - color: #fff; - background-color: #d9534f; - border-color: #d43f3a; -} -.btn-danger:focus, -.btn-danger.focus { - color: #fff; - background-color: #c9302c; - border-color: #761c19; -} -.btn-danger:hover { - color: #fff; - background-color: #c9302c; - border-color: #ac2925; -} -.btn-danger:active, -.btn-danger.active, -.open > .dropdown-toggle.btn-danger { - color: #fff; - background-color: #c9302c; - border-color: #ac2925; -} -.btn-danger:active:hover, -.btn-danger.active:hover, -.open > .dropdown-toggle.btn-danger:hover, -.btn-danger:active:focus, -.btn-danger.active:focus, -.open > .dropdown-toggle.btn-danger:focus, -.btn-danger:active.focus, -.btn-danger.active.focus, -.open > .dropdown-toggle.btn-danger.focus { - color: #fff; - background-color: #ac2925; - border-color: #761c19; -} -.btn-danger:active, -.btn-danger.active, -.open > .dropdown-toggle.btn-danger { - background-image: none; -} -.btn-danger.disabled:hover, -.btn-danger[disabled]:hover, -fieldset[disabled] .btn-danger:hover, -.btn-danger.disabled:focus, -.btn-danger[disabled]:focus, -fieldset[disabled] .btn-danger:focus, -.btn-danger.disabled.focus, -.btn-danger[disabled].focus, -fieldset[disabled] .btn-danger.focus { - background-color: #d9534f; - border-color: #d43f3a; -} -.btn-danger .badge { - color: #d9534f; - background-color: #fff; -} -.btn-link { - font-weight: normal; - color: #337ab7; - border-radius: 0; -} -.btn-link, -.btn-link:active, -.btn-link.active, -.btn-link[disabled], -fieldset[disabled] .btn-link { - background-color: transparent; - -webkit-box-shadow: none; - box-shadow: none; -} -.btn-link, -.btn-link:hover, -.btn-link:focus, -.btn-link:active { - border-color: transparent; -} -.btn-link:hover, -.btn-link:focus { - color: #23527c; - text-decoration: underline; - background-color: transparent; -} -.btn-link[disabled]:hover, -fieldset[disabled] .btn-link:hover, -.btn-link[disabled]:focus, -fieldset[disabled] .btn-link:focus { - color: #777; - text-decoration: none; -} -.btn-lg, -.btn-group-lg > .btn { - padding: 10px 16px; - font-size: 18px; - line-height: 1.3333333; - border-radius: 6px; -} -.btn-sm, -.btn-group-sm > .btn { - padding: 5px 10px; - font-size: 12px; - line-height: 1.5; - border-radius: 3px; -} -.btn-xs, -.btn-group-xs > .btn { - padding: 1px 5px; - font-size: 12px; - line-height: 1.5; - border-radius: 3px; -} -.btn-block { - display: block; - width: 100%; -} -.btn-block + .btn-block { - margin-top: 5px; -} -input[type="submit"].btn-block, -input[type="reset"].btn-block, -input[type="button"].btn-block { - width: 100%; -} -.fade { - opacity: 0; - -webkit-transition: opacity .15s linear; - -o-transition: opacity .15s linear; - transition: opacity .15s linear; -} -.fade.in { - opacity: 1; -} -.collapse { - display: none; -} -.collapse.in { - display: block; -} -tr.collapse.in { - display: table-row; -} -tbody.collapse.in { - display: table-row-group; -} -.collapsing { - position: relative; - height: 0; - overflow: hidden; - -webkit-transition-timing-function: ease; - -o-transition-timing-function: ease; - transition-timing-function: ease; - -webkit-transition-duration: .35s; - -o-transition-duration: .35s; - transition-duration: .35s; - -webkit-transition-property: height, visibility; - -o-transition-property: height, visibility; - transition-property: height, visibility; -} -.caret { - display: inline-block; - width: 0; - height: 0; - margin-left: 2px; - vertical-align: middle; - border-top: 4px dashed; - border-top: 4px solid \9; - border-right: 4px solid transparent; - border-left: 4px solid transparent; -} -.dropup, -.dropdown { - position: relative; -} -.dropdown-toggle:focus { - outline: 0; -} -.dropdown-menu { - position: absolute; - top: 100%; - left: 0; - z-index: 1000; - display: none; - float: left; - min-width: 160px; - padding: 5px 0; - margin: 2px 0 0; - font-size: 14px; - text-align: left; - list-style: none; - background-color: #fff; - -webkit-background-clip: padding-box; - background-clip: padding-box; - border: 1px solid #ccc; - border: 1px solid rgba(0, 0, 0, .15); - border-radius: 4px; - -webkit-box-shadow: 0 6px 12px rgba(0, 0, 0, .175); - box-shadow: 0 6px 12px rgba(0, 0, 0, .175); -} -.dropdown-menu.pull-right { - right: 0; - left: auto; -} -.dropdown-menu .divider { - height: 1px; - margin: 9px 0; - overflow: hidden; - background-color: #e5e5e5; -} -.dropdown-menu > li > a { - display: block; - padding: 3px 20px; - clear: both; - font-weight: normal; - line-height: 1.42857143; - color: #333; - white-space: nowrap; -} -.dropdown-menu > li > a:hover, -.dropdown-menu > li > a:focus { - color: #262626; - text-decoration: none; - background-color: #f5f5f5; -} -.dropdown-menu > .active > a, -.dropdown-menu > .active > a:hover, -.dropdown-menu > .active > a:focus { - color: #fff; - text-decoration: none; - background-color: #337ab7; - outline: 0; -} -.dropdown-menu > .disabled > a, -.dropdown-menu > .disabled > a:hover, -.dropdown-menu > .disabled > a:focus { - color: #777; -} -.dropdown-menu > .disabled > a:hover, -.dropdown-menu > .disabled > a:focus { - text-decoration: none; - cursor: not-allowed; - background-color: transparent; - background-image: none; - filter: progid:DXImageTransform.Microsoft.gradient(enabled = false); -} -.open > .dropdown-menu { - display: block; -} -.open > a { - outline: 0; -} -.dropdown-menu-right { - right: 0; - left: auto; -} -.dropdown-menu-left { - right: auto; - left: 0; -} -.dropdown-header { - display: block; - padding: 3px 20px; - font-size: 12px; - line-height: 1.42857143; - color: #777; - white-space: nowrap; -} -.dropdown-backdrop { - position: fixed; - top: 0; - right: 0; - bottom: 0; - left: 0; - z-index: 990; -} -.pull-right > .dropdown-menu { - right: 0; - left: auto; -} -.dropup .caret, -.navbar-fixed-bottom .dropdown .caret { - content: ""; - border-top: 0; - border-bottom: 4px dashed; - border-bottom: 4px solid \9; -} -.dropup .dropdown-menu, -.navbar-fixed-bottom .dropdown .dropdown-menu { - top: auto; - bottom: 100%; - margin-bottom: 2px; -} -@media (min-width: 768px) { - .navbar-right .dropdown-menu { - right: 0; - left: auto; - } - .navbar-right .dropdown-menu-left { - right: auto; - left: 0; - } -} -.btn-group, -.btn-group-vertical { - position: relative; - display: inline-block; - vertical-align: middle; -} -.btn-group > .btn, -.btn-group-vertical > .btn { - position: relative; - float: left; -} -.btn-group > .btn:hover, -.btn-group-vertical > .btn:hover, -.btn-group > .btn:focus, -.btn-group-vertical > .btn:focus, -.btn-group > .btn:active, -.btn-group-vertical > .btn:active, -.btn-group > .btn.active, -.btn-group-vertical > .btn.active { - z-index: 2; -} -.btn-group .btn + .btn, -.btn-group .btn + .btn-group, -.btn-group .btn-group + .btn, -.btn-group .btn-group + .btn-group { - margin-left: -1px; -} -.btn-toolbar { - margin-left: -5px; -} -.btn-toolbar .btn, -.btn-toolbar .btn-group, -.btn-toolbar .input-group { - float: left; -} -.btn-toolbar > .btn, -.btn-toolbar > .btn-group, -.btn-toolbar > .input-group { - margin-left: 5px; -} -.btn-group > .btn:not(:first-child):not(:last-child):not(.dropdown-toggle) { - border-radius: 0; -} -.btn-group > .btn:first-child { - margin-left: 0; -} -.btn-group > .btn:first-child:not(:last-child):not(.dropdown-toggle) { - border-top-right-radius: 0; - border-bottom-right-radius: 0; -} -.btn-group > .btn:last-child:not(:first-child), -.btn-group > .dropdown-toggle:not(:first-child) { - border-top-left-radius: 0; - border-bottom-left-radius: 0; -} -.btn-group > .btn-group { - float: left; -} -.btn-group > .btn-group:not(:first-child):not(:last-child) > .btn { - border-radius: 0; -} -.btn-group > .btn-group:first-child:not(:last-child) > .btn:last-child, -.btn-group > .btn-group:first-child:not(:last-child) > .dropdown-toggle { - border-top-right-radius: 0; - border-bottom-right-radius: 0; -} -.btn-group > .btn-group:last-child:not(:first-child) > .btn:first-child { - border-top-left-radius: 0; - border-bottom-left-radius: 0; -} -.btn-group .dropdown-toggle:active, -.btn-group.open .dropdown-toggle { - outline: 0; -} -.btn-group > .btn + .dropdown-toggle { - padding-right: 8px; - padding-left: 8px; -} -.btn-group > .btn-lg + .dropdown-toggle { - padding-right: 12px; - padding-left: 12px; -} -.btn-group.open .dropdown-toggle { - -webkit-box-shadow: inset 0 3px 5px rgba(0, 0, 0, .125); - box-shadow: inset 0 3px 5px rgba(0, 0, 0, .125); -} -.btn-group.open .dropdown-toggle.btn-link { - -webkit-box-shadow: none; - box-shadow: none; -} -.btn .caret { - margin-left: 0; -} -.btn-lg .caret { - border-width: 5px 5px 0; - border-bottom-width: 0; -} -.dropup .btn-lg .caret { - border-width: 0 5px 5px; -} -.btn-group-vertical > .btn, -.btn-group-vertical > .btn-group, -.btn-group-vertical > .btn-group > .btn { - display: block; - float: none; - width: 100%; - max-width: 100%; -} -.btn-group-vertical > .btn-group > .btn { - float: none; -} -.btn-group-vertical > .btn + .btn, -.btn-group-vertical > .btn + .btn-group, -.btn-group-vertical > .btn-group + .btn, -.btn-group-vertical > .btn-group + .btn-group { - margin-top: -1px; - margin-left: 0; -} -.btn-group-vertical > .btn:not(:first-child):not(:last-child) { - border-radius: 0; -} -.btn-group-vertical > .btn:first-child:not(:last-child) { - border-top-left-radius: 4px; - border-top-right-radius: 4px; - border-bottom-right-radius: 0; - border-bottom-left-radius: 0; -} -.btn-group-vertical > .btn:last-child:not(:first-child) { - border-top-left-radius: 0; - border-top-right-radius: 0; - border-bottom-right-radius: 4px; - border-bottom-left-radius: 4px; -} -.btn-group-vertical > .btn-group:not(:first-child):not(:last-child) > .btn { - border-radius: 0; -} -.btn-group-vertical > .btn-group:first-child:not(:last-child) > .btn:last-child, -.btn-group-vertical > .btn-group:first-child:not(:last-child) > .dropdown-toggle { - border-bottom-right-radius: 0; - border-bottom-left-radius: 0; -} -.btn-group-vertical > .btn-group:last-child:not(:first-child) > .btn:first-child { - border-top-left-radius: 0; - border-top-right-radius: 0; -} -.btn-group-justified { - display: table; - width: 100%; - table-layout: fixed; - border-collapse: separate; -} -.btn-group-justified > .btn, -.btn-group-justified > .btn-group { - display: table-cell; - float: none; - width: 1%; -} -.btn-group-justified > .btn-group .btn { - width: 100%; -} -.btn-group-justified > .btn-group .dropdown-menu { - left: auto; -} -[data-toggle="buttons"] > .btn input[type="radio"], -[data-toggle="buttons"] > .btn-group > .btn input[type="radio"], -[data-toggle="buttons"] > .btn input[type="checkbox"], -[data-toggle="buttons"] > .btn-group > .btn input[type="checkbox"] { - position: absolute; - clip: rect(0, 0, 0, 0); - pointer-events: none; -} -.input-group { - position: relative; - display: table; - border-collapse: separate; -} -.input-group[class*="col-"] { - float: none; - padding-right: 0; - padding-left: 0; -} -.input-group .form-control { - position: relative; - z-index: 2; - float: left; - width: 100%; - margin-bottom: 0; -} -.input-group .form-control:focus { - z-index: 3; -} -.input-group-lg > .form-control, -.input-group-lg > .input-group-addon, -.input-group-lg > .input-group-btn > .btn { - height: 46px; - padding: 10px 16px; - font-size: 18px; - line-height: 1.3333333; - border-radius: 6px; -} -select.input-group-lg > .form-control, -select.input-group-lg > .input-group-addon, -select.input-group-lg > .input-group-btn > .btn { - height: 46px; - line-height: 46px; -} -textarea.input-group-lg > .form-control, -textarea.input-group-lg > .input-group-addon, -textarea.input-group-lg > .input-group-btn > .btn, -select[multiple].input-group-lg > .form-control, -select[multiple].input-group-lg > .input-group-addon, -select[multiple].input-group-lg > .input-group-btn > .btn { - height: auto; -} -.input-group-sm > .form-control, -.input-group-sm > .input-group-addon, -.input-group-sm > .input-group-btn > .btn { - height: 30px; - padding: 5px 10px; - font-size: 12px; - line-height: 1.5; - border-radius: 3px; -} -select.input-group-sm > .form-control, -select.input-group-sm > .input-group-addon, -select.input-group-sm > .input-group-btn > .btn { - height: 30px; - line-height: 30px; -} -textarea.input-group-sm > .form-control, -textarea.input-group-sm > .input-group-addon, -textarea.input-group-sm > .input-group-btn > .btn, -select[multiple].input-group-sm > .form-control, -select[multiple].input-group-sm > .input-group-addon, -select[multiple].input-group-sm > .input-group-btn > .btn { - height: auto; -} -.input-group-addon, -.input-group-btn, -.input-group .form-control { - display: table-cell; -} -.input-group-addon:not(:first-child):not(:last-child), -.input-group-btn:not(:first-child):not(:last-child), -.input-group .form-control:not(:first-child):not(:last-child) { - border-radius: 0; -} -.input-group-addon, -.input-group-btn { - width: 1%; - white-space: nowrap; - vertical-align: middle; -} -.input-group-addon { - padding: 6px 12px; - font-size: 14px; - font-weight: normal; - line-height: 1; - color: #555; - text-align: center; - background-color: #eee; - border: 1px solid #ccc; - border-radius: 4px; -} -.input-group-addon.input-sm { - padding: 5px 10px; - font-size: 12px; - border-radius: 3px; -} -.input-group-addon.input-lg { - padding: 10px 16px; - font-size: 18px; - border-radius: 6px; -} -.input-group-addon input[type="radio"], -.input-group-addon input[type="checkbox"] { - margin-top: 0; -} -.input-group .form-control:first-child, -.input-group-addon:first-child, -.input-group-btn:first-child > .btn, -.input-group-btn:first-child > .btn-group > .btn, -.input-group-btn:first-child > .dropdown-toggle, -.input-group-btn:last-child > .btn:not(:last-child):not(.dropdown-toggle), -.input-group-btn:last-child > .btn-group:not(:last-child) > .btn { - border-top-right-radius: 0; - border-bottom-right-radius: 0; -} -.input-group-addon:first-child { - border-right: 0; -} -.input-group .form-control:last-child, -.input-group-addon:last-child, -.input-group-btn:last-child > .btn, -.input-group-btn:last-child > .btn-group > .btn, -.input-group-btn:last-child > .dropdown-toggle, -.input-group-btn:first-child > .btn:not(:first-child), -.input-group-btn:first-child > .btn-group:not(:first-child) > .btn { - border-top-left-radius: 0; - border-bottom-left-radius: 0; -} -.input-group-addon:last-child { - border-left: 0; -} -.input-group-btn { - position: relative; - font-size: 0; - white-space: nowrap; -} -.input-group-btn > .btn { - position: relative; -} -.input-group-btn > .btn + .btn { - margin-left: -1px; -} -.input-group-btn > .btn:hover, -.input-group-btn > .btn:focus, -.input-group-btn > .btn:active { - z-index: 2; -} -.input-group-btn:first-child > .btn, -.input-group-btn:first-child > .btn-group { - margin-right: -1px; -} -.input-group-btn:last-child > .btn, -.input-group-btn:last-child > .btn-group { - z-index: 2; - margin-left: -1px; -} -.nav { - padding-left: 0; - margin-bottom: 0; - list-style: none; -} -.nav > li { - position: relative; - display: block; -} -.nav > li > a { - position: relative; - display: block; - padding: 10px 15px; -} -.nav > li > a:hover, -.nav > li > a:focus { - text-decoration: none; - background-color: #eee; -} -.nav > li.disabled > a { - color: #777; -} -.nav > li.disabled > a:hover, -.nav > li.disabled > a:focus { - color: #777; - text-decoration: none; - cursor: not-allowed; - background-color: transparent; -} -.nav .open > a, -.nav .open > a:hover, -.nav .open > a:focus { - background-color: #eee; - border-color: #337ab7; -} -.nav .nav-divider { - height: 1px; - margin: 9px 0; - overflow: hidden; - background-color: #e5e5e5; -} -.nav > li > a > img { - max-width: none; -} -.nav-tabs { - border-bottom: 1px solid #ddd; -} -.nav-tabs > li { - float: left; - margin-bottom: -1px; -} -.nav-tabs > li > a { - margin-right: 2px; - line-height: 1.42857143; - border: 1px solid transparent; - border-radius: 4px 4px 0 0; -} -.nav-tabs > li > a:hover { - border-color: #eee #eee #ddd; -} -.nav-tabs > li.active > a, -.nav-tabs > li.active > a:hover, -.nav-tabs > li.active > a:focus { - color: #555; - cursor: default; - background-color: #fff; - border: 1px solid #ddd; - border-bottom-color: transparent; -} -.nav-tabs.nav-justified { - width: 100%; - border-bottom: 0; -} -.nav-tabs.nav-justified > li { - float: none; -} -.nav-tabs.nav-justified > li > a { - margin-bottom: 5px; - text-align: center; -} -.nav-tabs.nav-justified > .dropdown .dropdown-menu { - top: auto; - left: auto; -} -@media (min-width: 768px) { - .nav-tabs.nav-justified > li { - display: table-cell; - width: 1%; - } - .nav-tabs.nav-justified > li > a { - margin-bottom: 0; - } -} -.nav-tabs.nav-justified > li > a { - margin-right: 0; - border-radius: 4px; -} -.nav-tabs.nav-justified > .active > a, -.nav-tabs.nav-justified > .active > a:hover, -.nav-tabs.nav-justified > .active > a:focus { - border: 1px solid #ddd; -} -@media (min-width: 768px) { - .nav-tabs.nav-justified > li > a { - border-bottom: 1px solid #ddd; - border-radius: 4px 4px 0 0; - } - .nav-tabs.nav-justified > .active > a, - .nav-tabs.nav-justified > .active > a:hover, - .nav-tabs.nav-justified > .active > a:focus { - border-bottom-color: #fff; - } -} -.nav-pills > li { - float: left; -} -.nav-pills > li > a { - border-radius: 4px; -} -.nav-pills > li + li { - margin-left: 2px; -} -.nav-pills > li.active > a, -.nav-pills > li.active > a:hover, -.nav-pills > li.active > a:focus { - color: #fff; - background-color: #337ab7; -} -.nav-stacked > li { - float: none; -} -.nav-stacked > li + li { - margin-top: 2px; - margin-left: 0; -} -.nav-justified { - width: 100%; -} -.nav-justified > li { - float: none; -} -.nav-justified > li > a { - margin-bottom: 5px; - text-align: center; -} -.nav-justified > .dropdown .dropdown-menu { - top: auto; - left: auto; -} -@media (min-width: 768px) { - .nav-justified > li { - display: table-cell; - width: 1%; - } - .nav-justified > li > a { - margin-bottom: 0; - } -} -.nav-tabs-justified { - border-bottom: 0; -} -.nav-tabs-justified > li > a { - margin-right: 0; - border-radius: 4px; -} -.nav-tabs-justified > .active > a, -.nav-tabs-justified > .active > a:hover, -.nav-tabs-justified > .active > a:focus { - border: 1px solid #ddd; -} -@media (min-width: 768px) { - .nav-tabs-justified > li > a { - border-bottom: 1px solid #ddd; - border-radius: 4px 4px 0 0; - } - .nav-tabs-justified > .active > a, - .nav-tabs-justified > .active > a:hover, - .nav-tabs-justified > .active > a:focus { - border-bottom-color: #fff; - } -} -.tab-content > .tab-pane { - display: none; -} -.tab-content > .active { - display: block; -} -.nav-tabs .dropdown-menu { - margin-top: -1px; - border-top-left-radius: 0; - border-top-right-radius: 0; -} -.navbar { - position: relative; - min-height: 50px; - margin-bottom: 20px; - border: 1px solid transparent; -} -@media (min-width: 768px) { - .navbar { - border-radius: 4px; - } -} -@media (min-width: 768px) { - .navbar-header { - float: left; - } -} -.navbar-collapse { - padding-right: 15px; - padding-left: 15px; - overflow-x: visible; - -webkit-overflow-scrolling: touch; - border-top: 1px solid transparent; - -webkit-box-shadow: inset 0 1px 0 rgba(255, 255, 255, .1); - box-shadow: inset 0 1px 0 rgba(255, 255, 255, .1); -} -.navbar-collapse.in { - overflow-y: auto; -} -@media (min-width: 768px) { - .navbar-collapse { - width: auto; - border-top: 0; - -webkit-box-shadow: none; - box-shadow: none; - } - .navbar-collapse.collapse { - display: block !important; - height: auto !important; - padding-bottom: 0; - overflow: visible !important; - } - .navbar-collapse.in { - overflow-y: visible; - } - .navbar-fixed-top .navbar-collapse, - .navbar-static-top .navbar-collapse, - .navbar-fixed-bottom .navbar-collapse { - padding-right: 0; - padding-left: 0; - } -} -.navbar-fixed-top .navbar-collapse, -.navbar-fixed-bottom .navbar-collapse { - max-height: 340px; -} -@media (max-device-width: 480px) and (orientation: landscape) { - .navbar-fixed-top .navbar-collapse, - .navbar-fixed-bottom .navbar-collapse { - max-height: 200px; - } -} -.container > .navbar-header, -.container-fluid > .navbar-header, -.container > .navbar-collapse, -.container-fluid > .navbar-collapse { - margin-right: -15px; - margin-left: -15px; -} -@media (min-width: 768px) { - .container > .navbar-header, - .container-fluid > .navbar-header, - .container > .navbar-collapse, - .container-fluid > .navbar-collapse { - margin-right: 0; - margin-left: 0; - } -} -.navbar-static-top { - z-index: 1000; - border-width: 0 0 1px; -} -@media (min-width: 768px) { - .navbar-static-top { - border-radius: 0; - } -} -.navbar-fixed-top, -.navbar-fixed-bottom { - position: fixed; - right: 0; - left: 0; - z-index: 1030; -} -@media (min-width: 768px) { - .navbar-fixed-top, - .navbar-fixed-bottom { - border-radius: 0; - } -} -.navbar-fixed-top { - top: 0; - border-width: 0 0 1px; -} -.navbar-fixed-bottom { - bottom: 0; - margin-bottom: 0; - border-width: 1px 0 0; -} -.navbar-brand { - float: left; - height: 50px; - padding: 15px 15px; - font-size: 18px; - line-height: 20px; -} -.navbar-brand:hover, -.navbar-brand:focus { - text-decoration: none; -} -.navbar-brand > img { - display: block; -} -@media (min-width: 768px) { - .navbar > .container .navbar-brand, - .navbar > .container-fluid .navbar-brand { - margin-left: -15px; - } -} -.navbar-toggle { - position: relative; - float: right; - padding: 9px 10px; - margin-top: 8px; - margin-right: 15px; - margin-bottom: 8px; - background-color: transparent; - background-image: none; - border: 1px solid transparent; - border-radius: 4px; -} -.navbar-toggle:focus { - outline: 0; -} -.navbar-toggle .icon-bar { - display: block; - width: 22px; - height: 2px; - border-radius: 1px; -} -.navbar-toggle .icon-bar + .icon-bar { - margin-top: 4px; -} -@media (min-width: 768px) { - .navbar-toggle { - display: none; - } -} -.navbar-nav { - margin: 7.5px -15px; -} -.navbar-nav > li > a { - padding-top: 10px; - padding-bottom: 10px; - line-height: 20px; -} -@media (max-width: 767px) { - .navbar-nav .open .dropdown-menu { - position: static; - float: none; - width: auto; - margin-top: 0; - background-color: transparent; - border: 0; - -webkit-box-shadow: none; - box-shadow: none; - } - .navbar-nav .open .dropdown-menu > li > a, - .navbar-nav .open .dropdown-menu .dropdown-header { - padding: 5px 15px 5px 25px; - } - .navbar-nav .open .dropdown-menu > li > a { - line-height: 20px; - } - .navbar-nav .open .dropdown-menu > li > a:hover, - .navbar-nav .open .dropdown-menu > li > a:focus { - background-image: none; - } -} -@media (min-width: 768px) { - .navbar-nav { - float: left; - margin: 0; - } - .navbar-nav > li { - float: left; - } - .navbar-nav > li > a { - padding-top: 15px; - padding-bottom: 15px; - } -} -.navbar-form { - padding: 10px 15px; - margin-top: 8px; - margin-right: -15px; - margin-bottom: 8px; - margin-left: -15px; - border-top: 1px solid transparent; - border-bottom: 1px solid transparent; - -webkit-box-shadow: inset 0 1px 0 rgba(255, 255, 255, .1), 0 1px 0 rgba(255, 255, 255, .1); - box-shadow: inset 0 1px 0 rgba(255, 255, 255, .1), 0 1px 0 rgba(255, 255, 255, .1); -} -@media (min-width: 768px) { - .navbar-form .form-group { - display: inline-block; - margin-bottom: 0; - vertical-align: middle; - } - .navbar-form .form-control { - display: inline-block; - width: auto; - vertical-align: middle; - } - .navbar-form .form-control-static { - display: inline-block; - } - .navbar-form .input-group { - display: inline-table; - vertical-align: middle; - } - .navbar-form .input-group .input-group-addon, - .navbar-form .input-group .input-group-btn, - .navbar-form .input-group .form-control { - width: auto; - } - .navbar-form .input-group > .form-control { - width: 100%; - } - .navbar-form .control-label { - margin-bottom: 0; - vertical-align: middle; - } - .navbar-form .radio, - .navbar-form .checkbox { - display: inline-block; - margin-top: 0; - margin-bottom: 0; - vertical-align: middle; - } - .navbar-form .radio label, - .navbar-form .checkbox label { - padding-left: 0; - } - .navbar-form .radio input[type="radio"], - .navbar-form .checkbox input[type="checkbox"] { - position: relative; - margin-left: 0; - } - .navbar-form .has-feedback .form-control-feedback { - top: 0; - } -} -@media (max-width: 767px) { - .navbar-form .form-group { - margin-bottom: 5px; - } - .navbar-form .form-group:last-child { - margin-bottom: 0; - } -} -@media (min-width: 768px) { - .navbar-form { - width: auto; - padding-top: 0; - padding-bottom: 0; - margin-right: 0; - margin-left: 0; - border: 0; - -webkit-box-shadow: none; - box-shadow: none; - } -} -.navbar-nav > li > .dropdown-menu { - margin-top: 0; - border-top-left-radius: 0; - border-top-right-radius: 0; -} -.navbar-fixed-bottom .navbar-nav > li > .dropdown-menu { - margin-bottom: 0; - border-top-left-radius: 4px; - border-top-right-radius: 4px; - border-bottom-right-radius: 0; - border-bottom-left-radius: 0; -} -.navbar-btn { - margin-top: 8px; - margin-bottom: 8px; -} -.navbar-btn.btn-sm { - margin-top: 10px; - margin-bottom: 10px; -} -.navbar-btn.btn-xs { - margin-top: 14px; - margin-bottom: 14px; -} -.navbar-text { - margin-top: 15px; - margin-bottom: 15px; -} -@media (min-width: 768px) { - .navbar-text { - float: left; - margin-right: 15px; - margin-left: 15px; - } -} -@media (min-width: 768px) { - .navbar-left { - float: left !important; - } - .navbar-right { - float: right !important; - margin-right: -15px; - } - .navbar-right ~ .navbar-right { - margin-right: 0; - } -} -.navbar-default { - background-color: #f8f8f8; - border-color: #e7e7e7; -} -.navbar-default .navbar-brand { - color: #777; -} -.navbar-default .navbar-brand:hover, -.navbar-default .navbar-brand:focus { - color: #5e5e5e; - background-color: transparent; -} -.navbar-default .navbar-text { - color: #777; -} -.navbar-default .navbar-nav > li > a { - color: #777; -} -.navbar-default .navbar-nav > li > a:hover, -.navbar-default .navbar-nav > li > a:focus { - color: #333; - background-color: transparent; -} -.navbar-default .navbar-nav > .active > a, -.navbar-default .navbar-nav > .active > a:hover, -.navbar-default .navbar-nav > .active > a:focus { - color: #555; - background-color: #e7e7e7; -} -.navbar-default .navbar-nav > .disabled > a, -.navbar-default .navbar-nav > .disabled > a:hover, -.navbar-default .navbar-nav > .disabled > a:focus { - color: #ccc; - background-color: transparent; -} -.navbar-default .navbar-toggle { - border-color: #ddd; -} -.navbar-default .navbar-toggle:hover, -.navbar-default .navbar-toggle:focus { - background-color: #ddd; -} -.navbar-default .navbar-toggle .icon-bar { - background-color: #888; -} -.navbar-default .navbar-collapse, -.navbar-default .navbar-form { - border-color: #e7e7e7; -} -.navbar-default .navbar-nav > .open > a, -.navbar-default .navbar-nav > .open > a:hover, -.navbar-default .navbar-nav > .open > a:focus { - color: #555; - background-color: #e7e7e7; -} -@media (max-width: 767px) { - .navbar-default .navbar-nav .open .dropdown-menu > li > a { - color: #777; - } - .navbar-default .navbar-nav .open .dropdown-menu > li > a:hover, - .navbar-default .navbar-nav .open .dropdown-menu > li > a:focus { - color: #333; - background-color: transparent; - } - .navbar-default .navbar-nav .open .dropdown-menu > .active > a, - .navbar-default .navbar-nav .open .dropdown-menu > .active > a:hover, - .navbar-default .navbar-nav .open .dropdown-menu > .active > a:focus { - color: #555; - background-color: #e7e7e7; - } - .navbar-default .navbar-nav .open .dropdown-menu > .disabled > a, - .navbar-default .navbar-nav .open .dropdown-menu > .disabled > a:hover, - .navbar-default .navbar-nav .open .dropdown-menu > .disabled > a:focus { - color: #ccc; - background-color: transparent; - } -} -.navbar-default .navbar-link { - color: #777; -} -.navbar-default .navbar-link:hover { - color: #333; -} -.navbar-default .btn-link { - color: #777; -} -.navbar-default .btn-link:hover, -.navbar-default .btn-link:focus { - color: #333; -} -.navbar-default .btn-link[disabled]:hover, -fieldset[disabled] .navbar-default .btn-link:hover, -.navbar-default .btn-link[disabled]:focus, -fieldset[disabled] .navbar-default .btn-link:focus { - color: #ccc; -} -.navbar-inverse { - background-color: #222; - border-color: #080808; -} -.navbar-inverse .navbar-brand { - color: #9d9d9d; -} -.navbar-inverse .navbar-brand:hover, -.navbar-inverse .navbar-brand:focus { - color: #fff; - background-color: transparent; -} -.navbar-inverse .navbar-text { - color: #9d9d9d; -} -.navbar-inverse .navbar-nav > li > a { - color: #9d9d9d; -} -.navbar-inverse .navbar-nav > li > a:hover, -.navbar-inverse .navbar-nav > li > a:focus { - color: #fff; - background-color: transparent; -} -.navbar-inverse .navbar-nav > .active > a, -.navbar-inverse .navbar-nav > .active > a:hover, -.navbar-inverse .navbar-nav > .active > a:focus { - color: #fff; - background-color: #080808; -} -.navbar-inverse .navbar-nav > .disabled > a, -.navbar-inverse .navbar-nav > .disabled > a:hover, -.navbar-inverse .navbar-nav > .disabled > a:focus { - color: #444; - background-color: transparent; -} -.navbar-inverse .navbar-toggle { - border-color: #333; -} -.navbar-inverse .navbar-toggle:hover, -.navbar-inverse .navbar-toggle:focus { - background-color: #333; -} -.navbar-inverse .navbar-toggle .icon-bar { - background-color: #fff; -} -.navbar-inverse .navbar-collapse, -.navbar-inverse .navbar-form { - border-color: #101010; -} -.navbar-inverse .navbar-nav > .open > a, -.navbar-inverse .navbar-nav > .open > a:hover, -.navbar-inverse .navbar-nav > .open > a:focus { - color: #fff; - background-color: #080808; -} -@media (max-width: 767px) { - .navbar-inverse .navbar-nav .open .dropdown-menu > .dropdown-header { - border-color: #080808; - } - .navbar-inverse .navbar-nav .open .dropdown-menu .divider { - background-color: #080808; - } - .navbar-inverse .navbar-nav .open .dropdown-menu > li > a { - color: #9d9d9d; - } - .navbar-inverse .navbar-nav .open .dropdown-menu > li > a:hover, - .navbar-inverse .navbar-nav .open .dropdown-menu > li > a:focus { - color: #fff; - background-color: transparent; - } - .navbar-inverse .navbar-nav .open .dropdown-menu > .active > a, - .navbar-inverse .navbar-nav .open .dropdown-menu > .active > a:hover, - .navbar-inverse .navbar-nav .open .dropdown-menu > .active > a:focus { - color: #fff; - background-color: #080808; - } - .navbar-inverse .navbar-nav .open .dropdown-menu > .disabled > a, - .navbar-inverse .navbar-nav .open .dropdown-menu > .disabled > a:hover, - .navbar-inverse .navbar-nav .open .dropdown-menu > .disabled > a:focus { - color: #444; - background-color: transparent; - } -} -.navbar-inverse .navbar-link { - color: #9d9d9d; -} -.navbar-inverse .navbar-link:hover { - color: #fff; -} -.navbar-inverse .btn-link { - color: #9d9d9d; -} -.navbar-inverse .btn-link:hover, -.navbar-inverse .btn-link:focus { - color: #fff; -} -.navbar-inverse .btn-link[disabled]:hover, -fieldset[disabled] .navbar-inverse .btn-link:hover, -.navbar-inverse .btn-link[disabled]:focus, -fieldset[disabled] .navbar-inverse .btn-link:focus { - color: #444; -} -.breadcrumb { - padding: 8px 15px; - margin-bottom: 20px; - list-style: none; - background-color: #f5f5f5; - border-radius: 4px; -} -.breadcrumb > li { - display: inline-block; -} -.breadcrumb > li + li:before { - padding: 0 5px; - color: #ccc; - content: "/\00a0"; -} -.breadcrumb > .active { - color: #777; -} -.pagination { - display: inline-block; - padding-left: 0; - margin: 20px 0; - border-radius: 4px; -} -.pagination > li { - display: inline; -} -.pagination > li > a, -.pagination > li > span { - position: relative; - float: left; - padding: 6px 12px; - margin-left: -1px; - line-height: 1.42857143; - color: #337ab7; - text-decoration: none; - background-color: #fff; - border: 1px solid #ddd; -} -.pagination > li:first-child > a, -.pagination > li:first-child > span { - margin-left: 0; - border-top-left-radius: 4px; - border-bottom-left-radius: 4px; -} -.pagination > li:last-child > a, -.pagination > li:last-child > span { - border-top-right-radius: 4px; - border-bottom-right-radius: 4px; -} -.pagination > li > a:hover, -.pagination > li > span:hover, -.pagination > li > a:focus, -.pagination > li > span:focus { - z-index: 2; - color: #23527c; - background-color: #eee; - border-color: #ddd; -} -.pagination > .active > a, -.pagination > .active > span, -.pagination > .active > a:hover, -.pagination > .active > span:hover, -.pagination > .active > a:focus, -.pagination > .active > span:focus { - z-index: 3; - color: #fff; - cursor: default; - background-color: #337ab7; - border-color: #337ab7; -} -.pagination > .disabled > span, -.pagination > .disabled > span:hover, -.pagination > .disabled > span:focus, -.pagination > .disabled > a, -.pagination > .disabled > a:hover, -.pagination > .disabled > a:focus { - color: #777; - cursor: not-allowed; - background-color: #fff; - border-color: #ddd; -} -.pagination-lg > li > a, -.pagination-lg > li > span { - padding: 10px 16px; - font-size: 18px; - line-height: 1.3333333; -} -.pagination-lg > li:first-child > a, -.pagination-lg > li:first-child > span { - border-top-left-radius: 6px; - border-bottom-left-radius: 6px; -} -.pagination-lg > li:last-child > a, -.pagination-lg > li:last-child > span { - border-top-right-radius: 6px; - border-bottom-right-radius: 6px; -} -.pagination-sm > li > a, -.pagination-sm > li > span { - padding: 5px 10px; - font-size: 12px; - line-height: 1.5; -} -.pagination-sm > li:first-child > a, -.pagination-sm > li:first-child > span { - border-top-left-radius: 3px; - border-bottom-left-radius: 3px; -} -.pagination-sm > li:last-child > a, -.pagination-sm > li:last-child > span { - border-top-right-radius: 3px; - border-bottom-right-radius: 3px; -} -.pager { - padding-left: 0; - margin: 20px 0; - text-align: center; - list-style: none; -} -.pager li { - display: inline; -} -.pager li > a, -.pager li > span { - display: inline-block; - padding: 5px 14px; - background-color: #fff; - border: 1px solid #ddd; - border-radius: 15px; -} -.pager li > a:hover, -.pager li > a:focus { - text-decoration: none; - background-color: #eee; -} -.pager .next > a, -.pager .next > span { - float: right; -} -.pager .previous > a, -.pager .previous > span { - float: left; -} -.pager .disabled > a, -.pager .disabled > a:hover, -.pager .disabled > a:focus, -.pager .disabled > span { - color: #777; - cursor: not-allowed; - background-color: #fff; -} -.label { - display: inline; - padding: .2em .6em .3em; - font-size: 75%; - font-weight: bold; - line-height: 1; - color: #fff; - text-align: center; - white-space: nowrap; - vertical-align: baseline; - border-radius: .25em; -} -a.label:hover, -a.label:focus { - color: #fff; - text-decoration: none; - cursor: pointer; -} -.label:empty { - display: none; -} -.btn .label { - position: relative; - top: -1px; -} -.label-default { - background-color: #777; -} -.label-default[href]:hover, -.label-default[href]:focus { - background-color: #5e5e5e; -} -.label-primary { - background-color: #337ab7; -} -.label-primary[href]:hover, -.label-primary[href]:focus { - background-color: #286090; -} -.label-success { - background-color: #5cb85c; -} -.label-success[href]:hover, -.label-success[href]:focus { - background-color: #449d44; -} -.label-info { - background-color: #5bc0de; -} -.label-info[href]:hover, -.label-info[href]:focus { - background-color: #31b0d5; -} -.label-warning { - background-color: #f0ad4e; -} -.label-warning[href]:hover, -.label-warning[href]:focus { - background-color: #ec971f; -} -.label-danger { - background-color: #d9534f; -} -.label-danger[href]:hover, -.label-danger[href]:focus { - background-color: #c9302c; -} -.badge { - display: inline-block; - min-width: 10px; - padding: 3px 7px; - font-size: 12px; - font-weight: bold; - line-height: 1; - color: #fff; - text-align: center; - white-space: nowrap; - vertical-align: middle; - background-color: #777; - border-radius: 10px; -} -.badge:empty { - display: none; -} -.btn .badge { - position: relative; - top: -1px; -} -.btn-xs .badge, -.btn-group-xs > .btn .badge { - top: 0; - padding: 1px 5px; -} -a.badge:hover, -a.badge:focus { - color: #fff; - text-decoration: none; - cursor: pointer; -} -.list-group-item.active > .badge, -.nav-pills > .active > a > .badge { - color: #337ab7; - background-color: #fff; -} -.list-group-item > .badge { - float: right; -} -.list-group-item > .badge + .badge { - margin-right: 5px; -} -.nav-pills > li > a > .badge { - margin-left: 3px; -} -.jumbotron { - padding-top: 30px; - padding-bottom: 30px; - margin-bottom: 30px; - color: inherit; - background-color: #eee; -} -.jumbotron h1, -.jumbotron .h1 { - color: inherit; -} -.jumbotron p { - margin-bottom: 15px; - font-size: 21px; - font-weight: 200; -} -.jumbotron > hr { - border-top-color: #d5d5d5; -} -.container .jumbotron, -.container-fluid .jumbotron { - padding-right: 15px; - padding-left: 15px; - border-radius: 6px; -} -.jumbotron .container { - max-width: 100%; -} -@media screen and (min-width: 768px) { - .jumbotron { - padding-top: 48px; - padding-bottom: 48px; - } - .container .jumbotron, - .container-fluid .jumbotron { - padding-right: 60px; - padding-left: 60px; - } - .jumbotron h1, - .jumbotron .h1 { - font-size: 63px; - } -} -.thumbnail { - display: block; - padding: 4px; - margin-bottom: 20px; - line-height: 1.42857143; - background-color: #fff; - border: 1px solid #ddd; - border-radius: 4px; - -webkit-transition: border .2s ease-in-out; - -o-transition: border .2s ease-in-out; - transition: border .2s ease-in-out; -} -.thumbnail > img, -.thumbnail a > img { - margin-right: auto; - margin-left: auto; -} -a.thumbnail:hover, -a.thumbnail:focus, -a.thumbnail.active { - border-color: #337ab7; -} -.thumbnail .caption { - padding: 9px; - color: #333; -} -.alert { - padding: 15px; - margin-bottom: 20px; - border: 1px solid transparent; - border-radius: 4px; -} -.alert h4 { - margin-top: 0; - color: inherit; -} -.alert .alert-link { - font-weight: bold; -} -.alert > p, -.alert > ul { - margin-bottom: 0; -} -.alert > p + p { - margin-top: 5px; -} -.alert-dismissable, -.alert-dismissible { - padding-right: 35px; -} -.alert-dismissable .close, -.alert-dismissible .close { - position: relative; - top: -2px; - right: -21px; - color: inherit; -} -.alert-success { - color: #3c763d; - background-color: #dff0d8; - border-color: #d6e9c6; -} -.alert-success hr { - border-top-color: #c9e2b3; -} -.alert-success .alert-link { - color: #2b542c; -} -.alert-info { - color: #31708f; - background-color: #d9edf7; - border-color: #bce8f1; -} -.alert-info hr { - border-top-color: #a6e1ec; -} -.alert-info .alert-link { - color: #245269; -} -.alert-warning { - color: #8a6d3b; - background-color: #fcf8e3; - border-color: #faebcc; -} -.alert-warning hr { - border-top-color: #f7e1b5; -} -.alert-warning .alert-link { - color: #66512c; -} -.alert-danger { - color: #a94442; - background-color: #f2dede; - border-color: #ebccd1; -} -.alert-danger hr { - border-top-color: #e4b9c0; -} -.alert-danger .alert-link { - color: #843534; -} -@-webkit-keyframes progress-bar-stripes { - from { - background-position: 40px 0; - } - to { - background-position: 0 0; - } -} -@-o-keyframes progress-bar-stripes { - from { - background-position: 40px 0; - } - to { - background-position: 0 0; - } -} -@keyframes progress-bar-stripes { - from { - background-position: 40px 0; - } - to { - background-position: 0 0; - } -} -.progress { - height: 20px; - margin-bottom: 20px; - overflow: hidden; - background-color: #f5f5f5; - border-radius: 4px; - -webkit-box-shadow: inset 0 1px 2px rgba(0, 0, 0, .1); - box-shadow: inset 0 1px 2px rgba(0, 0, 0, .1); -} -.progress-bar { - float: left; - width: 0; - height: 100%; - font-size: 12px; - line-height: 20px; - color: #fff; - text-align: center; - background-color: #337ab7; - -webkit-box-shadow: inset 0 -1px 0 rgba(0, 0, 0, .15); - box-shadow: inset 0 -1px 0 rgba(0, 0, 0, .15); - -webkit-transition: width .6s ease; - -o-transition: width .6s ease; - transition: width .6s ease; -} -.progress-striped .progress-bar, -.progress-bar-striped { - background-image: -webkit-linear-gradient(45deg, rgba(255, 255, 255, .15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, .15) 50%, rgba(255, 255, 255, .15) 75%, transparent 75%, transparent); - background-image: -o-linear-gradient(45deg, rgba(255, 255, 255, .15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, .15) 50%, rgba(255, 255, 255, .15) 75%, transparent 75%, transparent); - background-image: linear-gradient(45deg, rgba(255, 255, 255, .15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, .15) 50%, rgba(255, 255, 255, .15) 75%, transparent 75%, transparent); - -webkit-background-size: 40px 40px; - background-size: 40px 40px; -} -.progress.active .progress-bar, -.progress-bar.active { - -webkit-animation: progress-bar-stripes 2s linear infinite; - -o-animation: progress-bar-stripes 2s linear infinite; - animation: progress-bar-stripes 2s linear infinite; -} -.progress-bar-success { - background-color: #5cb85c; -} -.progress-striped .progress-bar-success { - background-image: -webkit-linear-gradient(45deg, rgba(255, 255, 255, .15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, .15) 50%, rgba(255, 255, 255, .15) 75%, transparent 75%, transparent); - background-image: -o-linear-gradient(45deg, rgba(255, 255, 255, .15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, .15) 50%, rgba(255, 255, 255, .15) 75%, transparent 75%, transparent); - background-image: linear-gradient(45deg, rgba(255, 255, 255, .15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, .15) 50%, rgba(255, 255, 255, .15) 75%, transparent 75%, transparent); -} -.progress-bar-info { - background-color: #5bc0de; -} -.progress-striped .progress-bar-info { - background-image: -webkit-linear-gradient(45deg, rgba(255, 255, 255, .15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, .15) 50%, rgba(255, 255, 255, .15) 75%, transparent 75%, transparent); - background-image: -o-linear-gradient(45deg, rgba(255, 255, 255, .15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, .15) 50%, rgba(255, 255, 255, .15) 75%, transparent 75%, transparent); - background-image: linear-gradient(45deg, rgba(255, 255, 255, .15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, .15) 50%, rgba(255, 255, 255, .15) 75%, transparent 75%, transparent); -} -.progress-bar-warning { - background-color: #f0ad4e; -} -.progress-striped .progress-bar-warning { - background-image: -webkit-linear-gradient(45deg, rgba(255, 255, 255, .15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, .15) 50%, rgba(255, 255, 255, .15) 75%, transparent 75%, transparent); - background-image: -o-linear-gradient(45deg, rgba(255, 255, 255, .15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, .15) 50%, rgba(255, 255, 255, .15) 75%, transparent 75%, transparent); - background-image: linear-gradient(45deg, rgba(255, 255, 255, .15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, .15) 50%, rgba(255, 255, 255, .15) 75%, transparent 75%, transparent); -} -.progress-bar-danger { - background-color: #d9534f; -} -.progress-striped .progress-bar-danger { - background-image: -webkit-linear-gradient(45deg, rgba(255, 255, 255, .15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, .15) 50%, rgba(255, 255, 255, .15) 75%, transparent 75%, transparent); - background-image: -o-linear-gradient(45deg, rgba(255, 255, 255, .15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, .15) 50%, rgba(255, 255, 255, .15) 75%, transparent 75%, transparent); - background-image: linear-gradient(45deg, rgba(255, 255, 255, .15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, .15) 50%, rgba(255, 255, 255, .15) 75%, transparent 75%, transparent); -} -.media { - margin-top: 15px; -} -.media:first-child { - margin-top: 0; -} -.media, -.media-body { - overflow: hidden; - zoom: 1; -} -.media-body { - width: 10000px; -} -.media-object { - display: block; -} -.media-object.img-thumbnail { - max-width: none; -} -.media-right, -.media > .pull-right { - padding-left: 10px; -} -.media-left, -.media > .pull-left { - padding-right: 10px; -} -.media-left, -.media-right, -.media-body { - display: table-cell; - vertical-align: top; -} -.media-middle { - vertical-align: middle; -} -.media-bottom { - vertical-align: bottom; -} -.media-heading { - margin-top: 0; - margin-bottom: 5px; -} -.media-list { - padding-left: 0; - list-style: none; -} -.list-group { - padding-left: 0; - margin-bottom: 20px; -} -.list-group-item { - position: relative; - display: block; - padding: 10px 15px; - margin-bottom: -1px; - background-color: #fff; - border: 1px solid #ddd; -} -.list-group-item:first-child { - border-top-left-radius: 4px; - border-top-right-radius: 4px; -} -.list-group-item:last-child { - margin-bottom: 0; - border-bottom-right-radius: 4px; - border-bottom-left-radius: 4px; -} -a.list-group-item, -button.list-group-item { - color: #555; -} -a.list-group-item .list-group-item-heading, -button.list-group-item .list-group-item-heading { - color: #333; -} -a.list-group-item:hover, -button.list-group-item:hover, -a.list-group-item:focus, -button.list-group-item:focus { - color: #555; - text-decoration: none; - background-color: #f5f5f5; -} -button.list-group-item { - width: 100%; - text-align: left; -} -.list-group-item.disabled, -.list-group-item.disabled:hover, -.list-group-item.disabled:focus { - color: #777; - cursor: not-allowed; - background-color: #eee; -} -.list-group-item.disabled .list-group-item-heading, -.list-group-item.disabled:hover .list-group-item-heading, -.list-group-item.disabled:focus .list-group-item-heading { - color: inherit; -} -.list-group-item.disabled .list-group-item-text, -.list-group-item.disabled:hover .list-group-item-text, -.list-group-item.disabled:focus .list-group-item-text { - color: #777; -} -.list-group-item.active, -.list-group-item.active:hover, -.list-group-item.active:focus { - z-index: 2; - color: #fff; - background-color: #337ab7; - border-color: #337ab7; -} -.list-group-item.active .list-group-item-heading, -.list-group-item.active:hover .list-group-item-heading, -.list-group-item.active:focus .list-group-item-heading, -.list-group-item.active .list-group-item-heading > small, -.list-group-item.active:hover .list-group-item-heading > small, -.list-group-item.active:focus .list-group-item-heading > small, -.list-group-item.active .list-group-item-heading > .small, -.list-group-item.active:hover .list-group-item-heading > .small, -.list-group-item.active:focus .list-group-item-heading > .small { - color: inherit; -} -.list-group-item.active .list-group-item-text, -.list-group-item.active:hover .list-group-item-text, -.list-group-item.active:focus .list-group-item-text { - color: #c7ddef; -} -.list-group-item-success { - color: #3c763d; - background-color: #dff0d8; -} -a.list-group-item-success, -button.list-group-item-success { - color: #3c763d; -} -a.list-group-item-success .list-group-item-heading, -button.list-group-item-success .list-group-item-heading { - color: inherit; -} -a.list-group-item-success:hover, -button.list-group-item-success:hover, -a.list-group-item-success:focus, -button.list-group-item-success:focus { - color: #3c763d; - background-color: #d0e9c6; -} -a.list-group-item-success.active, -button.list-group-item-success.active, -a.list-group-item-success.active:hover, -button.list-group-item-success.active:hover, -a.list-group-item-success.active:focus, -button.list-group-item-success.active:focus { - color: #fff; - background-color: #3c763d; - border-color: #3c763d; -} -.list-group-item-info { - color: #31708f; - background-color: #d9edf7; -} -a.list-group-item-info, -button.list-group-item-info { - color: #31708f; -} -a.list-group-item-info .list-group-item-heading, -button.list-group-item-info .list-group-item-heading { - color: inherit; -} -a.list-group-item-info:hover, -button.list-group-item-info:hover, -a.list-group-item-info:focus, -button.list-group-item-info:focus { - color: #31708f; - background-color: #c4e3f3; -} -a.list-group-item-info.active, -button.list-group-item-info.active, -a.list-group-item-info.active:hover, -button.list-group-item-info.active:hover, -a.list-group-item-info.active:focus, -button.list-group-item-info.active:focus { - color: #fff; - background-color: #31708f; - border-color: #31708f; -} -.list-group-item-warning { - color: #8a6d3b; - background-color: #fcf8e3; -} -a.list-group-item-warning, -button.list-group-item-warning { - color: #8a6d3b; -} -a.list-group-item-warning .list-group-item-heading, -button.list-group-item-warning .list-group-item-heading { - color: inherit; -} -a.list-group-item-warning:hover, -button.list-group-item-warning:hover, -a.list-group-item-warning:focus, -button.list-group-item-warning:focus { - color: #8a6d3b; - background-color: #faf2cc; -} -a.list-group-item-warning.active, -button.list-group-item-warning.active, -a.list-group-item-warning.active:hover, -button.list-group-item-warning.active:hover, -a.list-group-item-warning.active:focus, -button.list-group-item-warning.active:focus { - color: #fff; - background-color: #8a6d3b; - border-color: #8a6d3b; -} -.list-group-item-danger { - color: #a94442; - background-color: #f2dede; -} -a.list-group-item-danger, -button.list-group-item-danger { - color: #a94442; -} -a.list-group-item-danger .list-group-item-heading, -button.list-group-item-danger .list-group-item-heading { - color: inherit; -} -a.list-group-item-danger:hover, -button.list-group-item-danger:hover, -a.list-group-item-danger:focus, -button.list-group-item-danger:focus { - color: #a94442; - background-color: #ebcccc; -} -a.list-group-item-danger.active, -button.list-group-item-danger.active, -a.list-group-item-danger.active:hover, -button.list-group-item-danger.active:hover, -a.list-group-item-danger.active:focus, -button.list-group-item-danger.active:focus { - color: #fff; - background-color: #a94442; - border-color: #a94442; -} -.list-group-item-heading { - margin-top: 0; - margin-bottom: 5px; -} -.list-group-item-text { - margin-bottom: 0; - line-height: 1.3; -} -.panel { - margin-bottom: 20px; - background-color: #fff; - border: 1px solid transparent; - border-radius: 4px; - -webkit-box-shadow: 0 1px 1px rgba(0, 0, 0, .05); - box-shadow: 0 1px 1px rgba(0, 0, 0, .05); -} -.panel-body { - padding: 15px; -} -.panel-heading { - padding: 10px 15px; - border-bottom: 1px solid transparent; - border-top-left-radius: 3px; - border-top-right-radius: 3px; -} -.panel-heading > .dropdown .dropdown-toggle { - color: inherit; -} -.panel-title { - margin-top: 0; - margin-bottom: 0; - font-size: 16px; - color: inherit; -} -.panel-title > a, -.panel-title > small, -.panel-title > .small, -.panel-title > small > a, -.panel-title > .small > a { - color: inherit; -} -.panel-footer { - padding: 10px 15px; - background-color: #f5f5f5; - border-top: 1px solid #ddd; - border-bottom-right-radius: 3px; - border-bottom-left-radius: 3px; -} -.panel > .list-group, -.panel > .panel-collapse > .list-group { - margin-bottom: 0; -} -.panel > .list-group .list-group-item, -.panel > .panel-collapse > .list-group .list-group-item { - border-width: 1px 0; - border-radius: 0; -} -.panel > .list-group:first-child .list-group-item:first-child, -.panel > .panel-collapse > .list-group:first-child .list-group-item:first-child { - border-top: 0; - border-top-left-radius: 3px; - border-top-right-radius: 3px; -} -.panel > .list-group:last-child .list-group-item:last-child, -.panel > .panel-collapse > .list-group:last-child .list-group-item:last-child { - border-bottom: 0; - border-bottom-right-radius: 3px; - border-bottom-left-radius: 3px; -} -.panel > .panel-heading + .panel-collapse > .list-group .list-group-item:first-child { - border-top-left-radius: 0; - border-top-right-radius: 0; -} -.panel-heading + .list-group .list-group-item:first-child { - border-top-width: 0; -} -.list-group + .panel-footer { - border-top-width: 0; -} -.panel > .table, -.panel > .table-responsive > .table, -.panel > .panel-collapse > .table { - margin-bottom: 0; -} -.panel > .table caption, -.panel > .table-responsive > .table caption, -.panel > .panel-collapse > .table caption { - padding-right: 15px; - padding-left: 15px; -} -.panel > .table:first-child, -.panel > .table-responsive:first-child > .table:first-child { - border-top-left-radius: 3px; - border-top-right-radius: 3px; -} -.panel > .table:first-child > thead:first-child > tr:first-child, -.panel > .table-responsive:first-child > .table:first-child > thead:first-child > tr:first-child, -.panel > .table:first-child > tbody:first-child > tr:first-child, -.panel > .table-responsive:first-child > .table:first-child > tbody:first-child > tr:first-child { - border-top-left-radius: 3px; - border-top-right-radius: 3px; -} -.panel > .table:first-child > thead:first-child > tr:first-child td:first-child, -.panel > .table-responsive:first-child > .table:first-child > thead:first-child > tr:first-child td:first-child, -.panel > .table:first-child > tbody:first-child > tr:first-child td:first-child, -.panel > .table-responsive:first-child > .table:first-child > tbody:first-child > tr:first-child td:first-child, -.panel > .table:first-child > thead:first-child > tr:first-child th:first-child, -.panel > .table-responsive:first-child > .table:first-child > thead:first-child > tr:first-child th:first-child, -.panel > .table:first-child > tbody:first-child > tr:first-child th:first-child, -.panel > .table-responsive:first-child > .table:first-child > tbody:first-child > tr:first-child th:first-child { - border-top-left-radius: 3px; -} -.panel > .table:first-child > thead:first-child > tr:first-child td:last-child, -.panel > .table-responsive:first-child > .table:first-child > thead:first-child > tr:first-child td:last-child, -.panel > .table:first-child > tbody:first-child > tr:first-child td:last-child, -.panel > .table-responsive:first-child > .table:first-child > tbody:first-child > tr:first-child td:last-child, -.panel > .table:first-child > thead:first-child > tr:first-child th:last-child, -.panel > .table-responsive:first-child > .table:first-child > thead:first-child > tr:first-child th:last-child, -.panel > .table:first-child > tbody:first-child > tr:first-child th:last-child, -.panel > .table-responsive:first-child > .table:first-child > tbody:first-child > tr:first-child th:last-child { - border-top-right-radius: 3px; -} -.panel > .table:last-child, -.panel > .table-responsive:last-child > .table:last-child { - border-bottom-right-radius: 3px; - border-bottom-left-radius: 3px; -} -.panel > .table:last-child > tbody:last-child > tr:last-child, -.panel > .table-responsive:last-child > .table:last-child > tbody:last-child > tr:last-child, -.panel > .table:last-child > tfoot:last-child > tr:last-child, -.panel > .table-responsive:last-child > .table:last-child > tfoot:last-child > tr:last-child { - border-bottom-right-radius: 3px; - border-bottom-left-radius: 3px; -} -.panel > .table:last-child > tbody:last-child > tr:last-child td:first-child, -.panel > .table-responsive:last-child > .table:last-child > tbody:last-child > tr:last-child td:first-child, -.panel > .table:last-child > tfoot:last-child > tr:last-child td:first-child, -.panel > .table-responsive:last-child > .table:last-child > tfoot:last-child > tr:last-child td:first-child, -.panel > .table:last-child > tbody:last-child > tr:last-child th:first-child, -.panel > .table-responsive:last-child > .table:last-child > tbody:last-child > tr:last-child th:first-child, -.panel > .table:last-child > tfoot:last-child > tr:last-child th:first-child, -.panel > .table-responsive:last-child > .table:last-child > tfoot:last-child > tr:last-child th:first-child { - border-bottom-left-radius: 3px; -} -.panel > .table:last-child > tbody:last-child > tr:last-child td:last-child, -.panel > .table-responsive:last-child > .table:last-child > tbody:last-child > tr:last-child td:last-child, -.panel > .table:last-child > tfoot:last-child > tr:last-child td:last-child, -.panel > .table-responsive:last-child > .table:last-child > tfoot:last-child > tr:last-child td:last-child, -.panel > .table:last-child > tbody:last-child > tr:last-child th:last-child, -.panel > .table-responsive:last-child > .table:last-child > tbody:last-child > tr:last-child th:last-child, -.panel > .table:last-child > tfoot:last-child > tr:last-child th:last-child, -.panel > .table-responsive:last-child > .table:last-child > tfoot:last-child > tr:last-child th:last-child { - border-bottom-right-radius: 3px; -} -.panel > .panel-body + .table, -.panel > .panel-body + .table-responsive, -.panel > .table + .panel-body, -.panel > .table-responsive + .panel-body { - border-top: 1px solid #ddd; -} -.panel > .table > tbody:first-child > tr:first-child th, -.panel > .table > tbody:first-child > tr:first-child td { - border-top: 0; -} -.panel > .table-bordered, -.panel > .table-responsive > .table-bordered { - border: 0; -} -.panel > .table-bordered > thead > tr > th:first-child, -.panel > .table-responsive > .table-bordered > thead > tr > th:first-child, -.panel > .table-bordered > tbody > tr > th:first-child, -.panel > .table-responsive > .table-bordered > tbody > tr > th:first-child, -.panel > .table-bordered > tfoot > tr > th:first-child, -.panel > .table-responsive > .table-bordered > tfoot > tr > th:first-child, -.panel > .table-bordered > thead > tr > td:first-child, -.panel > .table-responsive > .table-bordered > thead > tr > td:first-child, -.panel > .table-bordered > tbody > tr > td:first-child, -.panel > .table-responsive > .table-bordered > tbody > tr > td:first-child, -.panel > .table-bordered > tfoot > tr > td:first-child, -.panel > .table-responsive > .table-bordered > tfoot > tr > td:first-child { - border-left: 0; -} -.panel > .table-bordered > thead > tr > th:last-child, -.panel > .table-responsive > .table-bordered > thead > tr > th:last-child, -.panel > .table-bordered > tbody > tr > th:last-child, -.panel > .table-responsive > .table-bordered > tbody > tr > th:last-child, -.panel > .table-bordered > tfoot > tr > th:last-child, -.panel > .table-responsive > .table-bordered > tfoot > tr > th:last-child, -.panel > .table-bordered > thead > tr > td:last-child, -.panel > .table-responsive > .table-bordered > thead > tr > td:last-child, -.panel > .table-bordered > tbody > tr > td:last-child, -.panel > .table-responsive > .table-bordered > tbody > tr > td:last-child, -.panel > .table-bordered > tfoot > tr > td:last-child, -.panel > .table-responsive > .table-bordered > tfoot > tr > td:last-child { - border-right: 0; -} -.panel > .table-bordered > thead > tr:first-child > td, -.panel > .table-responsive > .table-bordered > thead > tr:first-child > td, -.panel > .table-bordered > tbody > tr:first-child > td, -.panel > .table-responsive > .table-bordered > tbody > tr:first-child > td, -.panel > .table-bordered > thead > tr:first-child > th, -.panel > .table-responsive > .table-bordered > thead > tr:first-child > th, -.panel > .table-bordered > tbody > tr:first-child > th, -.panel > .table-responsive > .table-bordered > tbody > tr:first-child > th { - border-bottom: 0; -} -.panel > .table-bordered > tbody > tr:last-child > td, -.panel > .table-responsive > .table-bordered > tbody > tr:last-child > td, -.panel > .table-bordered > tfoot > tr:last-child > td, -.panel > .table-responsive > .table-bordered > tfoot > tr:last-child > td, -.panel > .table-bordered > tbody > tr:last-child > th, -.panel > .table-responsive > .table-bordered > tbody > tr:last-child > th, -.panel > .table-bordered > tfoot > tr:last-child > th, -.panel > .table-responsive > .table-bordered > tfoot > tr:last-child > th { - border-bottom: 0; -} -.panel > .table-responsive { - margin-bottom: 0; - border: 0; -} -.panel-group { - margin-bottom: 20px; -} -.panel-group .panel { - margin-bottom: 0; - border-radius: 4px; -} -.panel-group .panel + .panel { - margin-top: 5px; -} -.panel-group .panel-heading { - border-bottom: 0; -} -.panel-group .panel-heading + .panel-collapse > .panel-body, -.panel-group .panel-heading + .panel-collapse > .list-group { - border-top: 1px solid #ddd; -} -.panel-group .panel-footer { - border-top: 0; -} -.panel-group .panel-footer + .panel-collapse .panel-body { - border-bottom: 1px solid #ddd; -} -.panel-default { - border-color: #ddd; -} -.panel-default > .panel-heading { - color: #333; - background-color: #f5f5f5; - border-color: #ddd; -} -.panel-default > .panel-heading + .panel-collapse > .panel-body { - border-top-color: #ddd; -} -.panel-default > .panel-heading .badge { - color: #f5f5f5; - background-color: #333; -} -.panel-default > .panel-footer + .panel-collapse > .panel-body { - border-bottom-color: #ddd; -} -.panel-primary { - border-color: #337ab7; -} -.panel-primary > .panel-heading { - color: #fff; - background-color: #337ab7; - border-color: #337ab7; -} -.panel-primary > .panel-heading + .panel-collapse > .panel-body { - border-top-color: #337ab7; -} -.panel-primary > .panel-heading .badge { - color: #337ab7; - background-color: #fff; -} -.panel-primary > .panel-footer + .panel-collapse > .panel-body { - border-bottom-color: #337ab7; -} -.panel-success { - border-color: #d6e9c6; -} -.panel-success > .panel-heading { - color: #3c763d; - background-color: #dff0d8; - border-color: #d6e9c6; -} -.panel-success > .panel-heading + .panel-collapse > .panel-body { - border-top-color: #d6e9c6; -} -.panel-success > .panel-heading .badge { - color: #dff0d8; - background-color: #3c763d; -} -.panel-success > .panel-footer + .panel-collapse > .panel-body { - border-bottom-color: #d6e9c6; -} -.panel-info { - border-color: #bce8f1; -} -.panel-info > .panel-heading { - color: #31708f; - background-color: #d9edf7; - border-color: #bce8f1; -} -.panel-info > .panel-heading + .panel-collapse > .panel-body { - border-top-color: #bce8f1; -} -.panel-info > .panel-heading .badge { - color: #d9edf7; - background-color: #31708f; -} -.panel-info > .panel-footer + .panel-collapse > .panel-body { - border-bottom-color: #bce8f1; -} -.panel-warning { - border-color: #faebcc; -} -.panel-warning > .panel-heading { - color: #8a6d3b; - background-color: #fcf8e3; - border-color: #faebcc; -} -.panel-warning > .panel-heading + .panel-collapse > .panel-body { - border-top-color: #faebcc; -} -.panel-warning > .panel-heading .badge { - color: #fcf8e3; - background-color: #8a6d3b; -} -.panel-warning > .panel-footer + .panel-collapse > .panel-body { - border-bottom-color: #faebcc; -} -.panel-danger { - border-color: #ebccd1; -} -.panel-danger > .panel-heading { - color: #a94442; - background-color: #f2dede; - border-color: #ebccd1; -} -.panel-danger > .panel-heading + .panel-collapse > .panel-body { - border-top-color: #ebccd1; -} -.panel-danger > .panel-heading .badge { - color: #f2dede; - background-color: #a94442; -} -.panel-danger > .panel-footer + .panel-collapse > .panel-body { - border-bottom-color: #ebccd1; -} -.embed-responsive { - position: relative; - display: block; - height: 0; - padding: 0; - overflow: hidden; -} -.embed-responsive .embed-responsive-item, -.embed-responsive iframe, -.embed-responsive embed, -.embed-responsive object, -.embed-responsive video { - position: absolute; - top: 0; - bottom: 0; - left: 0; - width: 100%; - height: 100%; - border: 0; -} -.embed-responsive-16by9 { - padding-bottom: 56.25%; -} -.embed-responsive-4by3 { - padding-bottom: 75%; -} -.well { - min-height: 20px; - padding: 19px; - margin-bottom: 20px; - background-color: #f5f5f5; - border: 1px solid #e3e3e3; - border-radius: 4px; - -webkit-box-shadow: inset 0 1px 1px rgba(0, 0, 0, .05); - box-shadow: inset 0 1px 1px rgba(0, 0, 0, .05); -} -.well blockquote { - border-color: #ddd; - border-color: rgba(0, 0, 0, .15); -} -.well-lg { - padding: 24px; - border-radius: 6px; -} -.well-sm { - padding: 9px; - border-radius: 3px; -} -.close { - float: right; - font-size: 21px; - font-weight: bold; - line-height: 1; - color: #000; - text-shadow: 0 1px 0 #fff; - filter: alpha(opacity=20); - opacity: .2; -} -.close:hover, -.close:focus { - color: #000; - text-decoration: none; - cursor: pointer; - filter: alpha(opacity=50); - opacity: .5; -} -button.close { - -webkit-appearance: none; - padding: 0; - cursor: pointer; - background: transparent; - border: 0; -} -.modal-open { - overflow: hidden; -} -.modal { - position: fixed; - top: 0; - right: 0; - bottom: 0; - left: 0; - z-index: 1050; - display: none; - overflow: hidden; - -webkit-overflow-scrolling: touch; - outline: 0; -} -.modal.fade .modal-dialog { - -webkit-transition: -webkit-transform .3s ease-out; - -o-transition: -o-transform .3s ease-out; - transition: transform .3s ease-out; - -webkit-transform: translate(0, -25%); - -ms-transform: translate(0, -25%); - -o-transform: translate(0, -25%); - transform: translate(0, -25%); -} -.modal.in .modal-dialog { - -webkit-transform: translate(0, 0); - -ms-transform: translate(0, 0); - -o-transform: translate(0, 0); - transform: translate(0, 0); -} -.modal-open .modal { - overflow-x: hidden; - overflow-y: auto; -} -.modal-dialog { - position: relative; - width: auto; - margin: 10px; -} -.modal-content { - position: relative; - background-color: #fff; - -webkit-background-clip: padding-box; - background-clip: padding-box; - border: 1px solid #999; - border: 1px solid rgba(0, 0, 0, .2); - border-radius: 6px; - outline: 0; - -webkit-box-shadow: 0 3px 9px rgba(0, 0, 0, .5); - box-shadow: 0 3px 9px rgba(0, 0, 0, .5); -} -.modal-backdrop { - position: fixed; - top: 0; - right: 0; - bottom: 0; - left: 0; - z-index: 1040; - background-color: #000; -} -.modal-backdrop.fade { - filter: alpha(opacity=0); - opacity: 0; -} -.modal-backdrop.in { - filter: alpha(opacity=50); - opacity: .5; -} -.modal-header { - padding: 15px; - border-bottom: 1px solid #e5e5e5; -} -.modal-header .close { - margin-top: -2px; -} -.modal-title { - margin: 0; - line-height: 1.42857143; -} -.modal-body { - position: relative; - padding: 15px; -} -.modal-footer { - padding: 15px; - text-align: right; - border-top: 1px solid #e5e5e5; -} -.modal-footer .btn + .btn { - margin-bottom: 0; - margin-left: 5px; -} -.modal-footer .btn-group .btn + .btn { - margin-left: -1px; -} -.modal-footer .btn-block + .btn-block { - margin-left: 0; -} -.modal-scrollbar-measure { - position: absolute; - top: -9999px; - width: 50px; - height: 50px; - overflow: scroll; -} -@media (min-width: 768px) { - .modal-dialog { - width: 600px; - margin: 30px auto; - } - .modal-content { - -webkit-box-shadow: 0 5px 15px rgba(0, 0, 0, .5); - box-shadow: 0 5px 15px rgba(0, 0, 0, .5); - } - .modal-sm { - width: 300px; - } -} -@media (min-width: 992px) { - .modal-lg { - width: 900px; - } -} -.tooltip { - position: absolute; - z-index: 1070; - display: block; - font-family: "Helvetica Neue", Helvetica, Arial, sans-serif; - font-size: 12px; - font-style: normal; - font-weight: normal; - line-height: 1.42857143; - text-align: left; - text-align: start; - text-decoration: none; - text-shadow: none; - text-transform: none; - letter-spacing: normal; - word-break: normal; - word-spacing: normal; - word-wrap: normal; - white-space: normal; - filter: alpha(opacity=0); - opacity: 0; - - line-break: auto; -} -.tooltip.in { - filter: alpha(opacity=90); - opacity: .9; -} -.tooltip.top { - padding: 5px 0; - margin-top: -3px; -} -.tooltip.right { - padding: 0 5px; - margin-left: 3px; -} -.tooltip.bottom { - padding: 5px 0; - margin-top: 3px; -} -.tooltip.left { - padding: 0 5px; - margin-left: -3px; -} -.tooltip-inner { - max-width: 200px; - padding: 3px 8px; - color: #fff; - text-align: center; - background-color: #000; - border-radius: 4px; -} -.tooltip-arrow { - position: absolute; - width: 0; - height: 0; - border-color: transparent; - border-style: solid; -} -.tooltip.top .tooltip-arrow { - bottom: 0; - left: 50%; - margin-left: -5px; - border-width: 5px 5px 0; - border-top-color: #000; -} -.tooltip.top-left .tooltip-arrow { - right: 5px; - bottom: 0; - margin-bottom: -5px; - border-width: 5px 5px 0; - border-top-color: #000; -} -.tooltip.top-right .tooltip-arrow { - bottom: 0; - left: 5px; - margin-bottom: -5px; - border-width: 5px 5px 0; - border-top-color: #000; -} -.tooltip.right .tooltip-arrow { - top: 50%; - left: 0; - margin-top: -5px; - border-width: 5px 5px 5px 0; - border-right-color: #000; -} -.tooltip.left .tooltip-arrow { - top: 50%; - right: 0; - margin-top: -5px; - border-width: 5px 0 5px 5px; - border-left-color: #000; -} -.tooltip.bottom .tooltip-arrow { - top: 0; - left: 50%; - margin-left: -5px; - border-width: 0 5px 5px; - border-bottom-color: #000; -} -.tooltip.bottom-left .tooltip-arrow { - top: 0; - right: 5px; - margin-top: -5px; - border-width: 0 5px 5px; - border-bottom-color: #000; -} -.tooltip.bottom-right .tooltip-arrow { - top: 0; - left: 5px; - margin-top: -5px; - border-width: 0 5px 5px; - border-bottom-color: #000; -} -.popover { - position: absolute; - top: 0; - left: 0; - z-index: 1060; - display: none; - max-width: 276px; - padding: 1px; - font-family: "Helvetica Neue", Helvetica, Arial, sans-serif; - font-size: 14px; - font-style: normal; - font-weight: normal; - line-height: 1.42857143; - text-align: left; - text-align: start; - text-decoration: none; - text-shadow: none; - text-transform: none; - letter-spacing: normal; - word-break: normal; - word-spacing: normal; - word-wrap: normal; - white-space: normal; - background-color: #fff; - -webkit-background-clip: padding-box; - background-clip: padding-box; - border: 1px solid #ccc; - border: 1px solid rgba(0, 0, 0, .2); - border-radius: 6px; - -webkit-box-shadow: 0 5px 10px rgba(0, 0, 0, .2); - box-shadow: 0 5px 10px rgba(0, 0, 0, .2); - - line-break: auto; -} -.popover.top { - margin-top: -10px; -} -.popover.right { - margin-left: 10px; -} -.popover.bottom { - margin-top: 10px; -} -.popover.left { - margin-left: -10px; -} -.popover-title { - padding: 8px 14px; - margin: 0; - font-size: 14px; - background-color: #f7f7f7; - border-bottom: 1px solid #ebebeb; - border-radius: 5px 5px 0 0; -} -.popover-content { - padding: 9px 14px; -} -.popover > .arrow, -.popover > .arrow:after { - position: absolute; - display: block; - width: 0; - height: 0; - border-color: transparent; - border-style: solid; -} -.popover > .arrow { - border-width: 11px; -} -.popover > .arrow:after { - content: ""; - border-width: 10px; -} -.popover.top > .arrow { - bottom: -11px; - left: 50%; - margin-left: -11px; - border-top-color: #999; - border-top-color: rgba(0, 0, 0, .25); - border-bottom-width: 0; -} -.popover.top > .arrow:after { - bottom: 1px; - margin-left: -10px; - content: " "; - border-top-color: #fff; - border-bottom-width: 0; -} -.popover.right > .arrow { - top: 50%; - left: -11px; - margin-top: -11px; - border-right-color: #999; - border-right-color: rgba(0, 0, 0, .25); - border-left-width: 0; -} -.popover.right > .arrow:after { - bottom: -10px; - left: 1px; - content: " "; - border-right-color: #fff; - border-left-width: 0; -} -.popover.bottom > .arrow { - top: -11px; - left: 50%; - margin-left: -11px; - border-top-width: 0; - border-bottom-color: #999; - border-bottom-color: rgba(0, 0, 0, .25); -} -.popover.bottom > .arrow:after { - top: 1px; - margin-left: -10px; - content: " "; - border-top-width: 0; - border-bottom-color: #fff; -} -.popover.left > .arrow { - top: 50%; - right: -11px; - margin-top: -11px; - border-right-width: 0; - border-left-color: #999; - border-left-color: rgba(0, 0, 0, .25); -} -.popover.left > .arrow:after { - right: 1px; - bottom: -10px; - content: " "; - border-right-width: 0; - border-left-color: #fff; -} -.carousel { - position: relative; -} -.carousel-inner { - position: relative; - width: 100%; - overflow: hidden; -} -.carousel-inner > .item { - position: relative; - display: none; - -webkit-transition: .6s ease-in-out left; - -o-transition: .6s ease-in-out left; - transition: .6s ease-in-out left; -} -.carousel-inner > .item > img, -.carousel-inner > .item > a > img { - line-height: 1; -} -@media all and (transform-3d), (-webkit-transform-3d) { - .carousel-inner > .item { - -webkit-transition: -webkit-transform .6s ease-in-out; - -o-transition: -o-transform .6s ease-in-out; - transition: transform .6s ease-in-out; - - -webkit-backface-visibility: hidden; - backface-visibility: hidden; - -webkit-perspective: 1000px; - perspective: 1000px; - } - .carousel-inner > .item.next, - .carousel-inner > .item.active.right { - left: 0; - -webkit-transform: translate3d(100%, 0, 0); - transform: translate3d(100%, 0, 0); - } - .carousel-inner > .item.prev, - .carousel-inner > .item.active.left { - left: 0; - -webkit-transform: translate3d(-100%, 0, 0); - transform: translate3d(-100%, 0, 0); - } - .carousel-inner > .item.next.left, - .carousel-inner > .item.prev.right, - .carousel-inner > .item.active { - left: 0; - -webkit-transform: translate3d(0, 0, 0); - transform: translate3d(0, 0, 0); - } -} -.carousel-inner > .active, -.carousel-inner > .next, -.carousel-inner > .prev { - display: block; -} -.carousel-inner > .active { - left: 0; -} -.carousel-inner > .next, -.carousel-inner > .prev { - position: absolute; - top: 0; - width: 100%; -} -.carousel-inner > .next { - left: 100%; -} -.carousel-inner > .prev { - left: -100%; -} -.carousel-inner > .next.left, -.carousel-inner > .prev.right { - left: 0; -} -.carousel-inner > .active.left { - left: -100%; -} -.carousel-inner > .active.right { - left: 100%; -} -.carousel-control { - position: absolute; - top: 0; - bottom: 0; - left: 0; - width: 15%; - font-size: 20px; - color: #fff; - text-align: center; - text-shadow: 0 1px 2px rgba(0, 0, 0, .6); - background-color: rgba(0, 0, 0, 0); - filter: alpha(opacity=50); - opacity: .5; -} -.carousel-control.left { - background-image: -webkit-linear-gradient(left, rgba(0, 0, 0, .5) 0%, rgba(0, 0, 0, .0001) 100%); - background-image: -o-linear-gradient(left, rgba(0, 0, 0, .5) 0%, rgba(0, 0, 0, .0001) 100%); - background-image: -webkit-gradient(linear, left top, right top, from(rgba(0, 0, 0, .5)), to(rgba(0, 0, 0, .0001))); - background-image: linear-gradient(to right, rgba(0, 0, 0, .5) 0%, rgba(0, 0, 0, .0001) 100%); - filter: progid:DXImageTransform.Microsoft.gradient(startColorstr='#80000000', endColorstr='#00000000', GradientType=1); - background-repeat: repeat-x; -} -.carousel-control.right { - right: 0; - left: auto; - background-image: -webkit-linear-gradient(left, rgba(0, 0, 0, .0001) 0%, rgba(0, 0, 0, .5) 100%); - background-image: -o-linear-gradient(left, rgba(0, 0, 0, .0001) 0%, rgba(0, 0, 0, .5) 100%); - background-image: -webkit-gradient(linear, left top, right top, from(rgba(0, 0, 0, .0001)), to(rgba(0, 0, 0, .5))); - background-image: linear-gradient(to right, rgba(0, 0, 0, .0001) 0%, rgba(0, 0, 0, .5) 100%); - filter: progid:DXImageTransform.Microsoft.gradient(startColorstr='#00000000', endColorstr='#80000000', GradientType=1); - background-repeat: repeat-x; -} -.carousel-control:hover, -.carousel-control:focus { - color: #fff; - text-decoration: none; - filter: alpha(opacity=90); - outline: 0; - opacity: .9; -} -.carousel-control .icon-prev, -.carousel-control .icon-next, -.carousel-control .glyphicon-chevron-left, -.carousel-control .glyphicon-chevron-right { - position: absolute; - top: 50%; - z-index: 5; - display: inline-block; - margin-top: -10px; -} -.carousel-control .icon-prev, -.carousel-control .glyphicon-chevron-left { - left: 50%; - margin-left: -10px; -} -.carousel-control .icon-next, -.carousel-control .glyphicon-chevron-right { - right: 50%; - margin-right: -10px; -} -.carousel-control .icon-prev, -.carousel-control .icon-next { - width: 20px; - height: 20px; - font-family: serif; - line-height: 1; -} -.carousel-control .icon-prev:before { - content: '\2039'; -} -.carousel-control .icon-next:before { - content: '\203a'; -} -.carousel-indicators { - position: absolute; - bottom: 10px; - left: 50%; - z-index: 15; - width: 60%; - padding-left: 0; - margin-left: -30%; - text-align: center; - list-style: none; -} -.carousel-indicators li { - display: inline-block; - width: 10px; - height: 10px; - margin: 1px; - text-indent: -999px; - cursor: pointer; - background-color: #000 \9; - background-color: rgba(0, 0, 0, 0); - border: 1px solid #fff; - border-radius: 10px; -} -.carousel-indicators .active { - width: 12px; - height: 12px; - margin: 0; - background-color: #fff; -} -.carousel-caption { - position: absolute; - right: 15%; - bottom: 20px; - left: 15%; - z-index: 10; - padding-top: 20px; - padding-bottom: 20px; - color: #fff; - text-align: center; - text-shadow: 0 1px 2px rgba(0, 0, 0, .6); -} -.carousel-caption .btn { - text-shadow: none; -} -@media screen and (min-width: 768px) { - .carousel-control .glyphicon-chevron-left, - .carousel-control .glyphicon-chevron-right, - .carousel-control .icon-prev, - .carousel-control .icon-next { - width: 30px; - height: 30px; - margin-top: -10px; - font-size: 30px; - } - .carousel-control .glyphicon-chevron-left, - .carousel-control .icon-prev { - margin-left: -10px; - } - .carousel-control .glyphicon-chevron-right, - .carousel-control .icon-next { - margin-right: -10px; - } - .carousel-caption { - right: 20%; - left: 20%; - padding-bottom: 30px; - } - .carousel-indicators { - bottom: 20px; - } -} -.clearfix:before, -.clearfix:after, -.dl-horizontal dd:before, -.dl-horizontal dd:after, -.container:before, -.container:after, -.container-fluid:before, -.container-fluid:after, -.row:before, -.row:after, -.form-horizontal .form-group:before, -.form-horizontal .form-group:after, -.btn-toolbar:before, -.btn-toolbar:after, -.btn-group-vertical > .btn-group:before, -.btn-group-vertical > .btn-group:after, -.nav:before, -.nav:after, -.navbar:before, -.navbar:after, -.navbar-header:before, -.navbar-header:after, -.navbar-collapse:before, -.navbar-collapse:after, -.pager:before, -.pager:after, -.panel-body:before, -.panel-body:after, -.modal-header:before, -.modal-header:after, -.modal-footer:before, -.modal-footer:after { - display: table; - content: " "; -} -.clearfix:after, -.dl-horizontal dd:after, -.container:after, -.container-fluid:after, -.row:after, -.form-horizontal .form-group:after, -.btn-toolbar:after, -.btn-group-vertical > .btn-group:after, -.nav:after, -.navbar:after, -.navbar-header:after, -.navbar-collapse:after, -.pager:after, -.panel-body:after, -.modal-header:after, -.modal-footer:after { - clear: both; -} -.center-block { - display: block; - margin-right: auto; - margin-left: auto; -} -.pull-right { - float: right !important; -} -.pull-left { - float: left !important; -} -.hide { - display: none !important; -} -.show { - display: block !important; -} -.invisible { - visibility: hidden; -} -.text-hide { - font: 0/0 a; - color: transparent; - text-shadow: none; - background-color: transparent; - border: 0; -} -.hidden { - display: none !important; -} -.affix { - position: fixed; -} -@-ms-viewport { - width: device-width; -} -.visible-xs, -.visible-sm, -.visible-md, -.visible-lg { - display: none !important; -} -.visible-xs-block, -.visible-xs-inline, -.visible-xs-inline-block, -.visible-sm-block, -.visible-sm-inline, -.visible-sm-inline-block, -.visible-md-block, -.visible-md-inline, -.visible-md-inline-block, -.visible-lg-block, -.visible-lg-inline, -.visible-lg-inline-block { - display: none !important; -} -@media (max-width: 767px) { - .visible-xs { - display: block !important; - } - table.visible-xs { - display: table !important; - } - tr.visible-xs { - display: table-row !important; - } - th.visible-xs, - td.visible-xs { - display: table-cell !important; - } -} -@media (max-width: 767px) { - .visible-xs-block { - display: block !important; - } -} -@media (max-width: 767px) { - .visible-xs-inline { - display: inline !important; - } -} -@media (max-width: 767px) { - .visible-xs-inline-block { - display: inline-block !important; - } -} -@media (min-width: 768px) and (max-width: 991px) { - .visible-sm { - display: block !important; - } - table.visible-sm { - display: table !important; - } - tr.visible-sm { - display: table-row !important; - } - th.visible-sm, - td.visible-sm { - display: table-cell !important; - } -} -@media (min-width: 768px) and (max-width: 991px) { - .visible-sm-block { - display: block !important; - } -} -@media (min-width: 768px) and (max-width: 991px) { - .visible-sm-inline { - display: inline !important; - } -} -@media (min-width: 768px) and (max-width: 991px) { - .visible-sm-inline-block { - display: inline-block !important; - } -} -@media (min-width: 992px) and (max-width: 1199px) { - .visible-md { - display: block !important; - } - table.visible-md { - display: table !important; - } - tr.visible-md { - display: table-row !important; - } - th.visible-md, - td.visible-md { - display: table-cell !important; - } -} -@media (min-width: 992px) and (max-width: 1199px) { - .visible-md-block { - display: block !important; - } -} -@media (min-width: 992px) and (max-width: 1199px) { - .visible-md-inline { - display: inline !important; - } -} -@media (min-width: 992px) and (max-width: 1199px) { - .visible-md-inline-block { - display: inline-block !important; - } -} -@media (min-width: 1200px) { - .visible-lg { - display: block !important; - } - table.visible-lg { - display: table !important; - } - tr.visible-lg { - display: table-row !important; - } - th.visible-lg, - td.visible-lg { - display: table-cell !important; - } -} -@media (min-width: 1200px) { - .visible-lg-block { - display: block !important; - } -} -@media (min-width: 1200px) { - .visible-lg-inline { - display: inline !important; - } -} -@media (min-width: 1200px) { - .visible-lg-inline-block { - display: inline-block !important; - } -} -@media (max-width: 767px) { - .hidden-xs { - display: none !important; - } -} -@media (min-width: 768px) and (max-width: 991px) { - .hidden-sm { - display: none !important; - } -} -@media (min-width: 992px) and (max-width: 1199px) { - .hidden-md { - display: none !important; - } -} -@media (min-width: 1200px) { - .hidden-lg { - display: none !important; - } -} -.visible-print { - display: none !important; -} -@media print { - .visible-print { - display: block !important; - } - table.visible-print { - display: table !important; - } - tr.visible-print { - display: table-row !important; - } - th.visible-print, - td.visible-print { - display: table-cell !important; - } -} -.visible-print-block { - display: none !important; -} -@media print { - .visible-print-block { - display: block !important; - } -} -.visible-print-inline { - display: none !important; -} -@media print { - .visible-print-inline { - display: inline !important; - } -} -.visible-print-inline-block { - display: none !important; -} -@media print { - .visible-print-inline-block { - display: inline-block !important; - } -} -@media print { - .hidden-print { - display: none !important; - } -} -/*# sourceMappingURL=bootstrap.css.map */ -/*! - * Bootstrap v3.3.5 (http://getbootstrap.com) - * Copyright 2011-2015 Twitter, Inc. - * Licensed under MIT (https://github.com/twbs/bootstrap/blob/master/LICENSE) - */ -/*! normalize.css v3.0.3 | MIT License | github.com/necolas/normalize.css */ -html { - font-family: sans-serif; - -webkit-text-size-adjust: 100%; - -ms-text-size-adjust: 100%; -} -body { - margin: 0; -} -article, -aside, -details, -figcaption, -figure, -footer, -header, -hgroup, -main, -menu, -nav, -section, -summary { - display: block; -} -audio, -canvas, -progress, -video { - display: inline-block; - vertical-align: baseline; -} -audio:not([controls]) { - display: none; - height: 0; -} -[hidden], -template { - display: none; -} -a { - background-color: transparent; -} -a:active, -a:hover { - outline: 0; -} -abbr[title] { - border-bottom: 1px dotted; -} -b, -strong { - font-weight: bold; -} -dfn { - font-style: italic; -} -h1 { - margin: .67em 0; - font-size: 2em; -} -mark { - color: #000; - background: #ff0; -} -small { - font-size: 80%; -} -sub, -sup { - position: relative; - font-size: 75%; - line-height: 0; - vertical-align: baseline; -} -sup { - top: -.5em; -} -sub { - bottom: -.25em; -} -img { - border: 0; -} -svg:not(:root) { - overflow: hidden; -} -figure { - margin: 1em 40px; -} -hr { - height: 0; - -webkit-box-sizing: content-box; - -moz-box-sizing: content-box; - box-sizing: content-box; -} -pre { - overflow: auto; -} -code, -kbd, -pre, -samp { - font-family: monospace, monospace; - font-size: 1em; -} -button, -input, -optgroup, -select, -textarea { - margin: 0; - font: inherit; - color: inherit; -} -button { - overflow: visible; -} -button, -select { - text-transform: none; -} -button, -html input[type="button"], -input[type="reset"], -input[type="submit"] { - -webkit-appearance: button; - cursor: pointer; -} -button[disabled], -html input[disabled] { - cursor: default; -} -button::-moz-focus-inner, -input::-moz-focus-inner { - padding: 0; - border: 0; -} -input { - line-height: normal; -} -input[type="checkbox"], -input[type="radio"] { - -webkit-box-sizing: border-box; - -moz-box-sizing: border-box; - box-sizing: border-box; - padding: 0; -} -input[type="number"]::-webkit-inner-spin-button, -input[type="number"]::-webkit-outer-spin-button { - height: auto; -} -input[type="search"] { - -webkit-box-sizing: content-box; - -moz-box-sizing: content-box; - box-sizing: content-box; - -webkit-appearance: textfield; -} -input[type="search"]::-webkit-search-cancel-button, -input[type="search"]::-webkit-search-decoration { - -webkit-appearance: none; -} -fieldset { - padding: .35em .625em .75em; - margin: 0 2px; - border: 1px solid #c0c0c0; -} -legend { - padding: 0; - border: 0; -} -textarea { - overflow: auto; -} -optgroup { - font-weight: bold; -} -table { - border-spacing: 0; - border-collapse: collapse; -} -td, -th { - padding: 0; -} -/*! Source: https://github.com/h5bp/html5-boilerplate/blob/master/src/css/main.css */ -@media print { - *, - *:before, - *:after { - color: #000 !important; - text-shadow: none !important; - background: transparent !important; - -webkit-box-shadow: none !important; - box-shadow: none !important; - } - a, - a:visited { - text-decoration: underline; - } - a[href]:after { - content: " (" attr(href) ")"; - } - abbr[title]:after { - content: " (" attr(title) ")"; - } - a[href^="#"]:after, - a[href^="javascript:"]:after { - content: ""; - } - pre, - blockquote { - border: 1px solid #999; - - page-break-inside: avoid; - } - thead { - display: table-header-group; - } - tr, - img { - page-break-inside: avoid; - } - img { - max-width: 100% !important; - } - p, - h2, - h3 { - orphans: 3; - widows: 3; - } - h2, - h3 { - page-break-after: avoid; - } - .navbar { - display: none; - } - .btn > .caret, - .dropup > .btn > .caret { - border-top-color: #000 !important; - } - .label { - border: 1px solid #000; - } - .table { - border-collapse: collapse !important; - } - .table td, - .table th { - background-color: #fff !important; - } - .table-bordered th, - .table-bordered td { - border: 1px solid #ddd !important; - } -} -@font-face { - font-family: 'Glyphicons Halflings'; - - src: url('../fonts/glyphicons-halflings-regular.eot'); - src: url('../fonts/glyphicons-halflings-regular.eot?#iefix') format('embedded-opentype'), url('../fonts/glyphicons-halflings-regular.woff2') format('woff2'), url('../fonts/glyphicons-halflings-regular.woff') format('woff'), url('../fonts/glyphicons-halflings-regular.ttf') format('truetype'), url('../fonts/glyphicons-halflings-regular.svg#glyphicons_halflingsregular') format('svg'); -} -.glyphicon { - position: relative; - top: 1px; - display: inline-block; - font-family: 'Glyphicons Halflings'; - font-style: normal; - font-weight: normal; - line-height: 1; - - -webkit-font-smoothing: antialiased; - -moz-osx-font-smoothing: grayscale; -} -.glyphicon-asterisk:before { - content: "\2a"; -} -.glyphicon-plus:before { - content: "\2b"; -} -.glyphicon-euro:before, -.glyphicon-eur:before { - content: "\20ac"; -} -.glyphicon-minus:before { - content: "\2212"; -} -.glyphicon-cloud:before { - content: "\2601"; -} -.glyphicon-envelope:before { - content: "\2709"; -} -.glyphicon-pencil:before { - content: "\270f"; -} -.glyphicon-glass:before { - content: "\e001"; -} -.glyphicon-music:before { - content: "\e002"; -} -.glyphicon-search:before { - content: "\e003"; -} -.glyphicon-heart:before { - content: "\e005"; -} -.glyphicon-star:before { - content: "\e006"; -} -.glyphicon-star-empty:before { - content: "\e007"; -} -.glyphicon-user:before { - content: "\e008"; -} -.glyphicon-film:before { - content: "\e009"; -} -.glyphicon-th-large:before { - content: "\e010"; -} -.glyphicon-th:before { - content: "\e011"; -} -.glyphicon-th-list:before { - content: "\e012"; -} -.glyphicon-ok:before { - content: "\e013"; -} -.glyphicon-remove:before { - content: "\e014"; -} -.glyphicon-zoom-in:before { - content: "\e015"; -} -.glyphicon-zoom-out:before { - content: "\e016"; -} -.glyphicon-off:before { - content: "\e017"; -} -.glyphicon-signal:before { - content: "\e018"; -} -.glyphicon-cog:before { - content: "\e019"; -} -.glyphicon-trash:before { - content: "\e020"; -} -.glyphicon-home:before { - content: "\e021"; -} -.glyphicon-file:before { - content: "\e022"; -} -.glyphicon-time:before { - content: "\e023"; -} -.glyphicon-road:before { - content: "\e024"; -} -.glyphicon-download-alt:before { - content: "\e025"; -} -.glyphicon-download:before { - content: "\e026"; -} -.glyphicon-upload:before { - content: "\e027"; -} -.glyphicon-inbox:before { - content: "\e028"; -} -.glyphicon-play-circle:before { - content: "\e029"; -} -.glyphicon-repeat:before { - content: "\e030"; -} -.glyphicon-refresh:before { - content: "\e031"; -} -.glyphicon-list-alt:before { - content: "\e032"; -} -.glyphicon-lock:before { - content: "\e033"; -} -.glyphicon-flag:before { - content: "\e034"; -} -.glyphicon-headphones:before { - content: "\e035"; -} -.glyphicon-volume-off:before { - content: "\e036"; -} -.glyphicon-volume-down:before { - content: "\e037"; -} -.glyphicon-volume-up:before { - content: "\e038"; -} -.glyphicon-qrcode:before { - content: "\e039"; -} -.glyphicon-barcode:before { - content: "\e040"; -} -.glyphicon-tag:before { - content: "\e041"; -} -.glyphicon-tags:before { - content: "\e042"; -} -.glyphicon-book:before { - content: "\e043"; -} -.glyphicon-bookmark:before { - content: "\e044"; -} -.glyphicon-print:before { - content: "\e045"; -} -.glyphicon-camera:before { - content: "\e046"; -} -.glyphicon-font:before { - content: "\e047"; -} -.glyphicon-bold:before { - content: "\e048"; -} -.glyphicon-italic:before { - content: "\e049"; -} -.glyphicon-text-height:before { - content: "\e050"; -} -.glyphicon-text-width:before { - content: "\e051"; -} -.glyphicon-align-left:before { - content: "\e052"; -} -.glyphicon-align-center:before { - content: "\e053"; -} -.glyphicon-align-right:before { - content: "\e054"; -} -.glyphicon-align-justify:before { - content: "\e055"; -} -.glyphicon-list:before { - content: "\e056"; -} -.glyphicon-indent-left:before { - content: "\e057"; -} -.glyphicon-indent-right:before { - content: "\e058"; -} -.glyphicon-facetime-video:before { - content: "\e059"; -} -.glyphicon-picture:before { - content: "\e060"; -} -.glyphicon-map-marker:before { - content: "\e062"; -} -.glyphicon-adjust:before { - content: "\e063"; -} -.glyphicon-tint:before { - content: "\e064"; -} -.glyphicon-edit:before { - content: "\e065"; -} -.glyphicon-share:before { - content: "\e066"; -} -.glyphicon-check:before { - content: "\e067"; -} -.glyphicon-move:before { - content: "\e068"; -} -.glyphicon-step-backward:before { - content: "\e069"; -} -.glyphicon-fast-backward:before { - content: "\e070"; -} -.glyphicon-backward:before { - content: "\e071"; -} -.glyphicon-play:before { - content: "\e072"; -} -.glyphicon-pause:before { - content: "\e073"; -} -.glyphicon-stop:before { - content: "\e074"; -} -.glyphicon-forward:before { - content: "\e075"; -} -.glyphicon-fast-forward:before { - content: "\e076"; -} -.glyphicon-step-forward:before { - content: "\e077"; -} -.glyphicon-eject:before { - content: "\e078"; -} -.glyphicon-chevron-left:before { - content: "\e079"; -} -.glyphicon-chevron-right:before { - content: "\e080"; -} -.glyphicon-plus-sign:before { - content: "\e081"; -} -.glyphicon-minus-sign:before { - content: "\e082"; -} -.glyphicon-remove-sign:before { - content: "\e083"; -} -.glyphicon-ok-sign:before { - content: "\e084"; -} -.glyphicon-question-sign:before { - content: "\e085"; -} -.glyphicon-info-sign:before { - content: "\e086"; -} -.glyphicon-screenshot:before { - content: "\e087"; -} -.glyphicon-remove-circle:before { - content: "\e088"; -} -.glyphicon-ok-circle:before { - content: "\e089"; -} -.glyphicon-ban-circle:before { - content: "\e090"; -} -.glyphicon-arrow-left:before { - content: "\e091"; -} -.glyphicon-arrow-right:before { - content: "\e092"; -} -.glyphicon-arrow-up:before { - content: "\e093"; -} -.glyphicon-arrow-down:before { - content: "\e094"; -} -.glyphicon-share-alt:before { - content: "\e095"; -} -.glyphicon-resize-full:before { - content: "\e096"; -} -.glyphicon-resize-small:before { - content: "\e097"; -} -.glyphicon-exclamation-sign:before { - content: "\e101"; -} -.glyphicon-gift:before { - content: "\e102"; -} -.glyphicon-leaf:before { - content: "\e103"; -} -.glyphicon-fire:before { - content: "\e104"; -} -.glyphicon-eye-open:before { - content: "\e105"; -} -.glyphicon-eye-close:before { - content: "\e106"; -} -.glyphicon-warning-sign:before { - content: "\e107"; -} -.glyphicon-plane:before { - content: "\e108"; -} -.glyphicon-calendar:before { - content: "\e109"; -} -.glyphicon-random:before { - content: "\e110"; -} -.glyphicon-comment:before { - content: "\e111"; -} -.glyphicon-magnet:before { - content: "\e112"; -} -.glyphicon-chevron-up:before { - content: "\e113"; -} -.glyphicon-chevron-down:before { - content: "\e114"; -} -.glyphicon-retweet:before { - content: "\e115"; -} -.glyphicon-shopping-cart:before { - content: "\e116"; -} -.glyphicon-folder-close:before { - content: "\e117"; -} -.glyphicon-folder-open:before { - content: "\e118"; -} -.glyphicon-resize-vertical:before { - content: "\e119"; -} -.glyphicon-resize-horizontal:before { - content: "\e120"; -} -.glyphicon-hdd:before { - content: "\e121"; -} -.glyphicon-bullhorn:before { - content: "\e122"; -} -.glyphicon-bell:before { - content: "\e123"; -} -.glyphicon-certificate:before { - content: "\e124"; -} -.glyphicon-thumbs-up:before { - content: "\e125"; -} -.glyphicon-thumbs-down:before { - content: "\e126"; -} -.glyphicon-hand-right:before { - content: "\e127"; -} -.glyphicon-hand-left:before { - content: "\e128"; -} -.glyphicon-hand-up:before { - content: "\e129"; -} -.glyphicon-hand-down:before { - content: "\e130"; -} -.glyphicon-circle-arrow-right:before { - content: "\e131"; -} -.glyphicon-circle-arrow-left:before { - content: "\e132"; -} -.glyphicon-circle-arrow-up:before { - content: "\e133"; -} -.glyphicon-circle-arrow-down:before { - content: "\e134"; -} -.glyphicon-globe:before { - content: "\e135"; -} -.glyphicon-wrench:before { - content: "\e136"; -} -.glyphicon-tasks:before { - content: "\e137"; -} -.glyphicon-filter:before { - content: "\e138"; -} -.glyphicon-briefcase:before { - content: "\e139"; -} -.glyphicon-fullscreen:before { - content: "\e140"; -} -.glyphicon-dashboard:before { - content: "\e141"; -} -.glyphicon-paperclip:before { - content: "\e142"; -} -.glyphicon-heart-empty:before { - content: "\e143"; -} -.glyphicon-link:before { - content: "\e144"; -} -.glyphicon-phone:before { - content: "\e145"; -} -.glyphicon-pushpin:before { - content: "\e146"; -} -.glyphicon-usd:before { - content: "\e148"; -} -.glyphicon-gbp:before { - content: "\e149"; -} -.glyphicon-sort:before { - content: "\e150"; -} -.glyphicon-sort-by-alphabet:before { - content: "\e151"; -} -.glyphicon-sort-by-alphabet-alt:before { - content: "\e152"; -} -.glyphicon-sort-by-order:before { - content: "\e153"; -} -.glyphicon-sort-by-order-alt:before { - content: "\e154"; -} -.glyphicon-sort-by-attributes:before { - content: "\e155"; -} -.glyphicon-sort-by-attributes-alt:before { - content: "\e156"; -} -.glyphicon-unchecked:before { - content: "\e157"; -} -.glyphicon-expand:before { - content: "\e158"; -} -.glyphicon-collapse-down:before { - content: "\e159"; -} -.glyphicon-collapse-up:before { - content: "\e160"; -} -.glyphicon-log-in:before { - content: "\e161"; -} -.glyphicon-flash:before { - content: "\e162"; -} -.glyphicon-log-out:before { - content: "\e163"; -} -.glyphicon-new-window:before { - content: "\e164"; -} -.glyphicon-record:before { - content: "\e165"; -} -.glyphicon-save:before { - content: "\e166"; -} -.glyphicon-open:before { - content: "\e167"; -} -.glyphicon-saved:before { - content: "\e168"; -} -.glyphicon-import:before { - content: "\e169"; -} -.glyphicon-export:before { - content: "\e170"; -} -.glyphicon-send:before { - content: "\e171"; -} -.glyphicon-floppy-disk:before { - content: "\e172"; -} -.glyphicon-floppy-saved:before { - content: "\e173"; -} -.glyphicon-floppy-remove:before { - content: "\e174"; -} -.glyphicon-floppy-save:before { - content: "\e175"; -} -.glyphicon-floppy-open:before { - content: "\e176"; -} -.glyphicon-credit-card:before { - content: "\e177"; -} -.glyphicon-transfer:before { - content: "\e178"; -} -.glyphicon-cutlery:before { - content: "\e179"; -} -.glyphicon-header:before { - content: "\e180"; -} -.glyphicon-compressed:before { - content: "\e181"; -} -.glyphicon-earphone:before { - content: "\e182"; -} -.glyphicon-phone-alt:before { - content: "\e183"; -} -.glyphicon-tower:before { - content: "\e184"; -} -.glyphicon-stats:before { - content: "\e185"; -} -.glyphicon-sd-video:before { - content: "\e186"; -} -.glyphicon-hd-video:before { - content: "\e187"; -} -.glyphicon-subtitles:before { - content: "\e188"; -} -.glyphicon-sound-stereo:before { - content: "\e189"; -} -.glyphicon-sound-dolby:before { - content: "\e190"; -} -.glyphicon-sound-5-1:before { - content: "\e191"; -} -.glyphicon-sound-6-1:before { - content: "\e192"; -} -.glyphicon-sound-7-1:before { - content: "\e193"; -} -.glyphicon-copyright-mark:before { - content: "\e194"; -} -.glyphicon-registration-mark:before { - content: "\e195"; -} -.glyphicon-cloud-download:before { - content: "\e197"; -} -.glyphicon-cloud-upload:before { - content: "\e198"; -} -.glyphicon-tree-conifer:before { - content: "\e199"; -} -.glyphicon-tree-deciduous:before { - content: "\e200"; -} -.glyphicon-cd:before { - content: "\e201"; -} -.glyphicon-save-file:before { - content: "\e202"; -} -.glyphicon-open-file:before { - content: "\e203"; -} -.glyphicon-level-up:before { - content: "\e204"; -} -.glyphicon-copy:before { - content: "\e205"; -} -.glyphicon-paste:before { - content: "\e206"; -} -.glyphicon-alert:before { - content: "\e209"; -} -.glyphicon-equalizer:before { - content: "\e210"; -} -.glyphicon-king:before { - content: "\e211"; -} -.glyphicon-queen:before { - content: "\e212"; -} -.glyphicon-pawn:before { - content: "\e213"; -} -.glyphicon-bishop:before { - content: "\e214"; -} -.glyphicon-knight:before { - content: "\e215"; -} -.glyphicon-baby-formula:before { - content: "\e216"; -} -.glyphicon-tent:before { - content: "\26fa"; -} -.glyphicon-blackboard:before { - content: "\e218"; -} -.glyphicon-bed:before { - content: "\e219"; -} -.glyphicon-apple:before { - content: "\f8ff"; -} -.glyphicon-erase:before { - content: "\e221"; -} -.glyphicon-hourglass:before { - content: "\231b"; -} -.glyphicon-lamp:before { - content: "\e223"; -} -.glyphicon-duplicate:before { - content: "\e224"; -} -.glyphicon-piggy-bank:before { - content: "\e225"; -} -.glyphicon-scissors:before { - content: "\e226"; -} -.glyphicon-bitcoin:before { - content: "\e227"; -} -.glyphicon-btc:before { - content: "\e227"; -} -.glyphicon-xbt:before { - content: "\e227"; -} -.glyphicon-yen:before { - content: "\00a5"; -} -.glyphicon-jpy:before { - content: "\00a5"; -} -.glyphicon-ruble:before { - content: "\20bd"; -} -.glyphicon-rub:before { - content: "\20bd"; -} -.glyphicon-scale:before { - content: "\e230"; -} -.glyphicon-ice-lolly:before { - content: "\e231"; -} -.glyphicon-ice-lolly-tasted:before { - content: "\e232"; -} -.glyphicon-education:before { - content: "\e233"; -} -.glyphicon-option-horizontal:before { - content: "\e234"; -} -.glyphicon-option-vertical:before { - content: "\e235"; -} -.glyphicon-menu-hamburger:before { - content: "\e236"; -} -.glyphicon-modal-window:before { - content: "\e237"; -} -.glyphicon-oil:before { - content: "\e238"; -} -.glyphicon-grain:before { - content: "\e239"; -} -.glyphicon-sunglasses:before { - content: "\e240"; -} -.glyphicon-text-size:before { - content: "\e241"; -} -.glyphicon-text-color:before { - content: "\e242"; -} -.glyphicon-text-background:before { - content: "\e243"; -} -.glyphicon-object-align-top:before { - content: "\e244"; -} -.glyphicon-object-align-bottom:before { - content: "\e245"; -} -.glyphicon-object-align-horizontal:before { - content: "\e246"; -} -.glyphicon-object-align-left:before { - content: "\e247"; -} -.glyphicon-object-align-vertical:before { - content: "\e248"; -} -.glyphicon-object-align-right:before { - content: "\e249"; -} -.glyphicon-triangle-right:before { - content: "\e250"; -} -.glyphicon-triangle-left:before { - content: "\e251"; -} -.glyphicon-triangle-bottom:before { - content: "\e252"; -} -.glyphicon-triangle-top:before { - content: "\e253"; -} -.glyphicon-console:before { - content: "\e254"; -} -.glyphicon-superscript:before { - content: "\e255"; -} -.glyphicon-subscript:before { - content: "\e256"; -} -.glyphicon-menu-left:before { - content: "\e257"; -} -.glyphicon-menu-right:before { - content: "\e258"; -} -.glyphicon-menu-down:before { - content: "\e259"; -} -.glyphicon-menu-up:before { - content: "\e260"; -} -* { - -webkit-box-sizing: border-box; - -moz-box-sizing: border-box; - box-sizing: border-box; -} -*:before, -*:after { - -webkit-box-sizing: border-box; - -moz-box-sizing: border-box; - box-sizing: border-box; -} -html { - font-size: 10px; - - -webkit-tap-highlight-color: rgba(0, 0, 0, 0); -} -body { - font-family: "Helvetica Neue", Helvetica, Arial, sans-serif; - font-size: 14px; - line-height: 1.42857143; - color: #333; - background-color: #fff; -} -input, -button, -select, -textarea { - font-family: inherit; - font-size: inherit; - line-height: inherit; -} -a { - color: #337ab7; - text-decoration: none; -} -a:hover, -a:focus { - color: #23527c; - text-decoration: underline; -} -a:focus { - outline: thin dotted; - outline: 5px auto -webkit-focus-ring-color; - outline-offset: -2px; -} -figure { - margin: 0; -} -img { - vertical-align: middle; -} -.img-responsive, -.thumbnail > img, -.thumbnail a > img, -.carousel-inner > .item > img, -.carousel-inner > .item > a > img { - display: block; - max-width: 100%; - height: auto; -} -.img-rounded { - border-radius: 6px; -} -.img-thumbnail { - display: inline-block; - max-width: 100%; - height: auto; - padding: 4px; - line-height: 1.42857143; - background-color: #fff; - border: 1px solid #ddd; - border-radius: 4px; - -webkit-transition: all .2s ease-in-out; - -o-transition: all .2s ease-in-out; - transition: all .2s ease-in-out; -} -.img-circle { - border-radius: 50%; -} -hr { - margin-top: 20px; - margin-bottom: 20px; - border: 0; - border-top: 1px solid #eee; -} -.sr-only { - position: absolute; - width: 1px; - height: 1px; - padding: 0; - margin: -1px; - overflow: hidden; - clip: rect(0, 0, 0, 0); - border: 0; -} -.sr-only-focusable:active, -.sr-only-focusable:focus { - position: static; - width: auto; - height: auto; - margin: 0; - overflow: visible; - clip: auto; -} -[role="button"] { - cursor: pointer; -} -h1, -h2, -h3, -h4, -h5, -h6, -.h1, -.h2, -.h3, -.h4, -.h5, -.h6 { - font-family: inherit; - font-weight: 500; - line-height: 1.1; - color: inherit; -} -h1 small, -h2 small, -h3 small, -h4 small, -h5 small, -h6 small, -.h1 small, -.h2 small, -.h3 small, -.h4 small, -.h5 small, -.h6 small, -h1 .small, -h2 .small, -h3 .small, -h4 .small, -h5 .small, -h6 .small, -.h1 .small, -.h2 .small, -.h3 .small, -.h4 .small, -.h5 .small, -.h6 .small { - font-weight: normal; - line-height: 1; - color: #777; -} -h1, -.h1, -h2, -.h2, -h3, -.h3 { - margin-top: 20px; - margin-bottom: 10px; -} -h1 small, -.h1 small, -h2 small, -.h2 small, -h3 small, -.h3 small, -h1 .small, -.h1 .small, -h2 .small, -.h2 .small, -h3 .small, -.h3 .small { - font-size: 65%; -} -h4, -.h4, -h5, -.h5, -h6, -.h6 { - margin-top: 10px; - margin-bottom: 10px; -} -h4 small, -.h4 small, -h5 small, -.h5 small, -h6 small, -.h6 small, -h4 .small, -.h4 .small, -h5 .small, -.h5 .small, -h6 .small, -.h6 .small { - font-size: 75%; -} -h1, -.h1 { - font-size: 36px; -} -h2, -.h2 { - font-size: 30px; -} -h3, -.h3 { - font-size: 24px; -} -h4, -.h4 { - font-size: 18px; -} -h5, -.h5 { - font-size: 14px; -} -h6, -.h6 { - font-size: 12px; -} -p { - margin: 0 0 10px; -} -.lead { - margin-bottom: 20px; - font-size: 16px; - font-weight: 300; - line-height: 1.4; -} -@media (min-width: 768px) { - .lead { - font-size: 21px; - } -} -small, -.small { - font-size: 85%; -} -mark, -.mark { - padding: .2em; - background-color: #fcf8e3; -} -.text-left { - text-align: left; -} -.text-right { - text-align: right; -} -.text-center { - text-align: center; -} -.text-justify { - text-align: justify; -} -.text-nowrap { - white-space: nowrap; -} -.text-lowercase { - text-transform: lowercase; -} -.text-uppercase { - text-transform: uppercase; -} -.text-capitalize { - text-transform: capitalize; -} -.text-muted { - color: #777; -} -.text-primary { - color: #337ab7; -} -a.text-primary:hover, -a.text-primary:focus { - color: #286090; -} -.text-success { - color: #3c763d; -} -a.text-success:hover, -a.text-success:focus { - color: #2b542c; -} -.text-info { - color: #31708f; -} -a.text-info:hover, -a.text-info:focus { - color: #245269; -} -.text-warning { - color: #8a6d3b; -} -a.text-warning:hover, -a.text-warning:focus { - color: #66512c; -} -.text-danger { - color: #a94442; -} -a.text-danger:hover, -a.text-danger:focus { - color: #843534; -} -.bg-primary { - color: #fff; - background-color: #337ab7; -} -a.bg-primary:hover, -a.bg-primary:focus { - background-color: #286090; -} -.bg-success { - background-color: #dff0d8; -} -a.bg-success:hover, -a.bg-success:focus { - background-color: #c1e2b3; -} -.bg-info { - background-color: #d9edf7; -} -a.bg-info:hover, -a.bg-info:focus { - background-color: #afd9ee; -} -.bg-warning { - background-color: #fcf8e3; -} -a.bg-warning:hover, -a.bg-warning:focus { - background-color: #f7ecb5; -} -.bg-danger { - background-color: #f2dede; -} -a.bg-danger:hover, -a.bg-danger:focus { - background-color: #e4b9b9; -} -.page-header { - padding-bottom: 9px; - margin: 40px 0 20px; - border-bottom: 1px solid #eee; -} -ul, -ol { - margin-top: 0; - margin-bottom: 10px; -} -ul ul, -ol ul, -ul ol, -ol ol { - margin-bottom: 0; -} -.list-unstyled { - padding-left: 0; - list-style: none; -} -.list-inline { - padding-left: 0; - margin-left: -5px; - list-style: none; -} -.list-inline > li { - display: inline-block; - padding-right: 5px; - padding-left: 5px; -} -dl { - margin-top: 0; - margin-bottom: 20px; -} -dt, -dd { - line-height: 1.42857143; -} -dt { - font-weight: bold; -} -dd { - margin-left: 0; -} -@media (min-width: 768px) { - .dl-horizontal dt { - float: left; - width: 160px; - overflow: hidden; - clear: left; - text-align: right; - text-overflow: ellipsis; - white-space: nowrap; - } - .dl-horizontal dd { - margin-left: 180px; - } -} -abbr[title], -abbr[data-original-title] { - cursor: help; - border-bottom: 1px dotted #777; -} -.initialism { - font-size: 90%; - text-transform: uppercase; -} -blockquote { - padding: 10px 20px; - margin: 0 0 20px; - font-size: 17.5px; - border-left: 5px solid #eee; -} -blockquote p:last-child, -blockquote ul:last-child, -blockquote ol:last-child { - margin-bottom: 0; -} -blockquote footer, -blockquote small, -blockquote .small { - display: block; - font-size: 80%; - line-height: 1.42857143; - color: #777; -} -blockquote footer:before, -blockquote small:before, -blockquote .small:before { - content: '\2014 \00A0'; -} -.blockquote-reverse, -blockquote.pull-right { - padding-right: 15px; - padding-left: 0; - text-align: right; - border-right: 5px solid #eee; - border-left: 0; -} -.blockquote-reverse footer:before, -blockquote.pull-right footer:before, -.blockquote-reverse small:before, -blockquote.pull-right small:before, -.blockquote-reverse .small:before, -blockquote.pull-right .small:before { - content: ''; -} -.blockquote-reverse footer:after, -blockquote.pull-right footer:after, -.blockquote-reverse small:after, -blockquote.pull-right small:after, -.blockquote-reverse .small:after, -blockquote.pull-right .small:after { - content: '\00A0 \2014'; -} -address { - margin-bottom: 20px; - font-style: normal; - line-height: 1.42857143; -} -code, -kbd, -pre, -samp { - font-family: Menlo, Monaco, Consolas, "Courier New", monospace; -} -code { - padding: 2px 4px; - font-size: 90%; - color: #c7254e; - background-color: #f9f2f4; - border-radius: 4px; -} -kbd { - padding: 2px 4px; - font-size: 90%; - color: #fff; - background-color: #333; - border-radius: 3px; - -webkit-box-shadow: inset 0 -1px 0 rgba(0, 0, 0, .25); - box-shadow: inset 0 -1px 0 rgba(0, 0, 0, .25); -} -kbd kbd { - padding: 0; - font-size: 100%; - font-weight: bold; - -webkit-box-shadow: none; - box-shadow: none; -} -pre { - display: block; - padding: 9.5px; - margin: 0 0 10px; - font-size: 13px; - line-height: 1.42857143; - color: #333; - word-break: break-all; - word-wrap: break-word; - background-color: #f5f5f5; - border: 1px solid #ccc; - border-radius: 4px; -} -pre code { - padding: 0; - font-size: inherit; - color: inherit; - white-space: pre-wrap; - background-color: transparent; - border-radius: 0; -} -.pre-scrollable { - max-height: 340px; - overflow-y: scroll; -} -.container { - padding-right: 15px; - padding-left: 15px; - margin-right: auto; - margin-left: auto; -} -@media (min-width: 768px) { - .container { - width: 750px; - } -} -@media (min-width: 992px) { - .container { - width: 970px; - } -} -@media (min-width: 1200px) { - .container { - width: 1170px; - } -} -.container-fluid { - padding-right: 15px; - padding-left: 15px; - margin-right: auto; - margin-left: auto; -} -.row { - margin-right: -15px; - margin-left: -15px; -} -.col-xs-1, .col-sm-1, .col-md-1, .col-lg-1, .col-xs-2, .col-sm-2, .col-md-2, .col-lg-2, .col-xs-3, .col-sm-3, .col-md-3, .col-lg-3, .col-xs-4, .col-sm-4, .col-md-4, .col-lg-4, .col-xs-5, .col-sm-5, .col-md-5, .col-lg-5, .col-xs-6, .col-sm-6, .col-md-6, .col-lg-6, .col-xs-7, .col-sm-7, .col-md-7, .col-lg-7, .col-xs-8, .col-sm-8, .col-md-8, .col-lg-8, .col-xs-9, .col-sm-9, .col-md-9, .col-lg-9, .col-xs-10, .col-sm-10, .col-md-10, .col-lg-10, .col-xs-11, .col-sm-11, .col-md-11, .col-lg-11, .col-xs-12, .col-sm-12, .col-md-12, .col-lg-12 { - position: relative; - min-height: 1px; - padding-right: 15px; - padding-left: 15px; -} -.col-xs-1, .col-xs-2, .col-xs-3, .col-xs-4, .col-xs-5, .col-xs-6, .col-xs-7, .col-xs-8, .col-xs-9, .col-xs-10, .col-xs-11, .col-xs-12 { - float: left; -} -.col-xs-12 { - width: 100%; -} -.col-xs-11 { - width: 91.66666667%; -} -.col-xs-10 { - width: 83.33333333%; -} -.col-xs-9 { - width: 75%; -} -.col-xs-8 { - width: 66.66666667%; -} -.col-xs-7 { - width: 58.33333333%; -} -.col-xs-6 { - width: 50%; -} -.col-xs-5 { - width: 41.66666667%; -} -.col-xs-4 { - width: 33.33333333%; -} -.col-xs-3 { - width: 25%; -} -.col-xs-2 { - width: 16.66666667%; -} -.col-xs-1 { - width: 8.33333333%; -} -.col-xs-pull-12 { - right: 100%; -} -.col-xs-pull-11 { - right: 91.66666667%; -} -.col-xs-pull-10 { - right: 83.33333333%; -} -.col-xs-pull-9 { - right: 75%; -} -.col-xs-pull-8 { - right: 66.66666667%; -} -.col-xs-pull-7 { - right: 58.33333333%; -} -.col-xs-pull-6 { - right: 50%; -} -.col-xs-pull-5 { - right: 41.66666667%; -} -.col-xs-pull-4 { - right: 33.33333333%; -} -.col-xs-pull-3 { - right: 25%; -} -.col-xs-pull-2 { - right: 16.66666667%; -} -.col-xs-pull-1 { - right: 8.33333333%; -} -.col-xs-pull-0 { - right: auto; -} -.col-xs-push-12 { - left: 100%; -} -.col-xs-push-11 { - left: 91.66666667%; -} -.col-xs-push-10 { - left: 83.33333333%; -} -.col-xs-push-9 { - left: 75%; -} -.col-xs-push-8 { - left: 66.66666667%; -} -.col-xs-push-7 { - left: 58.33333333%; -} -.col-xs-push-6 { - left: 50%; -} -.col-xs-push-5 { - left: 41.66666667%; -} -.col-xs-push-4 { - left: 33.33333333%; -} -.col-xs-push-3 { - left: 25%; -} -.col-xs-push-2 { - left: 16.66666667%; -} -.col-xs-push-1 { - left: 8.33333333%; -} -.col-xs-push-0 { - left: auto; -} -.col-xs-offset-12 { - margin-left: 100%; -} -.col-xs-offset-11 { - margin-left: 91.66666667%; -} -.col-xs-offset-10 { - margin-left: 83.33333333%; -} -.col-xs-offset-9 { - margin-left: 75%; -} -.col-xs-offset-8 { - margin-left: 66.66666667%; -} -.col-xs-offset-7 { - margin-left: 58.33333333%; -} -.col-xs-offset-6 { - margin-left: 50%; -} -.col-xs-offset-5 { - margin-left: 41.66666667%; -} -.col-xs-offset-4 { - margin-left: 33.33333333%; -} -.col-xs-offset-3 { - margin-left: 25%; -} -.col-xs-offset-2 { - margin-left: 16.66666667%; -} -.col-xs-offset-1 { - margin-left: 8.33333333%; -} -.col-xs-offset-0 { - margin-left: 0; -} -@media (min-width: 768px) { - .col-sm-1, .col-sm-2, .col-sm-3, .col-sm-4, .col-sm-5, .col-sm-6, .col-sm-7, .col-sm-8, .col-sm-9, .col-sm-10, .col-sm-11, .col-sm-12 { - float: left; - } - .col-sm-12 { - width: 100%; - } - .col-sm-11 { - width: 91.66666667%; - } - .col-sm-10 { - width: 83.33333333%; - } - .col-sm-9 { - width: 75%; - } - .col-sm-8 { - width: 66.66666667%; - } - .col-sm-7 { - width: 58.33333333%; - } - .col-sm-6 { - width: 50%; - } - .col-sm-5 { - width: 41.66666667%; - } - .col-sm-4 { - width: 33.33333333%; - } - .col-sm-3 { - width: 25%; - } - .col-sm-2 { - width: 16.66666667%; - } - .col-sm-1 { - width: 8.33333333%; - } - .col-sm-pull-12 { - right: 100%; - } - .col-sm-pull-11 { - right: 91.66666667%; - } - .col-sm-pull-10 { - right: 83.33333333%; - } - .col-sm-pull-9 { - right: 75%; - } - .col-sm-pull-8 { - right: 66.66666667%; - } - .col-sm-pull-7 { - right: 58.33333333%; - } - .col-sm-pull-6 { - right: 50%; - } - .col-sm-pull-5 { - right: 41.66666667%; - } - .col-sm-pull-4 { - right: 33.33333333%; - } - .col-sm-pull-3 { - right: 25%; - } - .col-sm-pull-2 { - right: 16.66666667%; - } - .col-sm-pull-1 { - right: 8.33333333%; - } - .col-sm-pull-0 { - right: auto; - } - .col-sm-push-12 { - left: 100%; - } - .col-sm-push-11 { - left: 91.66666667%; - } - .col-sm-push-10 { - left: 83.33333333%; - } - .col-sm-push-9 { - left: 75%; - } - .col-sm-push-8 { - left: 66.66666667%; - } - .col-sm-push-7 { - left: 58.33333333%; - } - .col-sm-push-6 { - left: 50%; - } - .col-sm-push-5 { - left: 41.66666667%; - } - .col-sm-push-4 { - left: 33.33333333%; - } - .col-sm-push-3 { - left: 25%; - } - .col-sm-push-2 { - left: 16.66666667%; - } - .col-sm-push-1 { - left: 8.33333333%; - } - .col-sm-push-0 { - left: auto; - } - .col-sm-offset-12 { - margin-left: 100%; - } - .col-sm-offset-11 { - margin-left: 91.66666667%; - } - .col-sm-offset-10 { - margin-left: 83.33333333%; - } - .col-sm-offset-9 { - margin-left: 75%; - } - .col-sm-offset-8 { - margin-left: 66.66666667%; - } - .col-sm-offset-7 { - margin-left: 58.33333333%; - } - .col-sm-offset-6 { - margin-left: 50%; - } - .col-sm-offset-5 { - margin-left: 41.66666667%; - } - .col-sm-offset-4 { - margin-left: 33.33333333%; - } - .col-sm-offset-3 { - margin-left: 25%; - } - .col-sm-offset-2 { - margin-left: 16.66666667%; - } - .col-sm-offset-1 { - margin-left: 8.33333333%; - } - .col-sm-offset-0 { - margin-left: 0; - } -} -@media (min-width: 992px) { - .col-md-1, .col-md-2, .col-md-3, .col-md-4, .col-md-5, .col-md-6, .col-md-7, .col-md-8, .col-md-9, .col-md-10, .col-md-11, .col-md-12 { - float: left; - } - .col-md-12 { - width: 100%; - } - .col-md-11 { - width: 91.66666667%; - } - .col-md-10 { - width: 83.33333333%; - } - .col-md-9 { - width: 75%; - } - .col-md-8 { - width: 66.66666667%; - } - .col-md-7 { - width: 58.33333333%; - } - .col-md-6 { - width: 50%; - } - .col-md-5 { - width: 41.66666667%; - } - .col-md-4 { - width: 33.33333333%; - } - .col-md-3 { - width: 25%; - } - .col-md-2 { - width: 16.66666667%; - } - .col-md-1 { - width: 8.33333333%; - } - .col-md-pull-12 { - right: 100%; - } - .col-md-pull-11 { - right: 91.66666667%; - } - .col-md-pull-10 { - right: 83.33333333%; - } - .col-md-pull-9 { - right: 75%; - } - .col-md-pull-8 { - right: 66.66666667%; - } - .col-md-pull-7 { - right: 58.33333333%; - } - .col-md-pull-6 { - right: 50%; - } - .col-md-pull-5 { - right: 41.66666667%; - } - .col-md-pull-4 { - right: 33.33333333%; - } - .col-md-pull-3 { - right: 25%; - } - .col-md-pull-2 { - right: 16.66666667%; - } - .col-md-pull-1 { - right: 8.33333333%; - } - .col-md-pull-0 { - right: auto; - } - .col-md-push-12 { - left: 100%; - } - .col-md-push-11 { - left: 91.66666667%; - } - .col-md-push-10 { - left: 83.33333333%; - } - .col-md-push-9 { - left: 75%; - } - .col-md-push-8 { - left: 66.66666667%; - } - .col-md-push-7 { - left: 58.33333333%; - } - .col-md-push-6 { - left: 50%; - } - .col-md-push-5 { - left: 41.66666667%; - } - .col-md-push-4 { - left: 33.33333333%; - } - .col-md-push-3 { - left: 25%; - } - .col-md-push-2 { - left: 16.66666667%; - } - .col-md-push-1 { - left: 8.33333333%; - } - .col-md-push-0 { - left: auto; - } - .col-md-offset-12 { - margin-left: 100%; - } - .col-md-offset-11 { - margin-left: 91.66666667%; - } - .col-md-offset-10 { - margin-left: 83.33333333%; - } - .col-md-offset-9 { - margin-left: 75%; - } - .col-md-offset-8 { - margin-left: 66.66666667%; - } - .col-md-offset-7 { - margin-left: 58.33333333%; - } - .col-md-offset-6 { - margin-left: 50%; - } - .col-md-offset-5 { - margin-left: 41.66666667%; - } - .col-md-offset-4 { - margin-left: 33.33333333%; - } - .col-md-offset-3 { - margin-left: 25%; - } - .col-md-offset-2 { - margin-left: 16.66666667%; - } - .col-md-offset-1 { - margin-left: 8.33333333%; - } - .col-md-offset-0 { - margin-left: 0; - } -} -@media (min-width: 1800px) { - .col-lg-1, .col-lg-2, .col-lg-3, .col-lg-4, .col-lg-5, .col-lg-6, .col-lg-7, .col-lg-8, .col-lg-9, .col-lg-10, .col-lg-11, .col-lg-12 { - float: left; - } - .col-lg-12 { - width: 100%; - } - .col-lg-11 { - width: 91.66666667%; - } - .col-lg-10 { - width: 83.33333333%; - } - .col-lg-9 { - width: 75%; - } - .col-lg-8 { - width: 66.66666667%; - } - .col-lg-7 { - width: 58.33333333%; - } - .col-lg-6 { - width: 50%; - } - .col-lg-5 { - width: 41.66666667%; - } - .col-lg-4 { - width: 33.33333333%; - } - .col-lg-3 { - width: 25%; - } - .col-lg-2 { - width: 16.66666667%; - } - .col-lg-1 { - width: 8.33333333%; - } - .col-lg-pull-12 { - right: 100%; - } - .col-lg-pull-11 { - right: 91.66666667%; - } - .col-lg-pull-10 { - right: 83.33333333%; - } - .col-lg-pull-9 { - right: 75%; - } - .col-lg-pull-8 { - right: 66.66666667%; - } - .col-lg-pull-7 { - right: 58.33333333%; - } - .col-lg-pull-6 { - right: 50%; - } - .col-lg-pull-5 { - right: 41.66666667%; - } - .col-lg-pull-4 { - right: 33.33333333%; - } - .col-lg-pull-3 { - right: 25%; - } - .col-lg-pull-2 { - right: 16.66666667%; - } - .col-lg-pull-1 { - right: 8.33333333%; - } - .col-lg-pull-0 { - right: auto; - } - .col-lg-push-12 { - left: 100%; - } - .col-lg-push-11 { - left: 91.66666667%; - } - .col-lg-push-10 { - left: 83.33333333%; - } - .col-lg-push-9 { - left: 75%; - } - .col-lg-push-8 { - left: 66.66666667%; - } - .col-lg-push-7 { - left: 58.33333333%; - } - .col-lg-push-6 { - left: 50%; - } - .col-lg-push-5 { - left: 41.66666667%; - } - .col-lg-push-4 { - left: 33.33333333%; - } - .col-lg-push-3 { - left: 25%; - } - .col-lg-push-2 { - left: 16.66666667%; - } - .col-lg-push-1 { - left: 8.33333333%; - } - .col-lg-push-0 { - left: auto; - } - .col-lg-offset-12 { - margin-left: 100%; - } - .col-lg-offset-11 { - margin-left: 91.66666667%; - } - .col-lg-offset-10 { - margin-left: 83.33333333%; - } - .col-lg-offset-9 { - margin-left: 75%; - } - .col-lg-offset-8 { - margin-left: 66.66666667%; - } - .col-lg-offset-7 { - margin-left: 58.33333333%; - } - .col-lg-offset-6 { - margin-left: 50%; - } - .col-lg-offset-5 { - margin-left: 41.66666667%; - } - .col-lg-offset-4 { - margin-left: 33.33333333%; - } - .col-lg-offset-3 { - margin-left: 25%; - } - .col-lg-offset-2 { - margin-left: 16.66666667%; - } - .col-lg-offset-1 { - margin-left: 8.33333333%; - } - .col-lg-offset-0 { - margin-left: 0; - } -} -table { - background-color: transparent; -} -caption { - padding-top: 8px; - padding-bottom: 8px; - color: #777; - text-align: left; -} -th { - text-align: left; -} -.table { - width: 100%; - max-width: 100%; - margin-bottom: 20px; -} -.table > thead > tr > th, -.table > tbody > tr > th, -.table > tfoot > tr > th, -.table > thead > tr > td, -.table > tbody > tr > td, -.table > tfoot > tr > td { - padding: 8px; - line-height: 1.42857143; - vertical-align: top; - border-top: 1px solid #ddd; -} -.table > thead > tr > th { - vertical-align: bottom; - border-bottom: 2px solid #ddd; -} -.table > caption + thead > tr:first-child > th, -.table > colgroup + thead > tr:first-child > th, -.table > thead:first-child > tr:first-child > th, -.table > caption + thead > tr:first-child > td, -.table > colgroup + thead > tr:first-child > td, -.table > thead:first-child > tr:first-child > td { - border-top: 0; -} -.table > tbody + tbody { - border-top: 2px solid #ddd; -} -.table .table { - background-color: #fff; -} -.table-condensed > thead > tr > th, -.table-condensed > tbody > tr > th, -.table-condensed > tfoot > tr > th, -.table-condensed > thead > tr > td, -.table-condensed > tbody > tr > td, -.table-condensed > tfoot > tr > td { - padding: 5px; -} -.table-bordered { - border: 1px solid #ddd; -} -.table-bordered > thead > tr > th, -.table-bordered > tbody > tr > th, -.table-bordered > tfoot > tr > th, -.table-bordered > thead > tr > td, -.table-bordered > tbody > tr > td, -.table-bordered > tfoot > tr > td { - border: 1px solid #ddd; -} -.table-bordered > thead > tr > th, -.table-bordered > thead > tr > td { - border-bottom-width: 2px; -} -.table-striped > tbody > tr:nth-of-type(odd) { - background-color: #f9f9f9; -} -.table-hover > tbody > tr:hover { - background-color: #f5f5f5; -} -table col[class*="col-"] { - position: static; - display: table-column; - float: none; -} -table td[class*="col-"], -table th[class*="col-"] { - position: static; - display: table-cell; - float: none; -} -.table > thead > tr > td.active, -.table > tbody > tr > td.active, -.table > tfoot > tr > td.active, -.table > thead > tr > th.active, -.table > tbody > tr > th.active, -.table > tfoot > tr > th.active, -.table > thead > tr.active > td, -.table > tbody > tr.active > td, -.table > tfoot > tr.active > td, -.table > thead > tr.active > th, -.table > tbody > tr.active > th, -.table > tfoot > tr.active > th { - background-color: #f5f5f5; -} -.table-hover > tbody > tr > td.active:hover, -.table-hover > tbody > tr > th.active:hover, -.table-hover > tbody > tr.active:hover > td, -.table-hover > tbody > tr:hover > .active, -.table-hover > tbody > tr.active:hover > th { - background-color: #e8e8e8; -} -.table > thead > tr > td.success, -.table > tbody > tr > td.success, -.table > tfoot > tr > td.success, -.table > thead > tr > th.success, -.table > tbody > tr > th.success, -.table > tfoot > tr > th.success, -.table > thead > tr.success > td, -.table > tbody > tr.success > td, -.table > tfoot > tr.success > td, -.table > thead > tr.success > th, -.table > tbody > tr.success > th, -.table > tfoot > tr.success > th { - background-color: #dff0d8; -} -.table-hover > tbody > tr > td.success:hover, -.table-hover > tbody > tr > th.success:hover, -.table-hover > tbody > tr.success:hover > td, -.table-hover > tbody > tr:hover > .success, -.table-hover > tbody > tr.success:hover > th { - background-color: #d0e9c6; -} -.table > thead > tr > td.info, -.table > tbody > tr > td.info, -.table > tfoot > tr > td.info, -.table > thead > tr > th.info, -.table > tbody > tr > th.info, -.table > tfoot > tr > th.info, -.table > thead > tr.info > td, -.table > tbody > tr.info > td, -.table > tfoot > tr.info > td, -.table > thead > tr.info > th, -.table > tbody > tr.info > th, -.table > tfoot > tr.info > th { - background-color: #d9edf7; -} -.table-hover > tbody > tr > td.info:hover, -.table-hover > tbody > tr > th.info:hover, -.table-hover > tbody > tr.info:hover > td, -.table-hover > tbody > tr:hover > .info, -.table-hover > tbody > tr.info:hover > th { - background-color: #c4e3f3; -} -.table > thead > tr > td.warning, -.table > tbody > tr > td.warning, -.table > tfoot > tr > td.warning, -.table > thead > tr > th.warning, -.table > tbody > tr > th.warning, -.table > tfoot > tr > th.warning, -.table > thead > tr.warning > td, -.table > tbody > tr.warning > td, -.table > tfoot > tr.warning > td, -.table > thead > tr.warning > th, -.table > tbody > tr.warning > th, -.table > tfoot > tr.warning > th { - background-color: #fcf8e3; -} -.table-hover > tbody > tr > td.warning:hover, -.table-hover > tbody > tr > th.warning:hover, -.table-hover > tbody > tr.warning:hover > td, -.table-hover > tbody > tr:hover > .warning, -.table-hover > tbody > tr.warning:hover > th { - background-color: #faf2cc; -} -.table > thead > tr > td.danger, -.table > tbody > tr > td.danger, -.table > tfoot > tr > td.danger, -.table > thead > tr > th.danger, -.table > tbody > tr > th.danger, -.table > tfoot > tr > th.danger, -.table > thead > tr.danger > td, -.table > tbody > tr.danger > td, -.table > tfoot > tr.danger > td, -.table > thead > tr.danger > th, -.table > tbody > tr.danger > th, -.table > tfoot > tr.danger > th { - background-color: #f2dede; -} -.table-hover > tbody > tr > td.danger:hover, -.table-hover > tbody > tr > th.danger:hover, -.table-hover > tbody > tr.danger:hover > td, -.table-hover > tbody > tr:hover > .danger, -.table-hover > tbody > tr.danger:hover > th { - background-color: #ebcccc; -} -.table-responsive { - min-height: .01%; - overflow-x: auto; -} -@media screen and (max-width: 767px) { - .table-responsive { - width: 100%; - margin-bottom: 15px; - overflow-y: hidden; - -ms-overflow-style: -ms-autohiding-scrollbar; - border: 1px solid #ddd; - } - .table-responsive > .table { - margin-bottom: 0; - } - .table-responsive > .table > thead > tr > th, - .table-responsive > .table > tbody > tr > th, - .table-responsive > .table > tfoot > tr > th, - .table-responsive > .table > thead > tr > td, - .table-responsive > .table > tbody > tr > td, - .table-responsive > .table > tfoot > tr > td { - white-space: nowrap; - } - .table-responsive > .table-bordered { - border: 0; - } - .table-responsive > .table-bordered > thead > tr > th:first-child, - .table-responsive > .table-bordered > tbody > tr > th:first-child, - .table-responsive > .table-bordered > tfoot > tr > th:first-child, - .table-responsive > .table-bordered > thead > tr > td:first-child, - .table-responsive > .table-bordered > tbody > tr > td:first-child, - .table-responsive > .table-bordered > tfoot > tr > td:first-child { - border-left: 0; - } - .table-responsive > .table-bordered > thead > tr > th:last-child, - .table-responsive > .table-bordered > tbody > tr > th:last-child, - .table-responsive > .table-bordered > tfoot > tr > th:last-child, - .table-responsive > .table-bordered > thead > tr > td:last-child, - .table-responsive > .table-bordered > tbody > tr > td:last-child, - .table-responsive > .table-bordered > tfoot > tr > td:last-child { - border-right: 0; - } - .table-responsive > .table-bordered > tbody > tr:last-child > th, - .table-responsive > .table-bordered > tfoot > tr:last-child > th, - .table-responsive > .table-bordered > tbody > tr:last-child > td, - .table-responsive > .table-bordered > tfoot > tr:last-child > td { - border-bottom: 0; - } -} -fieldset { - min-width: 0; - padding: 0; - margin: 0; - border: 0; -} -legend { - display: block; - width: 100%; - padding: 0; - margin-bottom: 20px; - font-size: 21px; - line-height: inherit; - color: #333; - border: 0; - border-bottom: 1px solid #e5e5e5; -} -label { - display: inline-block; - max-width: 100%; - margin-bottom: 5px; - font-weight: bold; -} -input[type="search"] { - -webkit-box-sizing: border-box; - -moz-box-sizing: border-box; - box-sizing: border-box; -} -input[type="radio"], -input[type="checkbox"] { - margin: 4px 0 0; - margin-top: 1px \9; - line-height: normal; -} -input[type="file"] { - display: block; -} -input[type="range"] { - display: block; - width: 100%; -} -select[multiple], -select[size] { - height: auto; -} -input[type="file"]:focus, -input[type="radio"]:focus, -input[type="checkbox"]:focus { - outline: thin dotted; - outline: 5px auto -webkit-focus-ring-color; - outline-offset: -2px; -} -output { - display: block; - padding-top: 7px; - font-size: 14px; - line-height: 1.42857143; - color: #555; -} -.form-control { - display: block; - width: 100%; - height: 34px; - padding: 6px 12px; - font-size: 14px; - line-height: 1.42857143; - color: #555; - background-color: #fff; - background-image: none; - border: 1px solid #ccc; - border-radius: 4px; - -webkit-box-shadow: inset 0 1px 1px rgba(0, 0, 0, .075); - box-shadow: inset 0 1px 1px rgba(0, 0, 0, .075); - -webkit-transition: border-color ease-in-out .15s, -webkit-box-shadow ease-in-out .15s; - -o-transition: border-color ease-in-out .15s, box-shadow ease-in-out .15s; - transition: border-color ease-in-out .15s, box-shadow ease-in-out .15s; -} -.form-control:focus { - border-color: #66afe9; - outline: 0; - -webkit-box-shadow: inset 0 1px 1px rgba(0,0,0,.075), 0 0 8px rgba(102, 175, 233, .6); - box-shadow: inset 0 1px 1px rgba(0,0,0,.075), 0 0 8px rgba(102, 175, 233, .6); -} -.form-control::-moz-placeholder { - color: #999; - opacity: 1; -} -.form-control:-ms-input-placeholder { - color: #999; -} -.form-control::-webkit-input-placeholder { - color: #999; -} -.form-control[disabled], -.form-control[readonly], -fieldset[disabled] .form-control { - background-color: #eee; - opacity: 1; -} -.form-control[disabled], -fieldset[disabled] .form-control { - cursor: not-allowed; -} -textarea.form-control { - height: auto; -} -input[type="search"] { - -webkit-appearance: none; -} -@media screen and (-webkit-min-device-pixel-ratio: 0) { - input[type="date"].form-control, - input[type="time"].form-control, - input[type="datetime-local"].form-control, - input[type="month"].form-control { - line-height: 34px; - } - input[type="date"].input-sm, - input[type="time"].input-sm, - input[type="datetime-local"].input-sm, - input[type="month"].input-sm, - .input-group-sm input[type="date"], - .input-group-sm input[type="time"], - .input-group-sm input[type="datetime-local"], - .input-group-sm input[type="month"] { - line-height: 30px; - } - input[type="date"].input-lg, - input[type="time"].input-lg, - input[type="datetime-local"].input-lg, - input[type="month"].input-lg, - .input-group-lg input[type="date"], - .input-group-lg input[type="time"], - .input-group-lg input[type="datetime-local"], - .input-group-lg input[type="month"] { - line-height: 46px; - } -} -.form-group { - margin-bottom: 15px; -} -.radio, -.checkbox { - position: relative; - display: block; - margin-top: 10px; - margin-bottom: 10px; -} -.radio label, -.checkbox label { - min-height: 20px; - padding-left: 20px; - margin-bottom: 0; - font-weight: normal; - cursor: pointer; -} -.radio input[type="radio"], -.radio-inline input[type="radio"], -.checkbox input[type="checkbox"], -.checkbox-inline input[type="checkbox"] { - position: absolute; - margin-top: 4px \9; - margin-left: -20px; -} -.radio + .radio, -.checkbox + .checkbox { - margin-top: -5px; -} -.radio-inline, -.checkbox-inline { - position: relative; - display: inline-block; - padding-left: 20px; - margin-bottom: 0; - font-weight: normal; - vertical-align: middle; - cursor: pointer; -} -.radio-inline + .radio-inline, -.checkbox-inline + .checkbox-inline { - margin-top: 0; - margin-left: 10px; -} -input[type="radio"][disabled], -input[type="checkbox"][disabled], -input[type="radio"].disabled, -input[type="checkbox"].disabled, -fieldset[disabled] input[type="radio"], -fieldset[disabled] input[type="checkbox"] { - cursor: not-allowed; -} -.radio-inline.disabled, -.checkbox-inline.disabled, -fieldset[disabled] .radio-inline, -fieldset[disabled] .checkbox-inline { - cursor: not-allowed; -} -.radio.disabled label, -.checkbox.disabled label, -fieldset[disabled] .radio label, -fieldset[disabled] .checkbox label { - cursor: not-allowed; -} -.form-control-static { - min-height: 34px; - padding-top: 7px; - padding-bottom: 7px; - margin-bottom: 0; -} -.form-control-static.input-lg, -.form-control-static.input-sm { - padding-right: 0; - padding-left: 0; -} -.input-sm { - height: 30px; - padding: 5px 10px; - font-size: 12px; - line-height: 1.5; - border-radius: 3px; -} -select.input-sm { - height: 30px; - line-height: 30px; -} -textarea.input-sm, -select[multiple].input-sm { - height: auto; -} -.form-group-sm .form-control { - height: 30px; - padding: 5px 10px; - font-size: 12px; - line-height: 1.5; - border-radius: 3px; -} -.form-group-sm select.form-control { - height: 30px; - line-height: 30px; -} -.form-group-sm textarea.form-control, -.form-group-sm select[multiple].form-control { - height: auto; -} -.form-group-sm .form-control-static { - height: 30px; - min-height: 32px; - padding: 6px 10px; - font-size: 12px; - line-height: 1.5; -} -.input-lg { - height: 46px; - padding: 10px 16px; - font-size: 18px; - line-height: 1.3333333; - border-radius: 6px; -} -select.input-lg { - height: 46px; - line-height: 46px; -} -textarea.input-lg, -select[multiple].input-lg { - height: auto; -} -.form-group-lg .form-control { - height: 46px; - padding: 10px 16px; - font-size: 18px; - line-height: 1.3333333; - border-radius: 6px; -} -.form-group-lg select.form-control { - height: 46px; - line-height: 46px; -} -.form-group-lg textarea.form-control, -.form-group-lg select[multiple].form-control { - height: auto; -} -.form-group-lg .form-control-static { - height: 46px; - min-height: 38px; - padding: 11px 16px; - font-size: 18px; - line-height: 1.3333333; -} -.has-feedback { - position: relative; -} -.has-feedback .form-control { - padding-right: 42.5px; -} -.form-control-feedback { - position: absolute; - top: 0; - right: 0; - z-index: 2; - display: block; - width: 34px; - height: 34px; - line-height: 34px; - text-align: center; - pointer-events: none; -} -.input-lg + .form-control-feedback, -.input-group-lg + .form-control-feedback, -.form-group-lg .form-control + .form-control-feedback { - width: 46px; - height: 46px; - line-height: 46px; -} -.input-sm + .form-control-feedback, -.input-group-sm + .form-control-feedback, -.form-group-sm .form-control + .form-control-feedback { - width: 30px; - height: 30px; - line-height: 30px; -} -.has-success .help-block, -.has-success .control-label, -.has-success .radio, -.has-success .checkbox, -.has-success .radio-inline, -.has-success .checkbox-inline, -.has-success.radio label, -.has-success.checkbox label, -.has-success.radio-inline label, -.has-success.checkbox-inline label { - color: #3c763d; -} -.has-success .form-control { - border-color: #3c763d; - -webkit-box-shadow: inset 0 1px 1px rgba(0, 0, 0, .075); - box-shadow: inset 0 1px 1px rgba(0, 0, 0, .075); -} -.has-success .form-control:focus { - border-color: #2b542c; - -webkit-box-shadow: inset 0 1px 1px rgba(0, 0, 0, .075), 0 0 6px #67b168; - box-shadow: inset 0 1px 1px rgba(0, 0, 0, .075), 0 0 6px #67b168; -} -.has-success .input-group-addon { - color: #3c763d; - background-color: #dff0d8; - border-color: #3c763d; -} -.has-success .form-control-feedback { - color: #3c763d; -} -.has-warning .help-block, -.has-warning .control-label, -.has-warning .radio, -.has-warning .checkbox, -.has-warning .radio-inline, -.has-warning .checkbox-inline, -.has-warning.radio label, -.has-warning.checkbox label, -.has-warning.radio-inline label, -.has-warning.checkbox-inline label { - color: #8a6d3b; -} -.has-warning .form-control { - border-color: #8a6d3b; - -webkit-box-shadow: inset 0 1px 1px rgba(0, 0, 0, .075); - box-shadow: inset 0 1px 1px rgba(0, 0, 0, .075); -} -.has-warning .form-control:focus { - border-color: #66512c; - -webkit-box-shadow: inset 0 1px 1px rgba(0, 0, 0, .075), 0 0 6px #c0a16b; - box-shadow: inset 0 1px 1px rgba(0, 0, 0, .075), 0 0 6px #c0a16b; -} -.has-warning .input-group-addon { - color: #8a6d3b; - background-color: #fcf8e3; - border-color: #8a6d3b; -} -.has-warning .form-control-feedback { - color: #8a6d3b; -} -.has-error .help-block, -.has-error .control-label, -.has-error .radio, -.has-error .checkbox, -.has-error .radio-inline, -.has-error .checkbox-inline, -.has-error.radio label, -.has-error.checkbox label, -.has-error.radio-inline label, -.has-error.checkbox-inline label { - color: #a94442; -} -.has-error .form-control { - border-color: #a94442; - -webkit-box-shadow: inset 0 1px 1px rgba(0, 0, 0, .075); - box-shadow: inset 0 1px 1px rgba(0, 0, 0, .075); -} -.has-error .form-control:focus { - border-color: #843534; - -webkit-box-shadow: inset 0 1px 1px rgba(0, 0, 0, .075), 0 0 6px #ce8483; - box-shadow: inset 0 1px 1px rgba(0, 0, 0, .075), 0 0 6px #ce8483; -} -.has-error .input-group-addon { - color: #a94442; - background-color: #f2dede; - border-color: #a94442; -} -.has-error .form-control-feedback { - color: #a94442; -} -.has-feedback label ~ .form-control-feedback { - top: 25px; -} -.has-feedback label.sr-only ~ .form-control-feedback { - top: 0; -} -.help-block { - display: block; - margin-top: 5px; - margin-bottom: 10px; - color: #737373; -} -@media (min-width: 768px) { - .form-inline .form-group { - display: inline-block; - margin-bottom: 0; - vertical-align: middle; - } - .form-inline .form-control { - display: inline-block; - width: auto; - vertical-align: middle; - } - .form-inline .form-control-static { - display: inline-block; - } - .form-inline .input-group { - display: inline-table; - vertical-align: middle; - } - .form-inline .input-group .input-group-addon, - .form-inline .input-group .input-group-btn, - .form-inline .input-group .form-control { - width: auto; - } - .form-inline .input-group > .form-control { - width: 100%; - } - .form-inline .control-label { - margin-bottom: 0; - vertical-align: middle; - } - .form-inline .radio, - .form-inline .checkbox { - display: inline-block; - margin-top: 0; - margin-bottom: 0; - vertical-align: middle; - } - .form-inline .radio label, - .form-inline .checkbox label { - padding-left: 0; - } - .form-inline .radio input[type="radio"], - .form-inline .checkbox input[type="checkbox"] { - position: relative; - margin-left: 0; - } - .form-inline .has-feedback .form-control-feedback { - top: 0; - } -} -.form-horizontal .radio, -.form-horizontal .checkbox, -.form-horizontal .radio-inline, -.form-horizontal .checkbox-inline { - padding-top: 7px; - margin-top: 0; - margin-bottom: 0; -} -.form-horizontal .radio, -.form-horizontal .checkbox { - min-height: 27px; -} -.form-horizontal .form-group { - margin-right: -15px; - margin-left: -15px; -} -@media (min-width: 768px) { - .form-horizontal .control-label { - padding-top: 7px; - margin-bottom: 0; - text-align: right; - } -} -.form-horizontal .has-feedback .form-control-feedback { - right: 15px; -} -@media (min-width: 768px) { - .form-horizontal .form-group-lg .control-label { - padding-top: 14.333333px; - font-size: 18px; - } -} -@media (min-width: 768px) { - .form-horizontal .form-group-sm .control-label { - padding-top: 6px; - font-size: 12px; - } -} -.btn { - display: inline-block; - padding: 6px 12px; - margin-bottom: 0; - font-size: 14px; - font-weight: normal; - line-height: 1.42857143; - text-align: center; - white-space: nowrap; - vertical-align: middle; - -ms-touch-action: manipulation; - touch-action: manipulation; - cursor: pointer; - -webkit-user-select: none; - -moz-user-select: none; - -ms-user-select: none; - user-select: none; - background-image: none; - border: 1px solid transparent; - border-radius: 4px; -} -.btn:focus, -.btn:active:focus, -.btn.active:focus, -.btn.focus, -.btn:active.focus, -.btn.active.focus { - outline: thin dotted; - outline: 5px auto -webkit-focus-ring-color; - outline-offset: -2px; -} -.btn:hover, -.btn:focus, -.btn.focus { - color: #333; - text-decoration: none; -} -.btn:active, -.btn.active { - background-image: none; - outline: 0; - -webkit-box-shadow: inset 0 3px 5px rgba(0, 0, 0, .125); - box-shadow: inset 0 3px 5px rgba(0, 0, 0, .125); -} -.btn.disabled, -.btn[disabled], -fieldset[disabled] .btn { - cursor: not-allowed; - filter: alpha(opacity=65); - -webkit-box-shadow: none; - box-shadow: none; - opacity: .65; -} -a.btn.disabled, -fieldset[disabled] a.btn { - pointer-events: none; -} -.btn-default { - color: #333; - background-color: #fff; - border-color: #ccc; -} -.btn-default:focus, -.btn-default.focus { - color: #333; - background-color: #e6e6e6; - border-color: #8c8c8c; -} -.btn-default:hover { - color: #333; - background-color: #e6e6e6; - border-color: #adadad; -} -.btn-default:active, -.btn-default.active, -.open > .dropdown-toggle.btn-default { - color: #333; - background-color: #e6e6e6; - border-color: #adadad; -} -.btn-default:active:hover, -.btn-default.active:hover, -.open > .dropdown-toggle.btn-default:hover, -.btn-default:active:focus, -.btn-default.active:focus, -.open > .dropdown-toggle.btn-default:focus, -.btn-default:active.focus, -.btn-default.active.focus, -.open > .dropdown-toggle.btn-default.focus { - color: #333; - background-color: #d4d4d4; - border-color: #8c8c8c; -} -.btn-default:active, -.btn-default.active, -.open > .dropdown-toggle.btn-default { - background-image: none; -} -.btn-default.disabled, -.btn-default[disabled], -fieldset[disabled] .btn-default, -.btn-default.disabled:hover, -.btn-default[disabled]:hover, -fieldset[disabled] .btn-default:hover, -.btn-default.disabled:focus, -.btn-default[disabled]:focus, -fieldset[disabled] .btn-default:focus, -.btn-default.disabled.focus, -.btn-default[disabled].focus, -fieldset[disabled] .btn-default.focus, -.btn-default.disabled:active, -.btn-default[disabled]:active, -fieldset[disabled] .btn-default:active, -.btn-default.disabled.active, -.btn-default[disabled].active, -fieldset[disabled] .btn-default.active { - background-color: #fff; - border-color: #ccc; -} -.btn-default .badge { - color: #fff; - background-color: #333; -} -.btn-primary { - color: #fff; - background-color: #337ab7; - border-color: #2e6da4; -} -.btn-primary:focus, -.btn-primary.focus { - color: #fff; - background-color: #286090; - border-color: #122b40; -} -.btn-primary:hover { - color: #fff; - background-color: #286090; - border-color: #204d74; -} -.btn-primary:active, -.btn-primary.active, -.open > .dropdown-toggle.btn-primary { - color: #fff; - background-color: #286090; - border-color: #204d74; -} -.btn-primary:active:hover, -.btn-primary.active:hover, -.open > .dropdown-toggle.btn-primary:hover, -.btn-primary:active:focus, -.btn-primary.active:focus, -.open > .dropdown-toggle.btn-primary:focus, -.btn-primary:active.focus, -.btn-primary.active.focus, -.open > .dropdown-toggle.btn-primary.focus { - color: #fff; - background-color: #204d74; - border-color: #122b40; -} -.btn-primary:active, -.btn-primary.active, -.open > .dropdown-toggle.btn-primary { - background-image: none; -} -.btn-primary.disabled, -.btn-primary[disabled], -fieldset[disabled] .btn-primary, -.btn-primary.disabled:hover, -.btn-primary[disabled]:hover, -fieldset[disabled] .btn-primary:hover, -.btn-primary.disabled:focus, -.btn-primary[disabled]:focus, -fieldset[disabled] .btn-primary:focus, -.btn-primary.disabled.focus, -.btn-primary[disabled].focus, -fieldset[disabled] .btn-primary.focus, -.btn-primary.disabled:active, -.btn-primary[disabled]:active, -fieldset[disabled] .btn-primary:active, -.btn-primary.disabled.active, -.btn-primary[disabled].active, -fieldset[disabled] .btn-primary.active { - background-color: #337ab7; - border-color: #2e6da4; -} -.btn-primary .badge { - color: #337ab7; - background-color: #fff; -} -.btn-success { - color: #fff; - background-color: #5cb85c; - border-color: #4cae4c; -} -.btn-success:focus, -.btn-success.focus { - color: #fff; - background-color: #449d44; - border-color: #255625; -} -.btn-success:hover { - color: #fff; - background-color: #449d44; - border-color: #398439; -} -.btn-success:active, -.btn-success.active, -.open > .dropdown-toggle.btn-success { - color: #fff; - background-color: #449d44; - border-color: #398439; -} -.btn-success:active:hover, -.btn-success.active:hover, -.open > .dropdown-toggle.btn-success:hover, -.btn-success:active:focus, -.btn-success.active:focus, -.open > .dropdown-toggle.btn-success:focus, -.btn-success:active.focus, -.btn-success.active.focus, -.open > .dropdown-toggle.btn-success.focus { - color: #fff; - background-color: #398439; - border-color: #255625; -} -.btn-success:active, -.btn-success.active, -.open > .dropdown-toggle.btn-success { - background-image: none; -} -.btn-success.disabled, -.btn-success[disabled], -fieldset[disabled] .btn-success, -.btn-success.disabled:hover, -.btn-success[disabled]:hover, -fieldset[disabled] .btn-success:hover, -.btn-success.disabled:focus, -.btn-success[disabled]:focus, -fieldset[disabled] .btn-success:focus, -.btn-success.disabled.focus, -.btn-success[disabled].focus, -fieldset[disabled] .btn-success.focus, -.btn-success.disabled:active, -.btn-success[disabled]:active, -fieldset[disabled] .btn-success:active, -.btn-success.disabled.active, -.btn-success[disabled].active, -fieldset[disabled] .btn-success.active { - background-color: #5cb85c; - border-color: #4cae4c; -} -.btn-success .badge { - color: #5cb85c; - background-color: #fff; -} -.btn-info { - color: #fff; - background-color: #5bc0de; - border-color: #46b8da; -} -.btn-info:focus, -.btn-info.focus { - color: #fff; - background-color: #31b0d5; - border-color: #1b6d85; -} -.btn-info:hover { - color: #fff; - background-color: #31b0d5; - border-color: #269abc; -} -.btn-info:active, -.btn-info.active, -.open > .dropdown-toggle.btn-info { - color: #fff; - background-color: #31b0d5; - border-color: #269abc; -} -.btn-info:active:hover, -.btn-info.active:hover, -.open > .dropdown-toggle.btn-info:hover, -.btn-info:active:focus, -.btn-info.active:focus, -.open > .dropdown-toggle.btn-info:focus, -.btn-info:active.focus, -.btn-info.active.focus, -.open > .dropdown-toggle.btn-info.focus { - color: #fff; - background-color: #269abc; - border-color: #1b6d85; -} -.btn-info:active, -.btn-info.active, -.open > .dropdown-toggle.btn-info { - background-image: none; -} -.btn-info.disabled, -.btn-info[disabled], -fieldset[disabled] .btn-info, -.btn-info.disabled:hover, -.btn-info[disabled]:hover, -fieldset[disabled] .btn-info:hover, -.btn-info.disabled:focus, -.btn-info[disabled]:focus, -fieldset[disabled] .btn-info:focus, -.btn-info.disabled.focus, -.btn-info[disabled].focus, -fieldset[disabled] .btn-info.focus, -.btn-info.disabled:active, -.btn-info[disabled]:active, -fieldset[disabled] .btn-info:active, -.btn-info.disabled.active, -.btn-info[disabled].active, -fieldset[disabled] .btn-info.active { - background-color: #5bc0de; - border-color: #46b8da; -} -.btn-info .badge { - color: #5bc0de; - background-color: #fff; -} -.btn-warning { - color: #fff; - background-color: #f0ad4e; - border-color: #eea236; -} -.btn-warning:focus, -.btn-warning.focus { - color: #fff; - background-color: #ec971f; - border-color: #985f0d; -} -.btn-warning:hover { - color: #fff; - background-color: #ec971f; - border-color: #d58512; -} -.btn-warning:active, -.btn-warning.active, -.open > .dropdown-toggle.btn-warning { - color: #fff; - background-color: #ec971f; - border-color: #d58512; -} -.btn-warning:active:hover, -.btn-warning.active:hover, -.open > .dropdown-toggle.btn-warning:hover, -.btn-warning:active:focus, -.btn-warning.active:focus, -.open > .dropdown-toggle.btn-warning:focus, -.btn-warning:active.focus, -.btn-warning.active.focus, -.open > .dropdown-toggle.btn-warning.focus { - color: #fff; - background-color: #d58512; - border-color: #985f0d; -} -.btn-warning:active, -.btn-warning.active, -.open > .dropdown-toggle.btn-warning { - background-image: none; -} -.btn-warning.disabled, -.btn-warning[disabled], -fieldset[disabled] .btn-warning, -.btn-warning.disabled:hover, -.btn-warning[disabled]:hover, -fieldset[disabled] .btn-warning:hover, -.btn-warning.disabled:focus, -.btn-warning[disabled]:focus, -fieldset[disabled] .btn-warning:focus, -.btn-warning.disabled.focus, -.btn-warning[disabled].focus, -fieldset[disabled] .btn-warning.focus, -.btn-warning.disabled:active, -.btn-warning[disabled]:active, -fieldset[disabled] .btn-warning:active, -.btn-warning.disabled.active, -.btn-warning[disabled].active, -fieldset[disabled] .btn-warning.active { - background-color: #f0ad4e; - border-color: #eea236; -} -.btn-warning .badge { - color: #f0ad4e; - background-color: #fff; -} -.btn-danger { - color: #fff; - background-color: #d9534f; - border-color: #d43f3a; -} -.btn-danger:focus, -.btn-danger.focus { - color: #fff; - background-color: #c9302c; - border-color: #761c19; -} -.btn-danger:hover { - color: #fff; - background-color: #c9302c; - border-color: #ac2925; -} -.btn-danger:active, -.btn-danger.active, -.open > .dropdown-toggle.btn-danger { - color: #fff; - background-color: #c9302c; - border-color: #ac2925; -} -.btn-danger:active:hover, -.btn-danger.active:hover, -.open > .dropdown-toggle.btn-danger:hover, -.btn-danger:active:focus, -.btn-danger.active:focus, -.open > .dropdown-toggle.btn-danger:focus, -.btn-danger:active.focus, -.btn-danger.active.focus, -.open > .dropdown-toggle.btn-danger.focus { - color: #fff; - background-color: #ac2925; - border-color: #761c19; -} -.btn-danger:active, -.btn-danger.active, -.open > .dropdown-toggle.btn-danger { - background-image: none; -} -.btn-danger.disabled, -.btn-danger[disabled], -fieldset[disabled] .btn-danger, -.btn-danger.disabled:hover, -.btn-danger[disabled]:hover, -fieldset[disabled] .btn-danger:hover, -.btn-danger.disabled:focus, -.btn-danger[disabled]:focus, -fieldset[disabled] .btn-danger:focus, -.btn-danger.disabled.focus, -.btn-danger[disabled].focus, -fieldset[disabled] .btn-danger.focus, -.btn-danger.disabled:active, -.btn-danger[disabled]:active, -fieldset[disabled] .btn-danger:active, -.btn-danger.disabled.active, -.btn-danger[disabled].active, -fieldset[disabled] .btn-danger.active { - background-color: #d9534f; - border-color: #d43f3a; -} -.btn-danger .badge { - color: #d9534f; - background-color: #fff; -} -.btn-link { - font-weight: normal; - color: #337ab7; - border-radius: 0; -} -.btn-link, -.btn-link:active, -.btn-link.active, -.btn-link[disabled], -fieldset[disabled] .btn-link { - background-color: transparent; - -webkit-box-shadow: none; - box-shadow: none; -} -.btn-link, -.btn-link:hover, -.btn-link:focus, -.btn-link:active { - border-color: transparent; -} -.btn-link:hover, -.btn-link:focus { - color: #23527c; - text-decoration: underline; - background-color: transparent; -} -.btn-link[disabled]:hover, -fieldset[disabled] .btn-link:hover, -.btn-link[disabled]:focus, -fieldset[disabled] .btn-link:focus { - color: #777; - text-decoration: none; -} -.btn-lg, -.btn-group-lg > .btn { - padding: 10px 16px; - font-size: 18px; - line-height: 1.3333333; - border-radius: 6px; -} -.btn-sm, -.btn-group-sm > .btn { - padding: 5px 10px; - font-size: 12px; - line-height: 1.5; - border-radius: 3px; -} -.btn-xs, -.btn-group-xs > .btn { - padding: 1px 5px; - font-size: 12px; - line-height: 1.5; - border-radius: 3px; -} -.btn-block { - display: block; - width: 100%; -} -.btn-block + .btn-block { - margin-top: 5px; -} -input[type="submit"].btn-block, -input[type="reset"].btn-block, -input[type="button"].btn-block { - width: 100%; -} -.fade { - opacity: 0; - -webkit-transition: opacity .15s linear; - -o-transition: opacity .15s linear; - transition: opacity .15s linear; -} -.fade.in { - opacity: 1; -} -.collapse { - display: none; -} -.collapse.in { - display: block; -} -tr.collapse.in { - display: table-row; -} -tbody.collapse.in { - display: table-row-group; -} -.collapsing { - position: relative; - height: 0; - overflow: hidden; - -webkit-transition-timing-function: ease; - -o-transition-timing-function: ease; - transition-timing-function: ease; - -webkit-transition-duration: .35s; - -o-transition-duration: .35s; - transition-duration: .35s; - -webkit-transition-property: height, visibility; - -o-transition-property: height, visibility; - transition-property: height, visibility; -} -.caret { - display: inline-block; - width: 0; - height: 0; - margin-left: 2px; - vertical-align: middle; - border-top: 4px dashed; - border-top: 4px solid \9; - border-right: 4px solid transparent; - border-left: 4px solid transparent; -} -.dropup, -.dropdown { - position: relative; -} -.dropdown-toggle:focus { - outline: 0; -} -.dropdown-menu { - position: absolute; - top: 100%; - left: 0; - z-index: 1000; - display: none; - float: left; - min-width: 160px; - padding: 5px 0; - margin: 2px 0 0; - font-size: 14px; - text-align: left; - list-style: none; - background-color: #fff; - -webkit-background-clip: padding-box; - background-clip: padding-box; - border: 1px solid #ccc; - border: 1px solid rgba(0, 0, 0, .15); - border-radius: 4px; - -webkit-box-shadow: 0 6px 12px rgba(0, 0, 0, .175); - box-shadow: 0 6px 12px rgba(0, 0, 0, .175); -} -.dropdown-menu.pull-right { - right: 0; - left: auto; -} -.dropdown-menu .divider { - height: 1px; - margin: 9px 0; - overflow: hidden; - background-color: #e5e5e5; -} -.dropdown-menu > li > a { - display: block; - padding: 3px 20px; - clear: both; - font-weight: normal; - line-height: 1.42857143; - color: #333; - white-space: nowrap; -} -.dropdown-menu > li > a:hover, -.dropdown-menu > li > a:focus { - color: #262626; - text-decoration: none; - background-color: #f5f5f5; -} -.dropdown-menu > .active > a, -.dropdown-menu > .active > a:hover, -.dropdown-menu > .active > a:focus { - color: #fff; - text-decoration: none; - background-color: #337ab7; - outline: 0; -} -.dropdown-menu > .disabled > a, -.dropdown-menu > .disabled > a:hover, -.dropdown-menu > .disabled > a:focus { - color: #777; -} -.dropdown-menu > .disabled > a:hover, -.dropdown-menu > .disabled > a:focus { - text-decoration: none; - cursor: not-allowed; - background-color: transparent; - background-image: none; - filter: progid:DXImageTransform.Microsoft.gradient(enabled = false); -} -.open > .dropdown-menu { - display: block; -} -.open > a { - outline: 0; -} -.dropdown-menu-right { - right: 0; - left: auto; -} -.dropdown-menu-left { - right: auto; - left: 0; -} -.dropdown-header { - display: block; - padding: 3px 20px; - font-size: 12px; - line-height: 1.42857143; - color: #777; - white-space: nowrap; -} -.dropdown-backdrop { - position: fixed; - top: 0; - right: 0; - bottom: 0; - left: 0; - z-index: 990; -} -.pull-right > .dropdown-menu { - right: 0; - left: auto; -} -.dropup .caret, -.navbar-fixed-bottom .dropdown .caret { - content: ""; - border-top: 0; - border-bottom: 4px dashed; - border-bottom: 4px solid \9; -} -.dropup .dropdown-menu, -.navbar-fixed-bottom .dropdown .dropdown-menu { - top: auto; - bottom: 100%; - margin-bottom: 2px; -} -@media (min-width: 768px) { - .navbar-right .dropdown-menu { - right: 0; - left: auto; - } - .navbar-right .dropdown-menu-left { - right: auto; - left: 0; - } -} -.btn-group, -.btn-group-vertical { - position: relative; - display: inline-block; - vertical-align: middle; -} -.btn-group > .btn, -.btn-group-vertical > .btn { - position: relative; - float: left; -} -.btn-group > .btn:hover, -.btn-group-vertical > .btn:hover, -.btn-group > .btn:focus, -.btn-group-vertical > .btn:focus, -.btn-group > .btn:active, -.btn-group-vertical > .btn:active, -.btn-group > .btn.active, -.btn-group-vertical > .btn.active { - z-index: 2; -} -.btn-group .btn + .btn, -.btn-group .btn + .btn-group, -.btn-group .btn-group + .btn, -.btn-group .btn-group + .btn-group { - margin-left: -1px; -} -.btn-toolbar { - margin-left: -5px; -} -.btn-toolbar .btn, -.btn-toolbar .btn-group, -.btn-toolbar .input-group { - float: left; -} -.btn-toolbar > .btn, -.btn-toolbar > .btn-group, -.btn-toolbar > .input-group { - margin-left: 5px; -} -.btn-group > .btn:not(:first-child):not(:last-child):not(.dropdown-toggle) { - border-radius: 0; -} -.btn-group > .btn:first-child { - margin-left: 0; -} -.btn-group > .btn:first-child:not(:last-child):not(.dropdown-toggle) { - border-top-right-radius: 0; - border-bottom-right-radius: 0; -} -.btn-group > .btn:last-child:not(:first-child), -.btn-group > .dropdown-toggle:not(:first-child) { - border-top-left-radius: 0; - border-bottom-left-radius: 0; -} -.btn-group > .btn-group { - float: left; -} -.btn-group > .btn-group:not(:first-child):not(:last-child) > .btn { - border-radius: 0; -} -.btn-group > .btn-group:first-child:not(:last-child) > .btn:last-child, -.btn-group > .btn-group:first-child:not(:last-child) > .dropdown-toggle { - border-top-right-radius: 0; - border-bottom-right-radius: 0; -} -.btn-group > .btn-group:last-child:not(:first-child) > .btn:first-child { - border-top-left-radius: 0; - border-bottom-left-radius: 0; -} -.btn-group .dropdown-toggle:active, -.btn-group.open .dropdown-toggle { - outline: 0; -} -.btn-group > .btn + .dropdown-toggle { - padding-right: 8px; - padding-left: 8px; -} -.btn-group > .btn-lg + .dropdown-toggle { - padding-right: 12px; - padding-left: 12px; -} -.btn-group.open .dropdown-toggle { - -webkit-box-shadow: inset 0 3px 5px rgba(0, 0, 0, .125); - box-shadow: inset 0 3px 5px rgba(0, 0, 0, .125); -} -.btn-group.open .dropdown-toggle.btn-link { - -webkit-box-shadow: none; - box-shadow: none; -} -.btn .caret { - margin-left: 0; -} -.btn-lg .caret { - border-width: 5px 5px 0; - border-bottom-width: 0; -} -.dropup .btn-lg .caret { - border-width: 0 5px 5px; -} -.btn-group-vertical > .btn, -.btn-group-vertical > .btn-group, -.btn-group-vertical > .btn-group > .btn { - display: block; - float: none; - width: 100%; - max-width: 100%; -} -.btn-group-vertical > .btn-group > .btn { - float: none; -} -.btn-group-vertical > .btn + .btn, -.btn-group-vertical > .btn + .btn-group, -.btn-group-vertical > .btn-group + .btn, -.btn-group-vertical > .btn-group + .btn-group { - margin-top: -1px; - margin-left: 0; -} -.btn-group-vertical > .btn:not(:first-child):not(:last-child) { - border-radius: 0; -} -.btn-group-vertical > .btn:first-child:not(:last-child) { - border-top-right-radius: 4px; - border-bottom-right-radius: 0; - border-bottom-left-radius: 0; -} -.btn-group-vertical > .btn:last-child:not(:first-child) { - border-top-left-radius: 0; - border-top-right-radius: 0; - border-bottom-left-radius: 4px; -} -.btn-group-vertical > .btn-group:not(:first-child):not(:last-child) > .btn { - border-radius: 0; -} -.btn-group-vertical > .btn-group:first-child:not(:last-child) > .btn:last-child, -.btn-group-vertical > .btn-group:first-child:not(:last-child) > .dropdown-toggle { - border-bottom-right-radius: 0; - border-bottom-left-radius: 0; -} -.btn-group-vertical > .btn-group:last-child:not(:first-child) > .btn:first-child { - border-top-left-radius: 0; - border-top-right-radius: 0; -} -.btn-group-justified { - display: table; - width: 100%; - table-layout: fixed; - border-collapse: separate; -} -.btn-group-justified > .btn, -.btn-group-justified > .btn-group { - display: table-cell; - float: none; - width: 1%; -} -.btn-group-justified > .btn-group .btn { - width: 100%; -} -.btn-group-justified > .btn-group .dropdown-menu { - left: auto; -} -[data-toggle="buttons"] > .btn input[type="radio"], -[data-toggle="buttons"] > .btn-group > .btn input[type="radio"], -[data-toggle="buttons"] > .btn input[type="checkbox"], -[data-toggle="buttons"] > .btn-group > .btn input[type="checkbox"] { - position: absolute; - clip: rect(0, 0, 0, 0); - pointer-events: none; -} -.input-group { - position: relative; - display: table; - border-collapse: separate; -} -.input-group[class*="col-"] { - float: none; - padding-right: 0; - padding-left: 0; -} -.input-group .form-control { - position: relative; - z-index: 2; - float: left; - width: 100%; - margin-bottom: 0; -} -.input-group-lg > .form-control, -.input-group-lg > .input-group-addon, -.input-group-lg > .input-group-btn > .btn { - height: 46px; - padding: 10px 16px; - font-size: 18px; - line-height: 1.3333333; - border-radius: 6px; -} -select.input-group-lg > .form-control, -select.input-group-lg > .input-group-addon, -select.input-group-lg > .input-group-btn > .btn { - height: 46px; - line-height: 46px; -} -textarea.input-group-lg > .form-control, -textarea.input-group-lg > .input-group-addon, -textarea.input-group-lg > .input-group-btn > .btn, -select[multiple].input-group-lg > .form-control, -select[multiple].input-group-lg > .input-group-addon, -select[multiple].input-group-lg > .input-group-btn > .btn { - height: auto; -} -.input-group-sm > .form-control, -.input-group-sm > .input-group-addon, -.input-group-sm > .input-group-btn > .btn { - height: 30px; - padding: 5px 10px; - font-size: 12px; - line-height: 1.5; - border-radius: 3px; -} -select.input-group-sm > .form-control, -select.input-group-sm > .input-group-addon, -select.input-group-sm > .input-group-btn > .btn { - height: 30px; - line-height: 30px; -} -textarea.input-group-sm > .form-control, -textarea.input-group-sm > .input-group-addon, -textarea.input-group-sm > .input-group-btn > .btn, -select[multiple].input-group-sm > .form-control, -select[multiple].input-group-sm > .input-group-addon, -select[multiple].input-group-sm > .input-group-btn > .btn { - height: auto; -} -.input-group-addon, -.input-group-btn, -.input-group .form-control { - display: table-cell; -} -.input-group-addon:not(:first-child):not(:last-child), -.input-group-btn:not(:first-child):not(:last-child), -.input-group .form-control:not(:first-child):not(:last-child) { - border-radius: 0; -} -.input-group-addon, -.input-group-btn { - width: 1%; - white-space: nowrap; - vertical-align: middle; -} -.input-group-addon { - padding: 6px 12px; - font-size: 14px; - font-weight: normal; - line-height: 1; - color: #555; - text-align: center; - background-color: #eee; - border: 1px solid #ccc; - border-radius: 4px; -} -.input-group-addon.input-sm { - padding: 5px 10px; - font-size: 12px; - border-radius: 3px; -} -.input-group-addon.input-lg { - padding: 10px 16px; - font-size: 18px; - border-radius: 6px; -} -.input-group-addon input[type="radio"], -.input-group-addon input[type="checkbox"] { - margin-top: 0; -} -.input-group .form-control:first-child, -.input-group-addon:first-child, -.input-group-btn:first-child > .btn, -.input-group-btn:first-child > .btn-group > .btn, -.input-group-btn:first-child > .dropdown-toggle, -.input-group-btn:last-child > .btn:not(:last-child):not(.dropdown-toggle), -.input-group-btn:last-child > .btn-group:not(:last-child) > .btn { - border-top-right-radius: 0; - border-bottom-right-radius: 0; -} -.input-group-addon:first-child { - border-right: 0; -} -.input-group .form-control:last-child, -.input-group-addon:last-child, -.input-group-btn:last-child > .btn, -.input-group-btn:last-child > .btn-group > .btn, -.input-group-btn:last-child > .dropdown-toggle, -.input-group-btn:first-child > .btn:not(:first-child), -.input-group-btn:first-child > .btn-group:not(:first-child) > .btn { - border-top-left-radius: 0; - border-bottom-left-radius: 0; -} -.input-group-addon:last-child { - border-left: 0; -} -.input-group-btn { - position: relative; - font-size: 0; - white-space: nowrap; -} -.input-group-btn > .btn { - position: relative; -} -.input-group-btn > .btn + .btn { - margin-left: -1px; -} -.input-group-btn > .btn:hover, -.input-group-btn > .btn:focus, -.input-group-btn > .btn:active { - z-index: 2; -} -.input-group-btn:first-child > .btn, -.input-group-btn:first-child > .btn-group { - margin-right: -1px; -} -.input-group-btn:last-child > .btn, -.input-group-btn:last-child > .btn-group { - z-index: 2; - margin-left: -1px; -} -.nav { - padding-left: 0; - margin-bottom: 0; - list-style: none; -} -.nav > li { - position: relative; - display: block; -} -.nav > li > a { - position: relative; - display: block; - padding: 10px 15px; -} -.nav > li > a:hover, -.nav > li > a:focus { - text-decoration: none; - background-color: #eee; -} -.nav > li.disabled > a { - color: #777; -} -.nav > li.disabled > a:hover, -.nav > li.disabled > a:focus { - color: #777; - text-decoration: none; - cursor: not-allowed; - background-color: transparent; -} -.nav .open > a, -.nav .open > a:hover, -.nav .open > a:focus { - background-color: #eee; - border-color: #337ab7; -} -.nav .nav-divider { - height: 1px; - margin: 9px 0; - overflow: hidden; - background-color: #e5e5e5; -} -.nav > li > a > img { - max-width: none; -} -.nav-tabs { - border-bottom: 1px solid #ddd; -} -.nav-tabs > li { - float: left; - margin-bottom: -1px; -} -.nav-tabs > li > a { - margin-right: 2px; - line-height: 1.42857143; - border: 1px solid transparent; - border-radius: 4px 4px 0 0; -} -.nav-tabs > li > a:hover { - border-color: #eee #eee #ddd; -} -.nav-tabs > li.active > a, -.nav-tabs > li.active > a:hover, -.nav-tabs > li.active > a:focus { - color: #555; - cursor: default; - background-color: #fff; - border: 1px solid #ddd; - border-bottom-color: transparent; -} -.nav-tabs.nav-justified { - width: 100%; - border-bottom: 0; -} -.nav-tabs.nav-justified > li { - float: none; -} -.nav-tabs.nav-justified > li > a { - margin-bottom: 5px; - text-align: center; -} -.nav-tabs.nav-justified > .dropdown .dropdown-menu { - top: auto; - left: auto; -} -@media (min-width: 768px) { - .nav-tabs.nav-justified > li { - display: table-cell; - width: 1%; - } - .nav-tabs.nav-justified > li > a { - margin-bottom: 0; - } -} -.nav-tabs.nav-justified > li > a { - margin-right: 0; - border-radius: 4px; -} -.nav-tabs.nav-justified > .active > a, -.nav-tabs.nav-justified > .active > a:hover, -.nav-tabs.nav-justified > .active > a:focus { - border: 1px solid #ddd; -} -@media (min-width: 768px) { - .nav-tabs.nav-justified > li > a { - border-bottom: 1px solid #ddd; - border-radius: 4px 4px 0 0; - } - .nav-tabs.nav-justified > .active > a, - .nav-tabs.nav-justified > .active > a:hover, - .nav-tabs.nav-justified > .active > a:focus { - border-bottom-color: #fff; - } -} -.nav-pills > li { - float: left; -} -.nav-pills > li > a { - border-radius: 4px; -} -.nav-pills > li + li { - margin-left: 2px; -} -.nav-pills > li.active > a, -.nav-pills > li.active > a:hover, -.nav-pills > li.active > a:focus { - color: #fff; - background-color: #337ab7; -} -.nav-stacked > li { - float: none; -} -.nav-stacked > li + li { - margin-top: 2px; - margin-left: 0; -} -.nav-justified { - width: 100%; -} -.nav-justified > li { - float: none; -} -.nav-justified > li > a { - margin-bottom: 5px; - text-align: center; -} -.nav-justified > .dropdown .dropdown-menu { - top: auto; - left: auto; -} -@media (min-width: 768px) { - .nav-justified > li { - display: table-cell; - width: 1%; - } - .nav-justified > li > a { - margin-bottom: 0; - } -} -.nav-tabs-justified { - border-bottom: 0; -} -.nav-tabs-justified > li > a { - margin-right: 0; - border-radius: 4px; -} -.nav-tabs-justified > .active > a, -.nav-tabs-justified > .active > a:hover, -.nav-tabs-justified > .active > a:focus { - border: 1px solid #ddd; -} -@media (min-width: 768px) { - .nav-tabs-justified > li > a { - border-bottom: 1px solid #ddd; - border-radius: 4px 4px 0 0; - } - .nav-tabs-justified > .active > a, - .nav-tabs-justified > .active > a:hover, - .nav-tabs-justified > .active > a:focus { - border-bottom-color: #fff; - } -} -.tab-content > .tab-pane { - display: none; -} -.tab-content > .active { - display: block; -} -.nav-tabs .dropdown-menu { - margin-top: -1px; - border-top-left-radius: 0; - border-top-right-radius: 0; -} -.navbar { - position: relative; - min-height: 50px; - margin-bottom: 20px; - border: 1px solid transparent; -} -@media (min-width: 768px) { - .navbar { - border-radius: 4px; - } -} -@media (min-width: 768px) { - .navbar-header { - float: left; - } -} -.navbar-collapse { - padding-right: 15px; - padding-left: 15px; - overflow-x: visible; - -webkit-overflow-scrolling: touch; - border-top: 1px solid transparent; - -webkit-box-shadow: inset 0 1px 0 rgba(255, 255, 255, .1); - box-shadow: inset 0 1px 0 rgba(255, 255, 255, .1); -} -.navbar-collapse.in { - overflow-y: auto; -} -@media (min-width: 768px) { - .navbar-collapse { - width: auto; - border-top: 0; - -webkit-box-shadow: none; - box-shadow: none; - } - .navbar-collapse.collapse { - display: block !important; - height: auto !important; - padding-bottom: 0; - overflow: visible !important; - } - .navbar-collapse.in { - overflow-y: visible; - } - .navbar-fixed-top .navbar-collapse, - .navbar-static-top .navbar-collapse, - .navbar-fixed-bottom .navbar-collapse { - padding-right: 0; - padding-left: 0; - } -} -.navbar-fixed-top .navbar-collapse, -.navbar-fixed-bottom .navbar-collapse { - max-height: 340px; -} -@media (max-device-width: 480px) and (orientation: landscape) { - .navbar-fixed-top .navbar-collapse, - .navbar-fixed-bottom .navbar-collapse { - max-height: 200px; - } -} -.container > .navbar-header, -.container-fluid > .navbar-header, -.container > .navbar-collapse, -.container-fluid > .navbar-collapse { - margin-right: -15px; - margin-left: -15px; -} -@media (min-width: 768px) { - .container > .navbar-header, - .container-fluid > .navbar-header, - .container > .navbar-collapse, - .container-fluid > .navbar-collapse { - margin-right: 0; - margin-left: 0; - } -} -.navbar-static-top { - z-index: 1000; - border-width: 0 0 1px; -} -@media (min-width: 768px) { - .navbar-static-top { - border-radius: 0; - } -} -.navbar-fixed-top, -.navbar-fixed-bottom { - position: fixed; - right: 0; - left: 0; - z-index: 1030; -} -@media (min-width: 768px) { - .navbar-fixed-top, - .navbar-fixed-bottom { - border-radius: 0; - } -} -.navbar-fixed-top { - top: 0; - border-width: 0 0 1px; -} -.navbar-fixed-bottom { - bottom: 0; - margin-bottom: 0; - border-width: 1px 0 0; -} -.navbar-brand { - float: left; - height: 50px; - padding: 15px 15px; - font-size: 18px; - line-height: 20px; -} -.navbar-brand:hover, -.navbar-brand:focus { - text-decoration: none; -} -.navbar-brand > img { - display: block; -} -@media (min-width: 768px) { - .navbar > .container .navbar-brand, - .navbar > .container-fluid .navbar-brand { - margin-left: -15px; - } -} -.navbar-toggle { - position: relative; - float: right; - padding: 9px 10px; - margin-top: 8px; - margin-right: 15px; - margin-bottom: 8px; - background-color: transparent; - background-image: none; - border: 1px solid transparent; - border-radius: 4px; -} -.navbar-toggle:focus { - outline: 0; -} -.navbar-toggle .icon-bar { - display: block; - width: 22px; - height: 2px; - border-radius: 1px; -} -.navbar-toggle .icon-bar + .icon-bar { - margin-top: 4px; -} -@media (min-width: 768px) { - .navbar-toggle { - display: none; - } -} -.navbar-nav { - margin: 7.5px -15px; -} -.navbar-nav > li > a { - padding-top: 10px; - padding-bottom: 10px; - line-height: 20px; -} -@media (max-width: 767px) { - .navbar-nav .open .dropdown-menu { - position: static; - float: none; - width: auto; - margin-top: 0; - background-color: transparent; - border: 0; - -webkit-box-shadow: none; - box-shadow: none; - } - .navbar-nav .open .dropdown-menu > li > a, - .navbar-nav .open .dropdown-menu .dropdown-header { - padding: 5px 15px 5px 25px; - } - .navbar-nav .open .dropdown-menu > li > a { - line-height: 20px; - } - .navbar-nav .open .dropdown-menu > li > a:hover, - .navbar-nav .open .dropdown-menu > li > a:focus { - background-image: none; - } -} -@media (min-width: 768px) { - .navbar-nav { - float: left; - margin: 0; - } - .navbar-nav > li { - float: left; - } - .navbar-nav > li > a { - padding-top: 15px; - padding-bottom: 15px; - } -} -.navbar-form { - padding: 10px 15px; - margin-top: 8px; - margin-right: -15px; - margin-bottom: 8px; - margin-left: -15px; - border-top: 1px solid transparent; - border-bottom: 1px solid transparent; - -webkit-box-shadow: inset 0 1px 0 rgba(255, 255, 255, .1), 0 1px 0 rgba(255, 255, 255, .1); - box-shadow: inset 0 1px 0 rgba(255, 255, 255, .1), 0 1px 0 rgba(255, 255, 255, .1); -} -@media (min-width: 768px) { - .navbar-form .form-group { - display: inline-block; - margin-bottom: 0; - vertical-align: middle; - } - .navbar-form .form-control { - display: inline-block; - width: auto; - vertical-align: middle; - } - .navbar-form .form-control-static { - display: inline-block; - } - .navbar-form .input-group { - display: inline-table; - vertical-align: middle; - } - .navbar-form .input-group .input-group-addon, - .navbar-form .input-group .input-group-btn, - .navbar-form .input-group .form-control { - width: auto; - } - .navbar-form .input-group > .form-control { - width: 100%; - } - .navbar-form .control-label { - margin-bottom: 0; - vertical-align: middle; - } - .navbar-form .radio, - .navbar-form .checkbox { - display: inline-block; - margin-top: 0; - margin-bottom: 0; - vertical-align: middle; - } - .navbar-form .radio label, - .navbar-form .checkbox label { - padding-left: 0; - } - .navbar-form .radio input[type="radio"], - .navbar-form .checkbox input[type="checkbox"] { - position: relative; - margin-left: 0; - } - .navbar-form .has-feedback .form-control-feedback { - top: 0; - } -} -@media (max-width: 767px) { - .navbar-form .form-group { - margin-bottom: 5px; - } - .navbar-form .form-group:last-child { - margin-bottom: 0; - } -} -@media (min-width: 768px) { - .navbar-form { - width: auto; - padding-top: 0; - padding-bottom: 0; - margin-right: 0; - margin-left: 0; - border: 0; - -webkit-box-shadow: none; - box-shadow: none; - } -} -.navbar-nav > li > .dropdown-menu { - margin-top: 0; - border-top-left-radius: 0; - border-top-right-radius: 0; -} -.navbar-fixed-bottom .navbar-nav > li > .dropdown-menu { - margin-bottom: 0; - border-top-left-radius: 4px; - border-top-right-radius: 4px; - border-bottom-right-radius: 0; - border-bottom-left-radius: 0; -} -.navbar-btn { - margin-top: 8px; - margin-bottom: 8px; -} -.navbar-btn.btn-sm { - margin-top: 10px; - margin-bottom: 10px; -} -.navbar-btn.btn-xs { - margin-top: 14px; - margin-bottom: 14px; -} -.navbar-text { - margin-top: 15px; - margin-bottom: 15px; -} -@media (min-width: 768px) { - .navbar-text { - float: left; - margin-right: 15px; - margin-left: 15px; - } -} -@media (min-width: 768px) { - .navbar-left { - float: left !important; - } - .navbar-right { - float: right !important; - margin-right: -15px; - } - .navbar-right ~ .navbar-right { - margin-right: 0; - } -} -.navbar-default { - background-color: #f8f8f8; - border-color: #e7e7e7; -} -.navbar-default .navbar-brand { - color: #777; -} -.navbar-default .navbar-brand:hover, -.navbar-default .navbar-brand:focus { - color: #5e5e5e; - background-color: transparent; -} -.navbar-default .navbar-text { - color: #777; -} -.navbar-default .navbar-nav > li > a { - color: #777; -} -.navbar-default .navbar-nav > li > a:hover, -.navbar-default .navbar-nav > li > a:focus { - color: #333; - background-color: transparent; -} -.navbar-default .navbar-nav > .active > a, -.navbar-default .navbar-nav > .active > a:hover, -.navbar-default .navbar-nav > .active > a:focus { - color: #555; - background-color: #e7e7e7; -} -.navbar-default .navbar-nav > .disabled > a, -.navbar-default .navbar-nav > .disabled > a:hover, -.navbar-default .navbar-nav > .disabled > a:focus { - color: #ccc; - background-color: transparent; -} -.navbar-default .navbar-toggle { - border-color: #ddd; -} -.navbar-default .navbar-toggle:hover, -.navbar-default .navbar-toggle:focus { - background-color: #ddd; -} -.navbar-default .navbar-toggle .icon-bar { - background-color: #888; -} -.navbar-default .navbar-collapse, -.navbar-default .navbar-form { - border-color: #e7e7e7; -} -.navbar-default .navbar-nav > .open > a, -.navbar-default .navbar-nav > .open > a:hover, -.navbar-default .navbar-nav > .open > a:focus { - color: #555; - background-color: #e7e7e7; -} -@media (max-width: 767px) { - .navbar-default .navbar-nav .open .dropdown-menu > li > a { - color: #777; - } - .navbar-default .navbar-nav .open .dropdown-menu > li > a:hover, - .navbar-default .navbar-nav .open .dropdown-menu > li > a:focus { - color: #333; - background-color: transparent; - } - .navbar-default .navbar-nav .open .dropdown-menu > .active > a, - .navbar-default .navbar-nav .open .dropdown-menu > .active > a:hover, - .navbar-default .navbar-nav .open .dropdown-menu > .active > a:focus { - color: #555; - background-color: #e7e7e7; - } - .navbar-default .navbar-nav .open .dropdown-menu > .disabled > a, - .navbar-default .navbar-nav .open .dropdown-menu > .disabled > a:hover, - .navbar-default .navbar-nav .open .dropdown-menu > .disabled > a:focus { - color: #ccc; - background-color: transparent; - } -} -.navbar-default .navbar-link { - color: #777; -} -.navbar-default .navbar-link:hover { - color: #333; -} -.navbar-default .btn-link { - color: #777; -} -.navbar-default .btn-link:hover, -.navbar-default .btn-link:focus { - color: #333; -} -.navbar-default .btn-link[disabled]:hover, -fieldset[disabled] .navbar-default .btn-link:hover, -.navbar-default .btn-link[disabled]:focus, -fieldset[disabled] .navbar-default .btn-link:focus { - color: #ccc; -} -.navbar-inverse { - background-color: #222; - border-color: #080808; -} -.navbar-inverse .navbar-brand { - color: #9d9d9d; -} -.navbar-inverse .navbar-brand:hover, -.navbar-inverse .navbar-brand:focus { - color: #fff; - background-color: transparent; -} -.navbar-inverse .navbar-text { - color: #9d9d9d; -} -.navbar-inverse .navbar-nav > li > a { - color: #9d9d9d; -} -.navbar-inverse .navbar-nav > li > a:hover, -.navbar-inverse .navbar-nav > li > a:focus { - color: #fff; - background-color: transparent; -} -.navbar-inverse .navbar-nav > .active > a, -.navbar-inverse .navbar-nav > .active > a:hover, -.navbar-inverse .navbar-nav > .active > a:focus { - color: #fff; - background-color: #080808; -} -.navbar-inverse .navbar-nav > .disabled > a, -.navbar-inverse .navbar-nav > .disabled > a:hover, -.navbar-inverse .navbar-nav > .disabled > a:focus { - color: #444; - background-color: transparent; -} -.navbar-inverse .navbar-toggle { - border-color: #333; -} -.navbar-inverse .navbar-toggle:hover, -.navbar-inverse .navbar-toggle:focus { - background-color: #333; -} -.navbar-inverse .navbar-toggle .icon-bar { - background-color: #fff; -} -.navbar-inverse .navbar-collapse, -.navbar-inverse .navbar-form { - border-color: #101010; -} -.navbar-inverse .navbar-nav > .open > a, -.navbar-inverse .navbar-nav > .open > a:hover, -.navbar-inverse .navbar-nav > .open > a:focus { - color: #fff; - background-color: #080808; -} -@media (max-width: 767px) { - .navbar-inverse .navbar-nav .open .dropdown-menu > .dropdown-header { - border-color: #080808; - } - .navbar-inverse .navbar-nav .open .dropdown-menu .divider { - background-color: #080808; - } - .navbar-inverse .navbar-nav .open .dropdown-menu > li > a { - color: #9d9d9d; - } - .navbar-inverse .navbar-nav .open .dropdown-menu > li > a:hover, - .navbar-inverse .navbar-nav .open .dropdown-menu > li > a:focus { - color: #fff; - background-color: transparent; - } - .navbar-inverse .navbar-nav .open .dropdown-menu > .active > a, - .navbar-inverse .navbar-nav .open .dropdown-menu > .active > a:hover, - .navbar-inverse .navbar-nav .open .dropdown-menu > .active > a:focus { - color: #fff; - background-color: #080808; - } - .navbar-inverse .navbar-nav .open .dropdown-menu > .disabled > a, - .navbar-inverse .navbar-nav .open .dropdown-menu > .disabled > a:hover, - .navbar-inverse .navbar-nav .open .dropdown-menu > .disabled > a:focus { - color: #444; - background-color: transparent; - } -} -.navbar-inverse .navbar-link { - color: #9d9d9d; -} -.navbar-inverse .navbar-link:hover { - color: #fff; -} -.navbar-inverse .btn-link { - color: #9d9d9d; -} -.navbar-inverse .btn-link:hover, -.navbar-inverse .btn-link:focus { - color: #fff; -} -.navbar-inverse .btn-link[disabled]:hover, -fieldset[disabled] .navbar-inverse .btn-link:hover, -.navbar-inverse .btn-link[disabled]:focus, -fieldset[disabled] .navbar-inverse .btn-link:focus { - color: #444; -} -.breadcrumb { - padding: 8px 15px; - margin-bottom: 20px; - list-style: none; - background-color: #f5f5f5; - border-radius: 4px; -} -.breadcrumb > li { - display: inline-block; -} -.breadcrumb > li + li:before { - padding: 0 5px; - color: #ccc; - content: "/\00a0"; -} -.breadcrumb > .active { - color: #777; -} -.pagination { - display: inline-block; - padding-left: 0; - margin: 20px 0; - border-radius: 4px; -} -.pagination > li { - display: inline; -} -.pagination > li > a, -.pagination > li > span { - position: relative; - float: left; - padding: 6px 12px; - margin-left: -1px; - line-height: 1.42857143; - color: #337ab7; - text-decoration: none; - background-color: #fff; - border: 1px solid #ddd; -} -.pagination > li:first-child > a, -.pagination > li:first-child > span { - margin-left: 0; - border-top-left-radius: 4px; - border-bottom-left-radius: 4px; -} -.pagination > li:last-child > a, -.pagination > li:last-child > span { - border-top-right-radius: 4px; - border-bottom-right-radius: 4px; -} -.pagination > li > a:hover, -.pagination > li > span:hover, -.pagination > li > a:focus, -.pagination > li > span:focus { - z-index: 3; - color: #23527c; - background-color: #eee; - border-color: #ddd; -} -.pagination > .active > a, -.pagination > .active > span, -.pagination > .active > a:hover, -.pagination > .active > span:hover, -.pagination > .active > a:focus, -.pagination > .active > span:focus { - z-index: 2; - color: #fff; - cursor: default; - background-color: #337ab7; - border-color: #337ab7; -} -.pagination > .disabled > span, -.pagination > .disabled > span:hover, -.pagination > .disabled > span:focus, -.pagination > .disabled > a, -.pagination > .disabled > a:hover, -.pagination > .disabled > a:focus { - color: #777; - cursor: not-allowed; - background-color: #fff; - border-color: #ddd; -} -.pagination-lg > li > a, -.pagination-lg > li > span { - padding: 10px 16px; - font-size: 18px; - line-height: 1.3333333; -} -.pagination-lg > li:first-child > a, -.pagination-lg > li:first-child > span { - border-top-left-radius: 6px; - border-bottom-left-radius: 6px; -} -.pagination-lg > li:last-child > a, -.pagination-lg > li:last-child > span { - border-top-right-radius: 6px; - border-bottom-right-radius: 6px; -} -.pagination-sm > li > a, -.pagination-sm > li > span { - padding: 5px 10px; - font-size: 12px; - line-height: 1.5; -} -.pagination-sm > li:first-child > a, -.pagination-sm > li:first-child > span { - border-top-left-radius: 3px; - border-bottom-left-radius: 3px; -} -.pagination-sm > li:last-child > a, -.pagination-sm > li:last-child > span { - border-top-right-radius: 3px; - border-bottom-right-radius: 3px; -} -.pager { - padding-left: 0; - margin: 20px 0; - text-align: center; - list-style: none; -} -.pager li { - display: inline; -} -.pager li > a, -.pager li > span { - display: inline-block; - padding: 5px 14px; - background-color: #fff; - border: 1px solid #ddd; - border-radius: 15px; -} -.pager li > a:hover, -.pager li > a:focus { - text-decoration: none; - background-color: #eee; -} -.pager .next > a, -.pager .next > span { - float: right; -} -.pager .previous > a, -.pager .previous > span { - float: left; -} -.pager .disabled > a, -.pager .disabled > a:hover, -.pager .disabled > a:focus, -.pager .disabled > span { - color: #777; - cursor: not-allowed; - background-color: #fff; -} -.label { - display: inline; - padding: .2em .6em .3em; - font-size: 75%; - font-weight: bold; - line-height: 1; - color: #fff; - text-align: center; - white-space: nowrap; - vertical-align: baseline; - border-radius: .25em; -} -a.label:hover, -a.label:focus { - color: #fff; - text-decoration: none; - cursor: pointer; -} -.label:empty { - display: none; -} -.btn .label { - position: relative; - top: -1px; -} -.label-default { - background-color: #777; -} -.label-default[href]:hover, -.label-default[href]:focus { - background-color: #5e5e5e; -} -.label-primary { - background-color: #337ab7; -} -.label-primary[href]:hover, -.label-primary[href]:focus { - background-color: #286090; -} -.label-success { - background-color: #5cb85c; -} -.label-success[href]:hover, -.label-success[href]:focus { - background-color: #449d44; -} -.label-info { - background-color: #5bc0de; -} -.label-info[href]:hover, -.label-info[href]:focus { - background-color: #31b0d5; -} -.label-warning { - background-color: #f0ad4e; -} -.label-warning[href]:hover, -.label-warning[href]:focus { - background-color: #ec971f; -} -.label-danger { - background-color: #d9534f; -} -.label-danger[href]:hover, -.label-danger[href]:focus { - background-color: #c9302c; -} -.badge { - display: inline-block; - min-width: 10px; - padding: 3px 7px; - font-size: 12px; - font-weight: bold; - line-height: 1; - color: #fff; - text-align: center; - white-space: nowrap; - vertical-align: middle; - background-color: #777; - border-radius: 10px; -} -.badge:empty { - display: none; -} -.btn .badge { - position: relative; - top: -1px; -} -.btn-xs .badge, -.btn-group-xs > .btn .badge { - top: 0; - padding: 1px 5px; -} -a.badge:hover, -a.badge:focus { - color: #fff; - text-decoration: none; - cursor: pointer; -} -.list-group-item.active > .badge, -.nav-pills > .active > a > .badge { - color: #337ab7; - background-color: #fff; -} -.list-group-item > .badge { - float: right; -} -.list-group-item > .badge + .badge { - margin-right: 5px; -} -.nav-pills > li > a > .badge { - margin-left: 3px; -} -.jumbotron { - padding-top: 30px; - padding-bottom: 30px; - margin-bottom: 30px; - color: inherit; - background-color: #eee; -} -.jumbotron h1, -.jumbotron .h1 { - color: inherit; -} -.jumbotron p { - margin-bottom: 15px; - font-size: 21px; - font-weight: 200; -} -.jumbotron > hr { - border-top-color: #d5d5d5; -} -.container .jumbotron, -.container-fluid .jumbotron { - border-radius: 6px; -} -.jumbotron .container { - max-width: 100%; -} -@media screen and (min-width: 768px) { - .jumbotron { - padding-top: 48px; - padding-bottom: 48px; - } - .container .jumbotron, - .container-fluid .jumbotron { - padding-right: 60px; - padding-left: 60px; - } - .jumbotron h1, - .jumbotron .h1 { - font-size: 63px; - } -} -.thumbnail { - display: block; - padding: 4px; - margin-bottom: 20px; - line-height: 1.42857143; - background-color: #fff; - border: 1px solid #ddd; - border-radius: 4px; - -webkit-transition: border .2s ease-in-out; - -o-transition: border .2s ease-in-out; - transition: border .2s ease-in-out; -} -.thumbnail > img, -.thumbnail a > img { - margin-right: auto; - margin-left: auto; -} -a.thumbnail:hover, -a.thumbnail:focus, -a.thumbnail.active { - border-color: #337ab7; -} -.thumbnail .caption { - padding: 9px; - color: #333; -} -.alert { - padding: 15px; - margin-bottom: 20px; - border: 1px solid transparent; - border-radius: 4px; -} -.alert h4 { - margin-top: 0; - color: inherit; -} -.alert .alert-link { - font-weight: bold; -} -.alert > p, -.alert > ul { - margin-bottom: 0; -} -.alert > p + p { - margin-top: 5px; -} -.alert-dismissable, -.alert-dismissible { - padding-right: 35px; -} -.alert-dismissable .close, -.alert-dismissible .close { - position: relative; - top: -2px; - right: -21px; - color: inherit; -} -.alert-success { - color: #3c763d; - background-color: #dff0d8; - border-color: #d6e9c6; -} -.alert-success hr { - border-top-color: #c9e2b3; -} -.alert-success .alert-link { - color: #2b542c; -} -.alert-info { - color: #31708f; - background-color: #d9edf7; - border-color: #bce8f1; -} -.alert-info hr { - border-top-color: #a6e1ec; -} -.alert-info .alert-link { - color: #245269; -} -.alert-warning { - color: #8a6d3b; - background-color: #fcf8e3; - border-color: #faebcc; -} -.alert-warning hr { - border-top-color: #f7e1b5; -} -.alert-warning .alert-link { - color: #66512c; -} -.alert-danger { - color: #a94442; - background-color: #f2dede; - border-color: #ebccd1; -} -.alert-danger hr { - border-top-color: #e4b9c0; -} -.alert-danger .alert-link { - color: #843534; -} -@-webkit-keyframes progress-bar-stripes { - from { - background-position: 40px 0; - } - to { - background-position: 0 0; - } -} -@-o-keyframes progress-bar-stripes { - from { - background-position: 40px 0; - } - to { - background-position: 0 0; - } -} -@keyframes progress-bar-stripes { - from { - background-position: 40px 0; - } - to { - background-position: 0 0; - } -} -.progress { - height: 20px; - margin-bottom: 20px; - overflow: hidden; - background-color: #f5f5f5; - border-radius: 4px; - -webkit-box-shadow: inset 0 1px 2px rgba(0, 0, 0, .1); - box-shadow: inset 0 1px 2px rgba(0, 0, 0, .1); -} -.progress-bar { - float: left; - width: 0; - height: 100%; - font-size: 12px; - line-height: 20px; - color: #fff; - text-align: center; - background-color: #337ab7; - -webkit-box-shadow: inset 0 -1px 0 rgba(0, 0, 0, .15); - box-shadow: inset 0 -1px 0 rgba(0, 0, 0, .15); - -webkit-transition: width .6s ease; - -o-transition: width .6s ease; - transition: width .6s ease; -} -.progress-striped .progress-bar, -.progress-bar-striped { - background-image: -webkit-linear-gradient(45deg, rgba(255, 255, 255, .15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, .15) 50%, rgba(255, 255, 255, .15) 75%, transparent 75%, transparent); - background-image: -o-linear-gradient(45deg, rgba(255, 255, 255, .15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, .15) 50%, rgba(255, 255, 255, .15) 75%, transparent 75%, transparent); - background-image: linear-gradient(45deg, rgba(255, 255, 255, .15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, .15) 50%, rgba(255, 255, 255, .15) 75%, transparent 75%, transparent); - -webkit-background-size: 40px 40px; - background-size: 40px 40px; -} -.progress.active .progress-bar, -.progress-bar.active { - -webkit-animation: progress-bar-stripes 2s linear infinite; - -o-animation: progress-bar-stripes 2s linear infinite; - animation: progress-bar-stripes 2s linear infinite; -} -.progress-bar-success { - background-color: #5cb85c; -} -.progress-striped .progress-bar-success { - background-image: -webkit-linear-gradient(45deg, rgba(255, 255, 255, .15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, .15) 50%, rgba(255, 255, 255, .15) 75%, transparent 75%, transparent); - background-image: -o-linear-gradient(45deg, rgba(255, 255, 255, .15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, .15) 50%, rgba(255, 255, 255, .15) 75%, transparent 75%, transparent); - background-image: linear-gradient(45deg, rgba(255, 255, 255, .15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, .15) 50%, rgba(255, 255, 255, .15) 75%, transparent 75%, transparent); -} -.progress-bar-info { - background-color: #5bc0de; -} -.progress-striped .progress-bar-info { - background-image: -webkit-linear-gradient(45deg, rgba(255, 255, 255, .15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, .15) 50%, rgba(255, 255, 255, .15) 75%, transparent 75%, transparent); - background-image: -o-linear-gradient(45deg, rgba(255, 255, 255, .15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, .15) 50%, rgba(255, 255, 255, .15) 75%, transparent 75%, transparent); - background-image: linear-gradient(45deg, rgba(255, 255, 255, .15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, .15) 50%, rgba(255, 255, 255, .15) 75%, transparent 75%, transparent); -} -.progress-bar-warning { - background-color: #f0ad4e; -} -.progress-striped .progress-bar-warning { - background-image: -webkit-linear-gradient(45deg, rgba(255, 255, 255, .15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, .15) 50%, rgba(255, 255, 255, .15) 75%, transparent 75%, transparent); - background-image: -o-linear-gradient(45deg, rgba(255, 255, 255, .15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, .15) 50%, rgba(255, 255, 255, .15) 75%, transparent 75%, transparent); - background-image: linear-gradient(45deg, rgba(255, 255, 255, .15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, .15) 50%, rgba(255, 255, 255, .15) 75%, transparent 75%, transparent); -} -.progress-bar-danger { - background-color: #d9534f; -} -.progress-striped .progress-bar-danger { - background-image: -webkit-linear-gradient(45deg, rgba(255, 255, 255, .15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, .15) 50%, rgba(255, 255, 255, .15) 75%, transparent 75%, transparent); - background-image: -o-linear-gradient(45deg, rgba(255, 255, 255, .15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, .15) 50%, rgba(255, 255, 255, .15) 75%, transparent 75%, transparent); - background-image: linear-gradient(45deg, rgba(255, 255, 255, .15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, .15) 50%, rgba(255, 255, 255, .15) 75%, transparent 75%, transparent); -} -.media { - margin-top: 15px; -} -.media:first-child { - margin-top: 0; -} -.media, -.media-body { - overflow: hidden; - zoom: 1; -} -.media-body { - width: 10000px; -} -.media-object { - display: block; -} -.media-object.img-thumbnail { - max-width: none; -} -.media-right, -.media > .pull-right { - padding-left: 10px; -} -.media-left, -.media > .pull-left { - padding-right: 10px; -} -.media-left, -.media-right, -.media-body { - display: table-cell; - vertical-align: top; -} -.media-middle { - vertical-align: middle; -} -.media-bottom { - vertical-align: bottom; -} -.media-heading { - margin-top: 0; - margin-bottom: 5px; -} -.media-list { - padding-left: 0; - list-style: none; -} -.list-group { - padding-left: 0; - margin-bottom: 20px; -} -.list-group-item { - position: relative; - display: block; - padding: 10px 15px; - margin-bottom: -1px; - background-color: #fff; - border: 1px solid #ddd; -} -.list-group-item:first-child { - border-top-left-radius: 4px; - border-top-right-radius: 4px; -} -.list-group-item:last-child { - margin-bottom: 0; - border-bottom-right-radius: 4px; - border-bottom-left-radius: 4px; -} -a.list-group-item, -button.list-group-item { - color: #555; -} -a.list-group-item .list-group-item-heading, -button.list-group-item .list-group-item-heading { - color: #333; -} -a.list-group-item:hover, -button.list-group-item:hover, -a.list-group-item:focus, -button.list-group-item:focus { - color: #555; - text-decoration: none; - background-color: #f5f5f5; -} -button.list-group-item { - width: 100%; - text-align: left; -} -.list-group-item.disabled, -.list-group-item.disabled:hover, -.list-group-item.disabled:focus { - color: #777; - cursor: not-allowed; - background-color: #eee; -} -.list-group-item.disabled .list-group-item-heading, -.list-group-item.disabled:hover .list-group-item-heading, -.list-group-item.disabled:focus .list-group-item-heading { - color: inherit; -} -.list-group-item.disabled .list-group-item-text, -.list-group-item.disabled:hover .list-group-item-text, -.list-group-item.disabled:focus .list-group-item-text { - color: #777; -} -.list-group-item.active, -.list-group-item.active:hover, -.list-group-item.active:focus { - z-index: 2; - color: #fff; - background-color: #337ab7; - border-color: #337ab7; -} -.list-group-item.active .list-group-item-heading, -.list-group-item.active:hover .list-group-item-heading, -.list-group-item.active:focus .list-group-item-heading, -.list-group-item.active .list-group-item-heading > small, -.list-group-item.active:hover .list-group-item-heading > small, -.list-group-item.active:focus .list-group-item-heading > small, -.list-group-item.active .list-group-item-heading > .small, -.list-group-item.active:hover .list-group-item-heading > .small, -.list-group-item.active:focus .list-group-item-heading > .small { - color: inherit; -} -.list-group-item.active .list-group-item-text, -.list-group-item.active:hover .list-group-item-text, -.list-group-item.active:focus .list-group-item-text { - color: #c7ddef; -} -.list-group-item-success { - color: #3c763d; - background-color: #dff0d8; -} -a.list-group-item-success, -button.list-group-item-success { - color: #3c763d; -} -a.list-group-item-success .list-group-item-heading, -button.list-group-item-success .list-group-item-heading { - color: inherit; -} -a.list-group-item-success:hover, -button.list-group-item-success:hover, -a.list-group-item-success:focus, -button.list-group-item-success:focus { - color: #3c763d; - background-color: #d0e9c6; -} -a.list-group-item-success.active, -button.list-group-item-success.active, -a.list-group-item-success.active:hover, -button.list-group-item-success.active:hover, -a.list-group-item-success.active:focus, -button.list-group-item-success.active:focus { - color: #fff; - background-color: #3c763d; - border-color: #3c763d; -} -.list-group-item-info { - color: #31708f; - background-color: #d9edf7; -} -a.list-group-item-info, -button.list-group-item-info { - color: #31708f; -} -a.list-group-item-info .list-group-item-heading, -button.list-group-item-info .list-group-item-heading { - color: inherit; -} -a.list-group-item-info:hover, -button.list-group-item-info:hover, -a.list-group-item-info:focus, -button.list-group-item-info:focus { - color: #31708f; - background-color: #c4e3f3; -} -a.list-group-item-info.active, -button.list-group-item-info.active, -a.list-group-item-info.active:hover, -button.list-group-item-info.active:hover, -a.list-group-item-info.active:focus, -button.list-group-item-info.active:focus { - color: #fff; - background-color: #31708f; - border-color: #31708f; -} -.list-group-item-warning { - color: #8a6d3b; - background-color: #fcf8e3; -} -a.list-group-item-warning, -button.list-group-item-warning { - color: #8a6d3b; -} -a.list-group-item-warning .list-group-item-heading, -button.list-group-item-warning .list-group-item-heading { - color: inherit; -} -a.list-group-item-warning:hover, -button.list-group-item-warning:hover, -a.list-group-item-warning:focus, -button.list-group-item-warning:focus { - color: #8a6d3b; - background-color: #faf2cc; -} -a.list-group-item-warning.active, -button.list-group-item-warning.active, -a.list-group-item-warning.active:hover, -button.list-group-item-warning.active:hover, -a.list-group-item-warning.active:focus, -button.list-group-item-warning.active:focus { - color: #fff; - background-color: #8a6d3b; - border-color: #8a6d3b; -} -.list-group-item-danger { - color: #a94442; - background-color: #f2dede; -} -a.list-group-item-danger, -button.list-group-item-danger { - color: #a94442; -} -a.list-group-item-danger .list-group-item-heading, -button.list-group-item-danger .list-group-item-heading { - color: inherit; -} -a.list-group-item-danger:hover, -button.list-group-item-danger:hover, -a.list-group-item-danger:focus, -button.list-group-item-danger:focus { - color: #a94442; - background-color: #ebcccc; -} -a.list-group-item-danger.active, -button.list-group-item-danger.active, -a.list-group-item-danger.active:hover, -button.list-group-item-danger.active:hover, -a.list-group-item-danger.active:focus, -button.list-group-item-danger.active:focus { - color: #fff; - background-color: #a94442; - border-color: #a94442; -} -.list-group-item-heading { - margin-top: 0; - margin-bottom: 5px; -} -.list-group-item-text { - margin-bottom: 0; - line-height: 1.3; -} -.panel { - margin-bottom: 20px; - background-color: #fff; - border: 1px solid transparent; - border-radius: 4px; - -webkit-box-shadow: 0 1px 1px rgba(0, 0, 0, .05); - box-shadow: 0 1px 1px rgba(0, 0, 0, .05); -} -.panel-body { - padding: 15px; -} -.panel-heading { - padding: 10px 15px; - border-bottom: 1px solid transparent; - border-top-left-radius: 3px; - border-top-right-radius: 3px; -} -.panel-heading > .dropdown .dropdown-toggle { - color: inherit; -} -.panel-title { - margin-top: 0; - margin-bottom: 0; - font-size: 16px; - color: inherit; -} -.panel-title > a, -.panel-title > small, -.panel-title > .small, -.panel-title > small > a, -.panel-title > .small > a { - color: inherit; -} -.panel-footer { - padding: 10px 15px; - background-color: #f5f5f5; - border-top: 1px solid #ddd; - border-bottom-right-radius: 3px; - border-bottom-left-radius: 3px; -} -.panel > .list-group, -.panel > .panel-collapse > .list-group { - margin-bottom: 0; -} -.panel > .list-group .list-group-item, -.panel > .panel-collapse > .list-group .list-group-item { - border-width: 1px 0; - border-radius: 0; -} -.panel > .list-group:first-child .list-group-item:first-child, -.panel > .panel-collapse > .list-group:first-child .list-group-item:first-child { - border-top: 0; - border-top-left-radius: 3px; - border-top-right-radius: 3px; -} -.panel > .list-group:last-child .list-group-item:last-child, -.panel > .panel-collapse > .list-group:last-child .list-group-item:last-child { - border-bottom: 0; - border-bottom-right-radius: 3px; - border-bottom-left-radius: 3px; -} -.panel > .panel-heading + .panel-collapse > .list-group .list-group-item:first-child { - border-top-left-radius: 0; - border-top-right-radius: 0; -} -.panel-heading + .list-group .list-group-item:first-child { - border-top-width: 0; -} -.list-group + .panel-footer { - border-top-width: 0; -} -.panel > .table, -.panel > .table-responsive > .table, -.panel > .panel-collapse > .table { - margin-bottom: 0; -} -.panel > .table caption, -.panel > .table-responsive > .table caption, -.panel > .panel-collapse > .table caption { - padding-right: 15px; - padding-left: 15px; -} -.panel > .table:first-child, -.panel > .table-responsive:first-child > .table:first-child { - border-top-left-radius: 3px; - border-top-right-radius: 3px; -} -.panel > .table:first-child > thead:first-child > tr:first-child, -.panel > .table-responsive:first-child > .table:first-child > thead:first-child > tr:first-child, -.panel > .table:first-child > tbody:first-child > tr:first-child, -.panel > .table-responsive:first-child > .table:first-child > tbody:first-child > tr:first-child { - border-top-left-radius: 3px; - border-top-right-radius: 3px; -} -.panel > .table:first-child > thead:first-child > tr:first-child td:first-child, -.panel > .table-responsive:first-child > .table:first-child > thead:first-child > tr:first-child td:first-child, -.panel > .table:first-child > tbody:first-child > tr:first-child td:first-child, -.panel > .table-responsive:first-child > .table:first-child > tbody:first-child > tr:first-child td:first-child, -.panel > .table:first-child > thead:first-child > tr:first-child th:first-child, -.panel > .table-responsive:first-child > .table:first-child > thead:first-child > tr:first-child th:first-child, -.panel > .table:first-child > tbody:first-child > tr:first-child th:first-child, -.panel > .table-responsive:first-child > .table:first-child > tbody:first-child > tr:first-child th:first-child { - border-top-left-radius: 3px; -} -.panel > .table:first-child > thead:first-child > tr:first-child td:last-child, -.panel > .table-responsive:first-child > .table:first-child > thead:first-child > tr:first-child td:last-child, -.panel > .table:first-child > tbody:first-child > tr:first-child td:last-child, -.panel > .table-responsive:first-child > .table:first-child > tbody:first-child > tr:first-child td:last-child, -.panel > .table:first-child > thead:first-child > tr:first-child th:last-child, -.panel > .table-responsive:first-child > .table:first-child > thead:first-child > tr:first-child th:last-child, -.panel > .table:first-child > tbody:first-child > tr:first-child th:last-child, -.panel > .table-responsive:first-child > .table:first-child > tbody:first-child > tr:first-child th:last-child { - border-top-right-radius: 3px; -} -.panel > .table:last-child, -.panel > .table-responsive:last-child > .table:last-child { - border-bottom-right-radius: 3px; - border-bottom-left-radius: 3px; -} -.panel > .table:last-child > tbody:last-child > tr:last-child, -.panel > .table-responsive:last-child > .table:last-child > tbody:last-child > tr:last-child, -.panel > .table:last-child > tfoot:last-child > tr:last-child, -.panel > .table-responsive:last-child > .table:last-child > tfoot:last-child > tr:last-child { - border-bottom-right-radius: 3px; - border-bottom-left-radius: 3px; -} -.panel > .table:last-child > tbody:last-child > tr:last-child td:first-child, -.panel > .table-responsive:last-child > .table:last-child > tbody:last-child > tr:last-child td:first-child, -.panel > .table:last-child > tfoot:last-child > tr:last-child td:first-child, -.panel > .table-responsive:last-child > .table:last-child > tfoot:last-child > tr:last-child td:first-child, -.panel > .table:last-child > tbody:last-child > tr:last-child th:first-child, -.panel > .table-responsive:last-child > .table:last-child > tbody:last-child > tr:last-child th:first-child, -.panel > .table:last-child > tfoot:last-child > tr:last-child th:first-child, -.panel > .table-responsive:last-child > .table:last-child > tfoot:last-child > tr:last-child th:first-child { - border-bottom-left-radius: 3px; -} -.panel > .table:last-child > tbody:last-child > tr:last-child td:last-child, -.panel > .table-responsive:last-child > .table:last-child > tbody:last-child > tr:last-child td:last-child, -.panel > .table:last-child > tfoot:last-child > tr:last-child td:last-child, -.panel > .table-responsive:last-child > .table:last-child > tfoot:last-child > tr:last-child td:last-child, -.panel > .table:last-child > tbody:last-child > tr:last-child th:last-child, -.panel > .table-responsive:last-child > .table:last-child > tbody:last-child > tr:last-child th:last-child, -.panel > .table:last-child > tfoot:last-child > tr:last-child th:last-child, -.panel > .table-responsive:last-child > .table:last-child > tfoot:last-child > tr:last-child th:last-child { - border-bottom-right-radius: 3px; -} -.panel > .panel-body + .table, -.panel > .panel-body + .table-responsive, -.panel > .table + .panel-body, -.panel > .table-responsive + .panel-body { - border-top: 1px solid #ddd; -} -.panel > .table > tbody:first-child > tr:first-child th, -.panel > .table > tbody:first-child > tr:first-child td { - border-top: 0; -} -.panel > .table-bordered, -.panel > .table-responsive > .table-bordered { - border: 0; -} -.panel > .table-bordered > thead > tr > th:first-child, -.panel > .table-responsive > .table-bordered > thead > tr > th:first-child, -.panel > .table-bordered > tbody > tr > th:first-child, -.panel > .table-responsive > .table-bordered > tbody > tr > th:first-child, -.panel > .table-bordered > tfoot > tr > th:first-child, -.panel > .table-responsive > .table-bordered > tfoot > tr > th:first-child, -.panel > .table-bordered > thead > tr > td:first-child, -.panel > .table-responsive > .table-bordered > thead > tr > td:first-child, -.panel > .table-bordered > tbody > tr > td:first-child, -.panel > .table-responsive > .table-bordered > tbody > tr > td:first-child, -.panel > .table-bordered > tfoot > tr > td:first-child, -.panel > .table-responsive > .table-bordered > tfoot > tr > td:first-child { - border-left: 0; -} -.panel > .table-bordered > thead > tr > th:last-child, -.panel > .table-responsive > .table-bordered > thead > tr > th:last-child, -.panel > .table-bordered > tbody > tr > th:last-child, -.panel > .table-responsive > .table-bordered > tbody > tr > th:last-child, -.panel > .table-bordered > tfoot > tr > th:last-child, -.panel > .table-responsive > .table-bordered > tfoot > tr > th:last-child, -.panel > .table-bordered > thead > tr > td:last-child, -.panel > .table-responsive > .table-bordered > thead > tr > td:last-child, -.panel > .table-bordered > tbody > tr > td:last-child, -.panel > .table-responsive > .table-bordered > tbody > tr > td:last-child, -.panel > .table-bordered > tfoot > tr > td:last-child, -.panel > .table-responsive > .table-bordered > tfoot > tr > td:last-child { - border-right: 0; -} -.panel > .table-bordered > thead > tr:first-child > td, -.panel > .table-responsive > .table-bordered > thead > tr:first-child > td, -.panel > .table-bordered > tbody > tr:first-child > td, -.panel > .table-responsive > .table-bordered > tbody > tr:first-child > td, -.panel > .table-bordered > thead > tr:first-child > th, -.panel > .table-responsive > .table-bordered > thead > tr:first-child > th, -.panel > .table-bordered > tbody > tr:first-child > th, -.panel > .table-responsive > .table-bordered > tbody > tr:first-child > th { - border-bottom: 0; -} -.panel > .table-bordered > tbody > tr:last-child > td, -.panel > .table-responsive > .table-bordered > tbody > tr:last-child > td, -.panel > .table-bordered > tfoot > tr:last-child > td, -.panel > .table-responsive > .table-bordered > tfoot > tr:last-child > td, -.panel > .table-bordered > tbody > tr:last-child > th, -.panel > .table-responsive > .table-bordered > tbody > tr:last-child > th, -.panel > .table-bordered > tfoot > tr:last-child > th, -.panel > .table-responsive > .table-bordered > tfoot > tr:last-child > th { - border-bottom: 0; -} -.panel > .table-responsive { - margin-bottom: 0; - border: 0; -} -.panel-group { - margin-bottom: 20px; -} -.panel-group .panel { - margin-bottom: 0; - border-radius: 4px; -} -.panel-group .panel + .panel { - margin-top: 5px; -} -.panel-group .panel-heading { - border-bottom: 0; -} -.panel-group .panel-heading + .panel-collapse > .panel-body, -.panel-group .panel-heading + .panel-collapse > .list-group { - border-top: 1px solid #ddd; -} -.panel-group .panel-footer { - border-top: 0; -} -.panel-group .panel-footer + .panel-collapse .panel-body { - border-bottom: 1px solid #ddd; -} -.panel-default { - border-color: #ddd; -} -.panel-default > .panel-heading { - color: #333; - background-color: #f5f5f5; - border-color: #ddd; -} -.panel-default > .panel-heading + .panel-collapse > .panel-body { - border-top-color: #ddd; -} -.panel-default > .panel-heading .badge { - color: #f5f5f5; - background-color: #333; -} -.panel-default > .panel-footer + .panel-collapse > .panel-body { - border-bottom-color: #ddd; -} -.panel-primary { - border-color: #337ab7; -} -.panel-primary > .panel-heading { - color: #fff; - background-color: #337ab7; - border-color: #337ab7; -} -.panel-primary > .panel-heading + .panel-collapse > .panel-body { - border-top-color: #337ab7; -} -.panel-primary > .panel-heading .badge { - color: #337ab7; - background-color: #fff; -} -.panel-primary > .panel-footer + .panel-collapse > .panel-body { - border-bottom-color: #337ab7; -} -.panel-success { - border-color: #d6e9c6; -} -.panel-success > .panel-heading { - color: #3c763d; - background-color: #dff0d8; - border-color: #d6e9c6; -} -.panel-success > .panel-heading + .panel-collapse > .panel-body { - border-top-color: #d6e9c6; -} -.panel-success > .panel-heading .badge { - color: #dff0d8; - background-color: #3c763d; -} -.panel-success > .panel-footer + .panel-collapse > .panel-body { - border-bottom-color: #d6e9c6; -} -.panel-info { - border-color: #bce8f1; -} -.panel-info > .panel-heading { - color: #31708f; - background-color: #d9edf7; - border-color: #bce8f1; -} -.panel-info > .panel-heading + .panel-collapse > .panel-body { - border-top-color: #bce8f1; -} -.panel-info > .panel-heading .badge { - color: #d9edf7; - background-color: #31708f; -} -.panel-info > .panel-footer + .panel-collapse > .panel-body { - border-bottom-color: #bce8f1; -} -.panel-warning { - border-color: #faebcc; -} -.panel-warning > .panel-heading { - color: #8a6d3b; - background-color: #fcf8e3; - border-color: #faebcc; -} -.panel-warning > .panel-heading + .panel-collapse > .panel-body { - border-top-color: #faebcc; -} -.panel-warning > .panel-heading .badge { - color: #fcf8e3; - background-color: #8a6d3b; -} -.panel-warning > .panel-footer + .panel-collapse > .panel-body { - border-bottom-color: #faebcc; -} -.panel-danger { - border-color: #ebccd1; -} -.panel-danger > .panel-heading { - color: #a94442; - background-color: #f2dede; - border-color: #ebccd1; -} -.panel-danger > .panel-heading + .panel-collapse > .panel-body { - border-top-color: #ebccd1; -} -.panel-danger > .panel-heading .badge { - color: #f2dede; - background-color: #a94442; -} -.panel-danger > .panel-footer + .panel-collapse > .panel-body { - border-bottom-color: #ebccd1; -} -.embed-responsive { - position: relative; - display: block; - height: 0; - padding: 0; - overflow: hidden; -} -.embed-responsive .embed-responsive-item, -.embed-responsive iframe, -.embed-responsive embed, -.embed-responsive object, -.embed-responsive video { - position: absolute; - top: 0; - bottom: 0; - left: 0; - width: 100%; - height: 100%; - border: 0; -} -.embed-responsive-16by9 { - padding-bottom: 56.25%; -} -.embed-responsive-4by3 { - padding-bottom: 75%; -} -.well { - min-height: 20px; - padding: 19px; - margin-bottom: 20px; - background-color: #f5f5f5; - border: 1px solid #e3e3e3; - border-radius: 4px; - -webkit-box-shadow: inset 0 1px 1px rgba(0, 0, 0, .05); - box-shadow: inset 0 1px 1px rgba(0, 0, 0, .05); -} -.well blockquote { - border-color: #ddd; - border-color: rgba(0, 0, 0, .15); -} -.well-lg { - padding: 24px; - border-radius: 6px; -} -.well-sm { - padding: 9px; - border-radius: 3px; -} -.close { - float: right; - font-size: 21px; - font-weight: bold; - line-height: 1; - color: #000; - text-shadow: 0 1px 0 #fff; - filter: alpha(opacity=20); - opacity: .2; -} -.close:hover, -.close:focus { - color: #000; - text-decoration: none; - cursor: pointer; - filter: alpha(opacity=50); - opacity: .5; -} -button.close { - -webkit-appearance: none; - padding: 0; - cursor: pointer; - background: transparent; - border: 0; -} -.modal-open { - overflow: hidden; -} -.modal { - position: fixed; - top: 0; - right: 0; - bottom: 0; - left: 0; - z-index: 1050; - display: none; - overflow: hidden; - -webkit-overflow-scrolling: touch; - outline: 0; -} -.modal.fade .modal-dialog { - -webkit-transition: -webkit-transform .3s ease-out; - -o-transition: -o-transform .3s ease-out; - transition: transform .3s ease-out; - -webkit-transform: translate(0, -25%); - -ms-transform: translate(0, -25%); - -o-transform: translate(0, -25%); - transform: translate(0, -25%); -} -.modal.in .modal-dialog { - -webkit-transform: translate(0, 0); - -ms-transform: translate(0, 0); - -o-transform: translate(0, 0); - transform: translate(0, 0); -} -.modal-open .modal { - overflow-x: hidden; - overflow-y: auto; -} -.modal-dialog { - position: relative; - width: auto; - margin: 10px; -} -.modal-content { - position: relative; - background-color: #fff; - -webkit-background-clip: padding-box; - background-clip: padding-box; - border: 1px solid #999; - border: 1px solid rgba(0, 0, 0, .2); - border-radius: 6px; - outline: 0; - -webkit-box-shadow: 0 3px 9px rgba(0, 0, 0, .5); - box-shadow: 0 3px 9px rgba(0, 0, 0, .5); -} -.modal-backdrop { - position: fixed; - top: 0; - right: 0; - bottom: 0; - left: 0; - z-index: 1040; - background-color: #000; -} -.modal-backdrop.fade { - filter: alpha(opacity=0); - opacity: 0; -} -.modal-backdrop.in { - filter: alpha(opacity=50); - opacity: .5; -} -.modal-header { - min-height: 16.42857143px; - padding: 15px; - border-bottom: 1px solid #e5e5e5; -} -.modal-header .close { - margin-top: -2px; -} -.modal-title { - margin: 0; - line-height: 1.42857143; -} -.modal-body { - position: relative; - padding: 15px; -} -.modal-footer { - padding: 15px; - text-align: right; - border-top: 1px solid #e5e5e5; -} -.modal-footer .btn + .btn { - margin-bottom: 0; - margin-left: 5px; -} -.modal-footer .btn-group .btn + .btn { - margin-left: -1px; -} -.modal-footer .btn-block + .btn-block { - margin-left: 0; -} -.modal-scrollbar-measure { - position: absolute; - top: -9999px; - width: 50px; - height: 50px; - overflow: scroll; -} -@media (min-width: 768px) { - .modal-dialog { - width: 600px; - margin: 30px auto; - } - .modal-content { - -webkit-box-shadow: 0 5px 15px rgba(0, 0, 0, .5); - box-shadow: 0 5px 15px rgba(0, 0, 0, .5); - } - .modal-sm { - width: 300px; - } -} -@media (min-width: 992px) { - .modal-lg { - width: 900px; - } -} -.tooltip { - position: absolute; - z-index: 1070; - display: block; - font-family: "Helvetica Neue", Helvetica, Arial, sans-serif; - font-size: 12px; - font-style: normal; - font-weight: normal; - line-height: 1.42857143; - text-align: left; - text-align: start; - text-decoration: none; - text-shadow: none; - text-transform: none; - letter-spacing: normal; - word-break: normal; - word-spacing: normal; - word-wrap: normal; - white-space: normal; - filter: alpha(opacity=0); - opacity: 0; - - line-break: auto; -} -.tooltip.in { - filter: alpha(opacity=90); - opacity: .9; -} -.tooltip.top { - padding: 5px 0; - margin-top: -3px; -} -.tooltip.right { - padding: 0 5px; - margin-left: 3px; -} -.tooltip.bottom { - padding: 5px 0; - margin-top: 3px; -} -.tooltip.left { - padding: 0 5px; - margin-left: -3px; -} -.tooltip-inner { - max-width: 200px; - padding: 3px 8px; - color: #fff; - text-align: center; - background-color: #000; - border-radius: 4px; -} -.tooltip-arrow { - position: absolute; - width: 0; - height: 0; - border-color: transparent; - border-style: solid; -} -.tooltip.top .tooltip-arrow { - bottom: 0; - left: 50%; - margin-left: -5px; - border-width: 5px 5px 0; - border-top-color: #000; -} -.tooltip.top-left .tooltip-arrow { - right: 5px; - bottom: 0; - margin-bottom: -5px; - border-width: 5px 5px 0; - border-top-color: #000; -} -.tooltip.top-right .tooltip-arrow { - bottom: 0; - left: 5px; - margin-bottom: -5px; - border-width: 5px 5px 0; - border-top-color: #000; -} -.tooltip.right .tooltip-arrow { - top: 50%; - left: 0; - margin-top: -5px; - border-width: 5px 5px 5px 0; - border-right-color: #000; -} -.tooltip.left .tooltip-arrow { - top: 50%; - right: 0; - margin-top: -5px; - border-width: 5px 0 5px 5px; - border-left-color: #000; -} -.tooltip.bottom .tooltip-arrow { - top: 0; - left: 50%; - margin-left: -5px; - border-width: 0 5px 5px; - border-bottom-color: #000; -} -.tooltip.bottom-left .tooltip-arrow { - top: 0; - right: 5px; - margin-top: -5px; - border-width: 0 5px 5px; - border-bottom-color: #000; -} -.tooltip.bottom-right .tooltip-arrow { - top: 0; - left: 5px; - margin-top: -5px; - border-width: 0 5px 5px; - border-bottom-color: #000; -} -.popover { - position: absolute; - top: 0; - left: 0; - z-index: 1060; - display: none; - max-width: 276px; - padding: 1px; - font-family: "Helvetica Neue", Helvetica, Arial, sans-serif; - font-size: 14px; - font-style: normal; - font-weight: normal; - line-height: 1.42857143; - text-align: left; - text-align: start; - text-decoration: none; - text-shadow: none; - text-transform: none; - letter-spacing: normal; - word-break: normal; - word-spacing: normal; - word-wrap: normal; - white-space: normal; - background-color: #fff; - -webkit-background-clip: padding-box; - background-clip: padding-box; - border: 1px solid #ccc; - border: 1px solid rgba(0, 0, 0, .2); - border-radius: 6px; - -webkit-box-shadow: 0 5px 10px rgba(0, 0, 0, .2); - box-shadow: 0 5px 10px rgba(0, 0, 0, .2); - - line-break: auto; -} -.popover.top { - margin-top: -10px; -} -.popover.right { - margin-left: 10px; -} -.popover.bottom { - margin-top: 10px; -} -.popover.left { - margin-left: -10px; -} -.popover-title { - padding: 8px 14px; - margin: 0; - font-size: 14px; - background-color: #f7f7f7; - border-bottom: 1px solid #ebebeb; - border-radius: 5px 5px 0 0; -} -.popover-content { - padding: 9px 14px; -} -.popover > .arrow, -.popover > .arrow:after { - position: absolute; - display: block; - width: 0; - height: 0; - border-color: transparent; - border-style: solid; -} -.popover > .arrow { - border-width: 11px; -} -.popover > .arrow:after { - content: ""; - border-width: 10px; -} -.popover.top > .arrow { - bottom: -11px; - left: 50%; - margin-left: -11px; - border-top-color: #999; - border-top-color: rgba(0, 0, 0, .25); - border-bottom-width: 0; -} -.popover.top > .arrow:after { - bottom: 1px; - margin-left: -10px; - content: " "; - border-top-color: #fff; - border-bottom-width: 0; -} -.popover.right > .arrow { - top: 50%; - left: -11px; - margin-top: -11px; - border-right-color: #999; - border-right-color: rgba(0, 0, 0, .25); - border-left-width: 0; -} -.popover.right > .arrow:after { - bottom: -10px; - left: 1px; - content: " "; - border-right-color: #fff; - border-left-width: 0; -} -.popover.bottom > .arrow { - top: -11px; - left: 50%; - margin-left: -11px; - border-top-width: 0; - border-bottom-color: #999; - border-bottom-color: rgba(0, 0, 0, .25); -} -.popover.bottom > .arrow:after { - top: 1px; - margin-left: -10px; - content: " "; - border-top-width: 0; - border-bottom-color: #fff; -} -.popover.left > .arrow { - top: 50%; - right: -11px; - margin-top: -11px; - border-right-width: 0; - border-left-color: #999; - border-left-color: rgba(0, 0, 0, .25); -} -.popover.left > .arrow:after { - right: 1px; - bottom: -10px; - content: " "; - border-right-width: 0; - border-left-color: #fff; -} -.carousel { - position: relative; -} -.carousel-inner { - position: relative; - width: 100%; - overflow: hidden; -} -.carousel-inner > .item { - position: relative; - display: none; - -webkit-transition: .6s ease-in-out left; - -o-transition: .6s ease-in-out left; - transition: .6s ease-in-out left; -} -.carousel-inner > .item > img, -.carousel-inner > .item > a > img { - line-height: 1; -} -@media all and (transform-3d), (-webkit-transform-3d) { - .carousel-inner > .item { - -webkit-transition: -webkit-transform .6s ease-in-out; - -o-transition: -o-transform .6s ease-in-out; - transition: transform .6s ease-in-out; - - -webkit-backface-visibility: hidden; - backface-visibility: hidden; - -webkit-perspective: 1000px; - perspective: 1000px; - } - .carousel-inner > .item.next, - .carousel-inner > .item.active.right { - left: 0; - -webkit-transform: translate3d(100%, 0, 0); - transform: translate3d(100%, 0, 0); - } - .carousel-inner > .item.prev, - .carousel-inner > .item.active.left { - left: 0; - -webkit-transform: translate3d(-100%, 0, 0); - transform: translate3d(-100%, 0, 0); - } - .carousel-inner > .item.next.left, - .carousel-inner > .item.prev.right, - .carousel-inner > .item.active { - left: 0; - -webkit-transform: translate3d(0, 0, 0); - transform: translate3d(0, 0, 0); - } -} -.carousel-inner > .active, -.carousel-inner > .next, -.carousel-inner > .prev { - display: block; -} -.carousel-inner > .active { - left: 0; -} -.carousel-inner > .next, -.carousel-inner > .prev { - position: absolute; - top: 0; - width: 100%; -} -.carousel-inner > .next { - left: 100%; -} -.carousel-inner > .prev { - left: -100%; -} -.carousel-inner > .next.left, -.carousel-inner > .prev.right { - left: 0; -} -.carousel-inner > .active.left { - left: -100%; -} -.carousel-inner > .active.right { - left: 100%; -} -.carousel-control { - position: absolute; - top: 0; - bottom: 0; - left: 0; - width: 15%; - font-size: 20px; - color: #fff; - text-align: center; - text-shadow: 0 1px 2px rgba(0, 0, 0, .6); - filter: alpha(opacity=50); - opacity: .5; -} -.carousel-control.left { - background-image: -webkit-linear-gradient(left, rgba(0, 0, 0, .5) 0%, rgba(0, 0, 0, .0001) 100%); - background-image: -o-linear-gradient(left, rgba(0, 0, 0, .5) 0%, rgba(0, 0, 0, .0001) 100%); - background-image: -webkit-gradient(linear, left top, right top, from(rgba(0, 0, 0, .5)), to(rgba(0, 0, 0, .0001))); - background-image: linear-gradient(to right, rgba(0, 0, 0, .5) 0%, rgba(0, 0, 0, .0001) 100%); - filter: progid:DXImageTransform.Microsoft.gradient(startColorstr='#80000000', endColorstr='#00000000', GradientType=1); - background-repeat: repeat-x; -} -.carousel-control.right { - right: 0; - left: auto; - background-image: -webkit-linear-gradient(left, rgba(0, 0, 0, .0001) 0%, rgba(0, 0, 0, .5) 100%); - background-image: -o-linear-gradient(left, rgba(0, 0, 0, .0001) 0%, rgba(0, 0, 0, .5) 100%); - background-image: -webkit-gradient(linear, left top, right top, from(rgba(0, 0, 0, .0001)), to(rgba(0, 0, 0, .5))); - background-image: linear-gradient(to right, rgba(0, 0, 0, .0001) 0%, rgba(0, 0, 0, .5) 100%); - filter: progid:DXImageTransform.Microsoft.gradient(startColorstr='#00000000', endColorstr='#80000000', GradientType=1); - background-repeat: repeat-x; -} -.carousel-control:hover, -.carousel-control:focus { - color: #fff; - text-decoration: none; - filter: alpha(opacity=90); - outline: 0; - opacity: .9; -} -.carousel-control .icon-prev, -.carousel-control .icon-next, -.carousel-control .glyphicon-chevron-left, -.carousel-control .glyphicon-chevron-right { - position: absolute; - top: 50%; - z-index: 5; - display: inline-block; - margin-top: -10px; -} -.carousel-control .icon-prev, -.carousel-control .glyphicon-chevron-left { - left: 50%; - margin-left: -10px; -} -.carousel-control .icon-next, -.carousel-control .glyphicon-chevron-right { - right: 50%; - margin-right: -10px; -} -.carousel-control .icon-prev, -.carousel-control .icon-next { - width: 20px; - height: 20px; - font-family: serif; - line-height: 1; -} -.carousel-control .icon-prev:before { - content: '\2039'; -} -.carousel-control .icon-next:before { - content: '\203a'; -} -.carousel-indicators { - position: absolute; - bottom: 10px; - left: 50%; - z-index: 15; - width: 60%; - padding-left: 0; - margin-left: -30%; - text-align: center; - list-style: none; -} -.carousel-indicators li { - display: inline-block; - width: 10px; - height: 10px; - margin: 1px; - text-indent: -999px; - cursor: pointer; - background-color: #000 \9; - background-color: rgba(0, 0, 0, 0); - border: 1px solid #fff; - border-radius: 10px; -} -.carousel-indicators .active { - width: 12px; - height: 12px; - margin: 0; - background-color: #fff; -} -.carousel-caption { - position: absolute; - right: 15%; - bottom: 20px; - left: 15%; - z-index: 10; - padding-top: 20px; - padding-bottom: 20px; - color: #fff; - text-align: center; - text-shadow: 0 1px 2px rgba(0, 0, 0, .6); -} -.carousel-caption .btn { - text-shadow: none; -} -@media screen and (min-width: 768px) { - .carousel-control .glyphicon-chevron-left, - .carousel-control .glyphicon-chevron-right, - .carousel-control .icon-prev, - .carousel-control .icon-next { - width: 30px; - height: 30px; - margin-top: -15px; - font-size: 30px; - } - .carousel-control .glyphicon-chevron-left, - .carousel-control .icon-prev { - margin-left: -15px; - } - .carousel-control .glyphicon-chevron-right, - .carousel-control .icon-next { - margin-right: -15px; - } - .carousel-caption { - right: 20%; - left: 20%; - padding-bottom: 30px; - } - .carousel-indicators { - bottom: 20px; - } -} -.clearfix:before, -.clearfix:after, -.dl-horizontal dd:before, -.dl-horizontal dd:after, -.container:before, -.container:after, -.container-fluid:before, -.container-fluid:after, -.row:before, -.row:after, -.form-horizontal .form-group:before, -.form-horizontal .form-group:after, -.btn-toolbar:before, -.btn-toolbar:after, -.btn-group-vertical > .btn-group:before, -.btn-group-vertical > .btn-group:after, -.nav:before, -.nav:after, -.navbar:before, -.navbar:after, -.navbar-header:before, -.navbar-header:after, -.navbar-collapse:before, -.navbar-collapse:after, -.pager:before, -.pager:after, -.panel-body:before, -.panel-body:after, -.modal-footer:before, -.modal-footer:after { - display: table; - content: " "; -} -.clearfix:after, -.dl-horizontal dd:after, -.container:after, -.container-fluid:after, -.row:after, -.form-horizontal .form-group:after, -.btn-toolbar:after, -.btn-group-vertical > .btn-group:after, -.nav:after, -.navbar:after, -.navbar-header:after, -.navbar-collapse:after, -.pager:after, -.panel-body:after, -.modal-footer:after { - clear: both; -} -.center-block { - display: block; - margin-right: auto; - margin-left: auto; -} -.pull-right { - float: right !important; -} -.pull-left { - float: left !important; -} -.hide { - display: none !important; -} -.show { - display: block !important; -} -.invisible { - visibility: hidden; -} -.text-hide { - font: 0/0 a; - color: transparent; - text-shadow: none; - background-color: transparent; - border: 0; -} -.hidden { - display: none !important; -} -.affix { - position: fixed; -} -@-ms-viewport { - width: device-width; -} -.visible-xs, -.visible-sm, -.visible-md, -.visible-lg { - display: none !important; -} -.visible-xs-block, -.visible-xs-inline, -.visible-xs-inline-block, -.visible-sm-block, -.visible-sm-inline, -.visible-sm-inline-block, -.visible-md-block, -.visible-md-inline, -.visible-md-inline-block, -.visible-lg-block, -.visible-lg-inline, -.visible-lg-inline-block { - display: none !important; -} -@media (max-width: 767px) { - .visible-xs { - display: block !important; - } - table.visible-xs { - display: table !important; - } - tr.visible-xs { - display: table-row !important; - } - th.visible-xs, - td.visible-xs { - display: table-cell !important; - } -} -@media (max-width: 767px) { - .visible-xs-block { - display: block !important; - } -} -@media (max-width: 767px) { - .visible-xs-inline { - display: inline !important; - } -} -@media (max-width: 767px) { - .visible-xs-inline-block { - display: inline-block !important; - } -} -@media (min-width: 768px) and (max-width: 991px) { - .visible-sm { - display: block !important; - } - table.visible-sm { - display: table !important; - } - tr.visible-sm { - display: table-row !important; - } - th.visible-sm, - td.visible-sm { - display: table-cell !important; - } -} -@media (min-width: 768px) and (max-width: 991px) { - .visible-sm-block { - display: block !important; - } -} -@media (min-width: 768px) and (max-width: 991px) { - .visible-sm-inline { - display: inline !important; - } -} -@media (min-width: 768px) and (max-width: 991px) { - .visible-sm-inline-block { - display: inline-block !important; - } -} -@media (min-width: 992px) and (max-width: 1199px) { - .visible-md { - display: block !important; - } - table.visible-md { - display: table !important; - } - tr.visible-md { - display: table-row !important; - } - th.visible-md, - td.visible-md { - display: table-cell !important; - } -} -@media (min-width: 992px) and (max-width: 1199px) { - .visible-md-block { - display: block !important; - } -} -@media (min-width: 992px) and (max-width: 1199px) { - .visible-md-inline { - display: inline !important; - } -} -@media (min-width: 992px) and (max-width: 1199px) { - .visible-md-inline-block { - display: inline-block !important; - } -} -@media (min-width: 1200px) { - .visible-lg { - display: block !important; - } - table.visible-lg { - display: table !important; - } - tr.visible-lg { - display: table-row !important; - } - th.visible-lg, - td.visible-lg { - display: table-cell !important; - } -} -@media (min-width: 1200px) { - .visible-lg-block { - display: block !important; - } -} -@media (min-width: 1200px) { - .visible-lg-inline { - display: inline !important; - } -} -@media (min-width: 1200px) { - .visible-lg-inline-block { - display: inline-block !important; - } -} -@media (max-width: 767px) { - .hidden-xs { - display: none !important; - } -} -@media (min-width: 768px) and (max-width: 991px) { - .hidden-sm { - display: none !important; - } -} -@media (min-width: 992px) and (max-width: 1199px) { - .hidden-md { - display: none !important; - } -} -@media (min-width: 1200px) { - .hidden-lg { - display: none !important; - } -} -.visible-print { - display: none !important; -} -@media print { - .visible-print { - display: block !important; - } - table.visible-print { - display: table !important; - } - tr.visible-print { - display: table-row !important; - } - th.visible-print, - td.visible-print { - display: table-cell !important; - } -} -.visible-print-block { - display: none !important; -} -@media print { - .visible-print-block { - display: block !important; - } -} -.visible-print-inline { - display: none !important; -} -@media print { - .visible-print-inline { - display: inline !important; - } -} -.visible-print-inline-block { - display: none !important; -} -@media print { - .visible-print-inline-block { - display: inline-block !important; - } -} -@media print { - .hidden-print { - display: none !important; - } -} -/* sourceMappingURL=bootstrap.css.map */ - -/* -.pep{fill:#B3E1D1;} -.linepep{stroke:#B3E1D1;stroke-width:1px;z-index:0} - -.srmPep{fill:#B3E1F0} -.linesrmPep{stroke:#B3E1F0;stroke-width:1px;z-index:0} - -.mature{fill:#B3B3C2;} -.linemature{stroke:#B3B3C2;stroke-width:1px;} - -.signal{fill:#B3B3E1;} -.linesignal{stroke:#B3B3E1;stroke-width:1px;} - -.pro{fill:#B3B3B3;} -.linepro{stroke:#B3B3B3;stroke-width:1px;} - -.antiB{fill:#B3C2F0;} -.lineantiB{stroke:#B3C2F0;stroke-width:1px;} - -.initMeth{fill:#B3B3D1;} -.lineinitMeth{stroke:#B3B3D1;stroke-width:1px;z-index:0} - -.modifRes{fill:#B3C2B3;} -.linemodifRes{stroke:#B3C2B3;stroke-width:1px;z-index:0} - -.crossLink{fill:#B3C2C2;} -.linecrossLink{stroke:#B3C2C2;stroke-width:1px;} - -.glycoSite{fill:#B3C2D1;} -.lineglycoSite{stroke:#B3C2D1;stroke-width:1px;} -*/ -.variant{ - stroke:rgba(0,255,154,0.6); - stroke-width:1px; -} - -a:focus { - outline:0 !important; -} - -.active { - z-index: 1; -} -.brush .extent{ - stroke: #fff; - fill-opacity: .125; - shape-rendering: crispEdges; -} - - -.point { - fill: #2f225d; - stroke: #afa2dc; -} - -.selected { - fill: #afa2dc; - stroke: #2f225d; -} - -.clear-button { - font: 14px sans-serif; - cursor: pointer; -} - -.axis path, -.axis line { - fill: none; - stroke: #000; - shape-rendering: crispEdges; -} - -.axis { - font: 10px sans-serif; -} -.d3-tip { - line-height: 1; - font-weight: bold; - padding: 12px; - background: rgba(0, 0, 0, 0.8); - color: #fff; - border-radius: 2px; -} - -/*Creates a small triangle extender for the tooltip */ -.tooltip2:after { - box-sizing: border-box; - display: inline; - font-size: 10px; - width: 100%; - line-height: 1; - color: rgba(0, 0, 0, 0.8); - content: "\25BC"; - position: absolute; - text-align: left; - margin: -1px 0 0 0; - top: 98%; - left: 10px; -} -.tooltip3:after { - box-sizing: border-box; - display: inline; - font-size: 10px; - width: 100%; - line-height: 1; - color: rgba(0, 0, 0, 0.8); - content: "\25BC"; - position: absolute; - text-align: right; - margin: -1px 0 0 0; - top: 98%; - right: 10px; -} -.yaxis{ - background-color:green; -} -.header-help{ - color: #C50063; -} -.header-help:hover{ - color: #98004C; - cursor: pointer; - text-decoration: none; -} -.header-help:focus{ - color: #98004C; -} -.popover-title{ - text-align: center; - background-color: rgba(197, 0, 99, 0.1); -} -.label-as-badge { - border-radius: 1em; - font-size:0.7em; - background-color: #C50063; -} -path{ - fill:none; -} \ No newline at end of file diff --git a/build/viewer.js b/build/viewer.js deleted file mode 100644 index 11c84b6..0000000 --- a/build/viewer.js +++ /dev/null @@ -1,23278 +0,0 @@ -require=(function e(t,n,r){function s(o,u){if(!n[o]){if(!t[o]){var a=typeof require=="function"&&require;if(!u&&a)return a(o,!0);if(i)return i(o,!0);var f=new Error("Cannot find module '"+o+"'");throw f.code="MODULE_NOT_FOUND",f}var l=n[o]={exports:{}};t[o][0].call(l.exports,function(e){var n=t[o][1][e];return s(n?n:e)},l,l.exports,e,t,n,r)}return n[o].exports}var i=typeof require=="function"&&require;for(var o=0;o

' - }) - - - // NOTE: POPOVER EXTENDS tooltip.js - // ================================ - - Popover.prototype = $.extend({}, $.fn.tooltip.Constructor.prototype) - - Popover.prototype.constructor = Popover - - Popover.prototype.getDefaults = function () { - return Popover.DEFAULTS - } - - Popover.prototype.setContent = function () { - var $tip = this.tip() - var title = this.getTitle() - var content = this.getContent() - - $tip.find('.popover-title')[this.options.html ? 'html' : 'text'](title) - $tip.find('.popover-content').children().detach().end()[ // we use append for html objects to maintain js events - this.options.html ? (typeof content == 'string' ? 'html' : 'append') : 'text' - ](content) - - $tip.removeClass('fade top bottom left right in') - - // IE8 doesn't accept hiding via the `:empty` pseudo selector, we have to do - // this manually by checking the contents. - if (!$tip.find('.popover-title').html()) $tip.find('.popover-title').hide() - } - - Popover.prototype.hasContent = function () { - return this.getTitle() || this.getContent() - } - - Popover.prototype.getContent = function () { - var $e = this.$element - var o = this.options - - return $e.attr('data-content') - || (typeof o.content == 'function' ? - o.content.call($e[0]) : - o.content) - } - - Popover.prototype.arrow = function () { - return (this.$arrow = this.$arrow || this.tip().find('.arrow')) - } - - - // POPOVER PLUGIN DEFINITION - // ========================= - - function Plugin(option) { - return this.each(function () { - var $this = $(this) - var data = $this.data('bs.popover') - var options = typeof option == 'object' && option - - if (!data && /destroy|hide/.test(option)) return - if (!data) $this.data('bs.popover', (data = new Popover(this, options))) - if (typeof option == 'string') data[option]() - }) - } - - var old = $.fn.popover - - $.fn.popover = Plugin - $.fn.popover.Constructor = Popover - - - // POPOVER NO CONFLICT - // =================== - - $.fn.popover.noConflict = function () { - $.fn.popover = old - return this - } - -}(jQuery); - -},{}],5:[function(require,module,exports){ -/* ======================================================================== - * Bootstrap: tooltip.js v3.3.7 - * http://getbootstrap.com/javascript/#tooltip - * Inspired by the original jQuery.tipsy by Jason Frame - * ======================================================================== - * Copyright 2011-2016 Twitter, Inc. - * Licensed under MIT (https://github.com/twbs/bootstrap/blob/master/LICENSE) - * ======================================================================== */ - - -+function ($) { - 'use strict'; - - // TOOLTIP PUBLIC CLASS DEFINITION - // =============================== - - var Tooltip = function (element, options) { - this.type = null - this.options = null - this.enabled = null - this.timeout = null - this.hoverState = null - this.$element = null - this.inState = null - - this.init('tooltip', element, options) - } - - Tooltip.VERSION = '3.3.7' - - Tooltip.TRANSITION_DURATION = 150 - - Tooltip.DEFAULTS = { - animation: true, - placement: 'top', - selector: false, - template: '', - trigger: 'hover focus', - title: '', - delay: 0, - html: false, - container: false, - viewport: { - selector: 'body', - padding: 0 - } - } - - Tooltip.prototype.init = function (type, element, options) { - this.enabled = true - this.type = type - this.$element = $(element) - this.options = this.getOptions(options) - this.$viewport = this.options.viewport && $($.isFunction(this.options.viewport) ? this.options.viewport.call(this, this.$element) : (this.options.viewport.selector || this.options.viewport)) - this.inState = { click: false, hover: false, focus: false } - - if (this.$element[0] instanceof document.constructor && !this.options.selector) { - throw new Error('`selector` option must be specified when initializing ' + this.type + ' on the window.document object!') - } - - var triggers = this.options.trigger.split(' ') - - for (var i = triggers.length; i--;) { - var trigger = triggers[i] - - if (trigger == 'click') { - this.$element.on('click.' + this.type, this.options.selector, $.proxy(this.toggle, this)) - } else if (trigger != 'manual') { - var eventIn = trigger == 'hover' ? 'mouseenter' : 'focusin' - var eventOut = trigger == 'hover' ? 'mouseleave' : 'focusout' - - this.$element.on(eventIn + '.' + this.type, this.options.selector, $.proxy(this.enter, this)) - this.$element.on(eventOut + '.' + this.type, this.options.selector, $.proxy(this.leave, this)) - } - } - - this.options.selector ? - (this._options = $.extend({}, this.options, { trigger: 'manual', selector: '' })) : - this.fixTitle() - } - - Tooltip.prototype.getDefaults = function () { - return Tooltip.DEFAULTS - } - - Tooltip.prototype.getOptions = function (options) { - options = $.extend({}, this.getDefaults(), this.$element.data(), options) - - if (options.delay && typeof options.delay == 'number') { - options.delay = { - show: options.delay, - hide: options.delay - } - } - - return options - } - - Tooltip.prototype.getDelegateOptions = function () { - var options = {} - var defaults = this.getDefaults() - - this._options && $.each(this._options, function (key, value) { - if (defaults[key] != value) options[key] = value - }) - - return options - } - - Tooltip.prototype.enter = function (obj) { - var self = obj instanceof this.constructor ? - obj : $(obj.currentTarget).data('bs.' + this.type) - - if (!self) { - self = new this.constructor(obj.currentTarget, this.getDelegateOptions()) - $(obj.currentTarget).data('bs.' + this.type, self) - } - - if (obj instanceof $.Event) { - self.inState[obj.type == 'focusin' ? 'focus' : 'hover'] = true - } - - if (self.tip().hasClass('in') || self.hoverState == 'in') { - self.hoverState = 'in' - return - } - - clearTimeout(self.timeout) - - self.hoverState = 'in' - - if (!self.options.delay || !self.options.delay.show) return self.show() - - self.timeout = setTimeout(function () { - if (self.hoverState == 'in') self.show() - }, self.options.delay.show) - } - - Tooltip.prototype.isInStateTrue = function () { - for (var key in this.inState) { - if (this.inState[key]) return true - } - - return false - } - - Tooltip.prototype.leave = function (obj) { - var self = obj instanceof this.constructor ? - obj : $(obj.currentTarget).data('bs.' + this.type) - - if (!self) { - self = new this.constructor(obj.currentTarget, this.getDelegateOptions()) - $(obj.currentTarget).data('bs.' + this.type, self) - } - - if (obj instanceof $.Event) { - self.inState[obj.type == 'focusout' ? 'focus' : 'hover'] = false - } - - if (self.isInStateTrue()) return - - clearTimeout(self.timeout) - - self.hoverState = 'out' - - if (!self.options.delay || !self.options.delay.hide) return self.hide() - - self.timeout = setTimeout(function () { - if (self.hoverState == 'out') self.hide() - }, self.options.delay.hide) - } - - Tooltip.prototype.show = function () { - var e = $.Event('show.bs.' + this.type) - - if (this.hasContent() && this.enabled) { - this.$element.trigger(e) - - var inDom = $.contains(this.$element[0].ownerDocument.documentElement, this.$element[0]) - if (e.isDefaultPrevented() || !inDom) return - var that = this - - var $tip = this.tip() - - var tipId = this.getUID(this.type) - - this.setContent() - $tip.attr('id', tipId) - this.$element.attr('aria-describedby', tipId) - - if (this.options.animation) $tip.addClass('fade') - - var placement = typeof this.options.placement == 'function' ? - this.options.placement.call(this, $tip[0], this.$element[0]) : - this.options.placement - - var autoToken = /\s?auto?\s?/i - var autoPlace = autoToken.test(placement) - if (autoPlace) placement = placement.replace(autoToken, '') || 'top' - - $tip - .detach() - .css({ top: 0, left: 0, display: 'block' }) - .addClass(placement) - .data('bs.' + this.type, this) - - this.options.container ? $tip.appendTo(this.options.container) : $tip.insertAfter(this.$element) - this.$element.trigger('inserted.bs.' + this.type) - - var pos = this.getPosition() - var actualWidth = $tip[0].offsetWidth - var actualHeight = $tip[0].offsetHeight - - if (autoPlace) { - var orgPlacement = placement - var viewportDim = this.getPosition(this.$viewport) - - placement = placement == 'bottom' && pos.bottom + actualHeight > viewportDim.bottom ? 'top' : - placement == 'top' && pos.top - actualHeight < viewportDim.top ? 'bottom' : - placement == 'right' && pos.right + actualWidth > viewportDim.width ? 'left' : - placement == 'left' && pos.left - actualWidth < viewportDim.left ? 'right' : - placement - - $tip - .removeClass(orgPlacement) - .addClass(placement) - } - - var calculatedOffset = this.getCalculatedOffset(placement, pos, actualWidth, actualHeight) - - this.applyPlacement(calculatedOffset, placement) - - var complete = function () { - var prevHoverState = that.hoverState - that.$element.trigger('shown.bs.' + that.type) - that.hoverState = null - - if (prevHoverState == 'out') that.leave(that) - } - - $.support.transition && this.$tip.hasClass('fade') ? - $tip - .one('bsTransitionEnd', complete) - .emulateTransitionEnd(Tooltip.TRANSITION_DURATION) : - complete() - } - } - - Tooltip.prototype.applyPlacement = function (offset, placement) { - var $tip = this.tip() - var width = $tip[0].offsetWidth - var height = $tip[0].offsetHeight - - // manually read margins because getBoundingClientRect includes difference - var marginTop = parseInt($tip.css('margin-top'), 10) - var marginLeft = parseInt($tip.css('margin-left'), 10) - - // we must check for NaN for ie 8/9 - if (isNaN(marginTop)) marginTop = 0 - if (isNaN(marginLeft)) marginLeft = 0 - - offset.top += marginTop - offset.left += marginLeft - - // $.fn.offset doesn't round pixel values - // so we use setOffset directly with our own function B-0 - $.offset.setOffset($tip[0], $.extend({ - using: function (props) { - $tip.css({ - top: Math.round(props.top), - left: Math.round(props.left) - }) - } - }, offset), 0) - - $tip.addClass('in') - - // check to see if placing tip in new offset caused the tip to resize itself - var actualWidth = $tip[0].offsetWidth - var actualHeight = $tip[0].offsetHeight - - if (placement == 'top' && actualHeight != height) { - offset.top = offset.top + height - actualHeight - } - - var delta = this.getViewportAdjustedDelta(placement, offset, actualWidth, actualHeight) - - if (delta.left) offset.left += delta.left - else offset.top += delta.top - - var isVertical = /top|bottom/.test(placement) - var arrowDelta = isVertical ? delta.left * 2 - width + actualWidth : delta.top * 2 - height + actualHeight - var arrowOffsetPosition = isVertical ? 'offsetWidth' : 'offsetHeight' - - $tip.offset(offset) - this.replaceArrow(arrowDelta, $tip[0][arrowOffsetPosition], isVertical) - } - - Tooltip.prototype.replaceArrow = function (delta, dimension, isVertical) { - this.arrow() - .css(isVertical ? 'left' : 'top', 50 * (1 - delta / dimension) + '%') - .css(isVertical ? 'top' : 'left', '') - } - - Tooltip.prototype.setContent = function () { - var $tip = this.tip() - var title = this.getTitle() - - $tip.find('.tooltip-inner')[this.options.html ? 'html' : 'text'](title) - $tip.removeClass('fade in top bottom left right') - } - - Tooltip.prototype.hide = function (callback) { - var that = this - var $tip = $(this.$tip) - var e = $.Event('hide.bs.' + this.type) - - function complete() { - if (that.hoverState != 'in') $tip.detach() - if (that.$element) { // TODO: Check whether guarding this code with this `if` is really necessary. - that.$element - .removeAttr('aria-describedby') - .trigger('hidden.bs.' + that.type) - } - callback && callback() - } - - this.$element.trigger(e) - - if (e.isDefaultPrevented()) return - - $tip.removeClass('in') - - $.support.transition && $tip.hasClass('fade') ? - $tip - .one('bsTransitionEnd', complete) - .emulateTransitionEnd(Tooltip.TRANSITION_DURATION) : - complete() - - this.hoverState = null - - return this - } - - Tooltip.prototype.fixTitle = function () { - var $e = this.$element - if ($e.attr('title') || typeof $e.attr('data-original-title') != 'string') { - $e.attr('data-original-title', $e.attr('title') || '').attr('title', '') - } - } - - Tooltip.prototype.hasContent = function () { - return this.getTitle() - } - - Tooltip.prototype.getPosition = function ($element) { - $element = $element || this.$element - - var el = $element[0] - var isBody = el.tagName == 'BODY' - - var elRect = el.getBoundingClientRect() - if (elRect.width == null) { - // width and height are missing in IE8, so compute them manually; see https://github.com/twbs/bootstrap/issues/14093 - elRect = $.extend({}, elRect, { width: elRect.right - elRect.left, height: elRect.bottom - elRect.top }) - } - var isSvg = window.SVGElement && el instanceof window.SVGElement - // Avoid using $.offset() on SVGs since it gives incorrect results in jQuery 3. - // See https://github.com/twbs/bootstrap/issues/20280 - var elOffset = isBody ? { top: 0, left: 0 } : (isSvg ? null : $element.offset()) - var scroll = { scroll: isBody ? document.documentElement.scrollTop || document.body.scrollTop : $element.scrollTop() } - var outerDims = isBody ? { width: $(window).width(), height: $(window).height() } : null - - return $.extend({}, elRect, scroll, outerDims, elOffset) - } - - Tooltip.prototype.getCalculatedOffset = function (placement, pos, actualWidth, actualHeight) { - return placement == 'bottom' ? { top: pos.top + pos.height, left: pos.left + pos.width / 2 - actualWidth / 2 } : - placement == 'top' ? { top: pos.top - actualHeight, left: pos.left + pos.width / 2 - actualWidth / 2 } : - placement == 'left' ? { top: pos.top + pos.height / 2 - actualHeight / 2, left: pos.left - actualWidth } : - /* placement == 'right' */ { top: pos.top + pos.height / 2 - actualHeight / 2, left: pos.left + pos.width } - - } - - Tooltip.prototype.getViewportAdjustedDelta = function (placement, pos, actualWidth, actualHeight) { - var delta = { top: 0, left: 0 } - if (!this.$viewport) return delta - - var viewportPadding = this.options.viewport && this.options.viewport.padding || 0 - var viewportDimensions = this.getPosition(this.$viewport) - - if (/right|left/.test(placement)) { - var topEdgeOffset = pos.top - viewportPadding - viewportDimensions.scroll - var bottomEdgeOffset = pos.top + viewportPadding - viewportDimensions.scroll + actualHeight - if (topEdgeOffset < viewportDimensions.top) { // top overflow - delta.top = viewportDimensions.top - topEdgeOffset - } else if (bottomEdgeOffset > viewportDimensions.top + viewportDimensions.height) { // bottom overflow - delta.top = viewportDimensions.top + viewportDimensions.height - bottomEdgeOffset - } - } else { - var leftEdgeOffset = pos.left - viewportPadding - var rightEdgeOffset = pos.left + viewportPadding + actualWidth - if (leftEdgeOffset < viewportDimensions.left) { // left overflow - delta.left = viewportDimensions.left - leftEdgeOffset - } else if (rightEdgeOffset > viewportDimensions.right) { // right overflow - delta.left = viewportDimensions.left + viewportDimensions.width - rightEdgeOffset - } - } - - return delta - } - - Tooltip.prototype.getTitle = function () { - var title - var $e = this.$element - var o = this.options - - title = $e.attr('data-original-title') - || (typeof o.title == 'function' ? o.title.call($e[0]) : o.title) - - return title - } - - Tooltip.prototype.getUID = function (prefix) { - do prefix += ~~(Math.random() * 1000000) - while (document.getElementById(prefix)) - return prefix - } - - Tooltip.prototype.tip = function () { - if (!this.$tip) { - this.$tip = $(this.options.template) - if (this.$tip.length != 1) { - throw new Error(this.type + ' `template` option must consist of exactly 1 top-level element!') - } - } - return this.$tip - } - - Tooltip.prototype.arrow = function () { - return (this.$arrow = this.$arrow || this.tip().find('.tooltip-arrow')) - } - - Tooltip.prototype.enable = function () { - this.enabled = true - } - - Tooltip.prototype.disable = function () { - this.enabled = false - } - - Tooltip.prototype.toggleEnabled = function () { - this.enabled = !this.enabled - } - - Tooltip.prototype.toggle = function (e) { - var self = this - if (e) { - self = $(e.currentTarget).data('bs.' + this.type) - if (!self) { - self = new this.constructor(e.currentTarget, this.getDelegateOptions()) - $(e.currentTarget).data('bs.' + this.type, self) - } - } - - if (e) { - self.inState.click = !self.inState.click - if (self.isInStateTrue()) self.enter(self) - else self.leave(self) - } else { - self.tip().hasClass('in') ? self.leave(self) : self.enter(self) - } - } - - Tooltip.prototype.destroy = function () { - var that = this - clearTimeout(this.timeout) - this.hide(function () { - that.$element.off('.' + that.type).removeData('bs.' + that.type) - if (that.$tip) { - that.$tip.detach() - } - that.$tip = null - that.$arrow = null - that.$viewport = null - that.$element = null - }) - } - - - // TOOLTIP PLUGIN DEFINITION - // ========================= - - function Plugin(option) { - return this.each(function () { - var $this = $(this) - var data = $this.data('bs.tooltip') - var options = typeof option == 'object' && option - - if (!data && /destroy|hide/.test(option)) return - if (!data) $this.data('bs.tooltip', (data = new Tooltip(this, options))) - if (typeof option == 'string') data[option]() - }) - } - - var old = $.fn.tooltip - - $.fn.tooltip = Plugin - $.fn.tooltip.Constructor = Tooltip - - - // TOOLTIP NO CONFLICT - // =================== - - $.fn.tooltip.noConflict = function () { - $.fn.tooltip = old - return this - } - -}(jQuery); - -},{}],6:[function(require,module,exports){ -!function() { - var d3 = { - version: "3.5.6" - }; - var d3_arraySlice = [].slice, d3_array = function(list) { - return d3_arraySlice.call(list); - }; - var d3_document = this.document; - function d3_documentElement(node) { - return node && (node.ownerDocument || node.document || node).documentElement; - } - function d3_window(node) { - return node && (node.ownerDocument && node.ownerDocument.defaultView || node.document && node || node.defaultView); - } - if (d3_document) { - try { - d3_array(d3_document.documentElement.childNodes)[0].nodeType; - } catch (e) { - d3_array = function(list) { - var i = list.length, array = new Array(i); - while (i--) array[i] = list[i]; - return array; - }; - } - } - if (!Date.now) Date.now = function() { - return +new Date(); - }; - if (d3_document) { - try { - d3_document.createElement("DIV").style.setProperty("opacity", 0, ""); - } catch (error) { - var d3_element_prototype = this.Element.prototype, d3_element_setAttribute = d3_element_prototype.setAttribute, d3_element_setAttributeNS = d3_element_prototype.setAttributeNS, d3_style_prototype = this.CSSStyleDeclaration.prototype, d3_style_setProperty = d3_style_prototype.setProperty; - d3_element_prototype.setAttribute = function(name, value) { - d3_element_setAttribute.call(this, name, value + ""); - }; - d3_element_prototype.setAttributeNS = function(space, local, value) { - d3_element_setAttributeNS.call(this, space, local, value + ""); - }; - d3_style_prototype.setProperty = function(name, value, priority) { - d3_style_setProperty.call(this, name, value + "", priority); - }; - } - } - d3.ascending = d3_ascending; - function d3_ascending(a, b) { - return a < b ? -1 : a > b ? 1 : a >= b ? 0 : NaN; - } - d3.descending = function(a, b) { - return b < a ? -1 : b > a ? 1 : b >= a ? 0 : NaN; - }; - d3.min = function(array, f) { - var i = -1, n = array.length, a, b; - if (arguments.length === 1) { - while (++i < n) if ((b = array[i]) != null && b >= b) { - a = b; - break; - } - while (++i < n) if ((b = array[i]) != null && a > b) a = b; - } else { - while (++i < n) if ((b = f.call(array, array[i], i)) != null && b >= b) { - a = b; - break; - } - while (++i < n) if ((b = f.call(array, array[i], i)) != null && a > b) a = b; - } - return a; - }; - d3.max = function(array, f) { - var i = -1, n = array.length, a, b; - if (arguments.length === 1) { - while (++i < n) if ((b = array[i]) != null && b >= b) { - a = b; - break; - } - while (++i < n) if ((b = array[i]) != null && b > a) a = b; - } else { - while (++i < n) if ((b = f.call(array, array[i], i)) != null && b >= b) { - a = b; - break; - } - while (++i < n) if ((b = f.call(array, array[i], i)) != null && b > a) a = b; - } - return a; - }; - d3.extent = function(array, f) { - var i = -1, n = array.length, a, b, c; - if (arguments.length === 1) { - while (++i < n) if ((b = array[i]) != null && b >= b) { - a = c = b; - break; - } - while (++i < n) if ((b = array[i]) != null) { - if (a > b) a = b; - if (c < b) c = b; - } - } else { - while (++i < n) if ((b = f.call(array, array[i], i)) != null && b >= b) { - a = c = b; - break; - } - while (++i < n) if ((b = f.call(array, array[i], i)) != null) { - if (a > b) a = b; - if (c < b) c = b; - } - } - return [ a, c ]; - }; - function d3_number(x) { - return x === null ? NaN : +x; - } - function d3_numeric(x) { - return !isNaN(x); - } - d3.sum = function(array, f) { - var s = 0, n = array.length, a, i = -1; - if (arguments.length === 1) { - while (++i < n) if (d3_numeric(a = +array[i])) s += a; - } else { - while (++i < n) if (d3_numeric(a = +f.call(array, array[i], i))) s += a; - } - return s; - }; - d3.mean = function(array, f) { - var s = 0, n = array.length, a, i = -1, j = n; - if (arguments.length === 1) { - while (++i < n) if (d3_numeric(a = d3_number(array[i]))) s += a; else --j; - } else { - while (++i < n) if (d3_numeric(a = d3_number(f.call(array, array[i], i)))) s += a; else --j; - } - if (j) return s / j; - }; - d3.quantile = function(values, p) { - var H = (values.length - 1) * p + 1, h = Math.floor(H), v = +values[h - 1], e = H - h; - return e ? v + e * (values[h] - v) : v; - }; - d3.median = function(array, f) { - var numbers = [], n = array.length, a, i = -1; - if (arguments.length === 1) { - while (++i < n) if (d3_numeric(a = d3_number(array[i]))) numbers.push(a); - } else { - while (++i < n) if (d3_numeric(a = d3_number(f.call(array, array[i], i)))) numbers.push(a); - } - if (numbers.length) return d3.quantile(numbers.sort(d3_ascending), .5); - }; - d3.variance = function(array, f) { - var n = array.length, m = 0, a, d, s = 0, i = -1, j = 0; - if (arguments.length === 1) { - while (++i < n) { - if (d3_numeric(a = d3_number(array[i]))) { - d = a - m; - m += d / ++j; - s += d * (a - m); - } - } - } else { - while (++i < n) { - if (d3_numeric(a = d3_number(f.call(array, array[i], i)))) { - d = a - m; - m += d / ++j; - s += d * (a - m); - } - } - } - if (j > 1) return s / (j - 1); - }; - d3.deviation = function() { - var v = d3.variance.apply(this, arguments); - return v ? Math.sqrt(v) : v; - }; - function d3_bisector(compare) { - return { - left: function(a, x, lo, hi) { - if (arguments.length < 3) lo = 0; - if (arguments.length < 4) hi = a.length; - while (lo < hi) { - var mid = lo + hi >>> 1; - if (compare(a[mid], x) < 0) lo = mid + 1; else hi = mid; - } - return lo; - }, - right: function(a, x, lo, hi) { - if (arguments.length < 3) lo = 0; - if (arguments.length < 4) hi = a.length; - while (lo < hi) { - var mid = lo + hi >>> 1; - if (compare(a[mid], x) > 0) hi = mid; else lo = mid + 1; - } - return lo; - } - }; - } - var d3_bisect = d3_bisector(d3_ascending); - d3.bisectLeft = d3_bisect.left; - d3.bisect = d3.bisectRight = d3_bisect.right; - d3.bisector = function(f) { - return d3_bisector(f.length === 1 ? function(d, x) { - return d3_ascending(f(d), x); - } : f); - }; - d3.shuffle = function(array, i0, i1) { - if ((m = arguments.length) < 3) { - i1 = array.length; - if (m < 2) i0 = 0; - } - var m = i1 - i0, t, i; - while (m) { - i = Math.random() * m-- | 0; - t = array[m + i0], array[m + i0] = array[i + i0], array[i + i0] = t; - } - return array; - }; - d3.permute = function(array, indexes) { - var i = indexes.length, permutes = new Array(i); - while (i--) permutes[i] = array[indexes[i]]; - return permutes; - }; - d3.pairs = function(array) { - var i = 0, n = array.length - 1, p0, p1 = array[0], pairs = new Array(n < 0 ? 0 : n); - while (i < n) pairs[i] = [ p0 = p1, p1 = array[++i] ]; - return pairs; - }; - d3.zip = function() { - if (!(n = arguments.length)) return []; - for (var i = -1, m = d3.min(arguments, d3_zipLength), zips = new Array(m); ++i < m; ) { - for (var j = -1, n, zip = zips[i] = new Array(n); ++j < n; ) { - zip[j] = arguments[j][i]; - } - } - return zips; - }; - function d3_zipLength(d) { - return d.length; - } - d3.transpose = function(matrix) { - return d3.zip.apply(d3, matrix); - }; - d3.keys = function(map) { - var keys = []; - for (var key in map) keys.push(key); - return keys; - }; - d3.values = function(map) { - var values = []; - for (var key in map) values.push(map[key]); - return values; - }; - d3.entries = function(map) { - var entries = []; - for (var key in map) entries.push({ - key: key, - value: map[key] - }); - return entries; - }; - d3.merge = function(arrays) { - var n = arrays.length, m, i = -1, j = 0, merged, array; - while (++i < n) j += arrays[i].length; - merged = new Array(j); - while (--n >= 0) { - array = arrays[n]; - m = array.length; - while (--m >= 0) { - merged[--j] = array[m]; - } - } - return merged; - }; - var abs = Math.abs; - d3.range = function(start, stop, step) { - if (arguments.length < 3) { - step = 1; - if (arguments.length < 2) { - stop = start; - start = 0; - } - } - if ((stop - start) / step === Infinity) throw new Error("infinite range"); - var range = [], k = d3_range_integerScale(abs(step)), i = -1, j; - start *= k, stop *= k, step *= k; - if (step < 0) while ((j = start + step * ++i) > stop) range.push(j / k); else while ((j = start + step * ++i) < stop) range.push(j / k); - return range; - }; - function d3_range_integerScale(x) { - var k = 1; - while (x * k % 1) k *= 10; - return k; - } - function d3_class(ctor, properties) { - for (var key in properties) { - Object.defineProperty(ctor.prototype, key, { - value: properties[key], - enumerable: false - }); - } - } - d3.map = function(object, f) { - var map = new d3_Map(); - if (object instanceof d3_Map) { - object.forEach(function(key, value) { - map.set(key, value); - }); - } else if (Array.isArray(object)) { - var i = -1, n = object.length, o; - if (arguments.length === 1) while (++i < n) map.set(i, object[i]); else while (++i < n) map.set(f.call(object, o = object[i], i), o); - } else { - for (var key in object) map.set(key, object[key]); - } - return map; - }; - function d3_Map() { - this._ = Object.create(null); - } - var d3_map_proto = "__proto__", d3_map_zero = "\x00"; - d3_class(d3_Map, { - has: d3_map_has, - get: function(key) { - return this._[d3_map_escape(key)]; - }, - set: function(key, value) { - return this._[d3_map_escape(key)] = value; - }, - remove: d3_map_remove, - keys: d3_map_keys, - values: function() { - var values = []; - for (var key in this._) values.push(this._[key]); - return values; - }, - entries: function() { - var entries = []; - for (var key in this._) entries.push({ - key: d3_map_unescape(key), - value: this._[key] - }); - return entries; - }, - size: d3_map_size, - empty: d3_map_empty, - forEach: function(f) { - for (var key in this._) f.call(this, d3_map_unescape(key), this._[key]); - } - }); - function d3_map_escape(key) { - return (key += "") === d3_map_proto || key[0] === d3_map_zero ? d3_map_zero + key : key; - } - function d3_map_unescape(key) { - return (key += "")[0] === d3_map_zero ? key.slice(1) : key; - } - function d3_map_has(key) { - return d3_map_escape(key) in this._; - } - function d3_map_remove(key) { - return (key = d3_map_escape(key)) in this._ && delete this._[key]; - } - function d3_map_keys() { - var keys = []; - for (var key in this._) keys.push(d3_map_unescape(key)); - return keys; - } - function d3_map_size() { - var size = 0; - for (var key in this._) ++size; - return size; - } - function d3_map_empty() { - for (var key in this._) return false; - return true; - } - d3.nest = function() { - var nest = {}, keys = [], sortKeys = [], sortValues, rollup; - function map(mapType, array, depth) { - if (depth >= keys.length) return rollup ? rollup.call(nest, array) : sortValues ? array.sort(sortValues) : array; - var i = -1, n = array.length, key = keys[depth++], keyValue, object, setter, valuesByKey = new d3_Map(), values; - while (++i < n) { - if (values = valuesByKey.get(keyValue = key(object = array[i]))) { - values.push(object); - } else { - valuesByKey.set(keyValue, [ object ]); - } - } - if (mapType) { - object = mapType(); - setter = function(keyValue, values) { - object.set(keyValue, map(mapType, values, depth)); - }; - } else { - object = {}; - setter = function(keyValue, values) { - object[keyValue] = map(mapType, values, depth); - }; - } - valuesByKey.forEach(setter); - return object; - } - function entries(map, depth) { - if (depth >= keys.length) return map; - var array = [], sortKey = sortKeys[depth++]; - map.forEach(function(key, keyMap) { - array.push({ - key: key, - values: entries(keyMap, depth) - }); - }); - return sortKey ? array.sort(function(a, b) { - return sortKey(a.key, b.key); - }) : array; - } - nest.map = function(array, mapType) { - return map(mapType, array, 0); - }; - nest.entries = function(array) { - return entries(map(d3.map, array, 0), 0); - }; - nest.key = function(d) { - keys.push(d); - return nest; - }; - nest.sortKeys = function(order) { - sortKeys[keys.length - 1] = order; - return nest; - }; - nest.sortValues = function(order) { - sortValues = order; - return nest; - }; - nest.rollup = function(f) { - rollup = f; - return nest; - }; - return nest; - }; - d3.set = function(array) { - var set = new d3_Set(); - if (array) for (var i = 0, n = array.length; i < n; ++i) set.add(array[i]); - return set; - }; - function d3_Set() { - this._ = Object.create(null); - } - d3_class(d3_Set, { - has: d3_map_has, - add: function(key) { - this._[d3_map_escape(key += "")] = true; - return key; - }, - remove: d3_map_remove, - values: d3_map_keys, - size: d3_map_size, - empty: d3_map_empty, - forEach: function(f) { - for (var key in this._) f.call(this, d3_map_unescape(key)); - } - }); - d3.behavior = {}; - function d3_identity(d) { - return d; - } - d3.rebind = function(target, source) { - var i = 1, n = arguments.length, method; - while (++i < n) target[method = arguments[i]] = d3_rebind(target, source, source[method]); - return target; - }; - function d3_rebind(target, source, method) { - return function() { - var value = method.apply(source, arguments); - return value === source ? target : value; - }; - } - function d3_vendorSymbol(object, name) { - if (name in object) return name; - name = name.charAt(0).toUpperCase() + name.slice(1); - for (var i = 0, n = d3_vendorPrefixes.length; i < n; ++i) { - var prefixName = d3_vendorPrefixes[i] + name; - if (prefixName in object) return prefixName; - } - } - var d3_vendorPrefixes = [ "webkit", "ms", "moz", "Moz", "o", "O" ]; - function d3_noop() {} - d3.dispatch = function() { - var dispatch = new d3_dispatch(), i = -1, n = arguments.length; - while (++i < n) dispatch[arguments[i]] = d3_dispatch_event(dispatch); - return dispatch; - }; - function d3_dispatch() {} - d3_dispatch.prototype.on = function(type, listener) { - var i = type.indexOf("."), name = ""; - if (i >= 0) { - name = type.slice(i + 1); - type = type.slice(0, i); - } - if (type) return arguments.length < 2 ? this[type].on(name) : this[type].on(name, listener); - if (arguments.length === 2) { - if (listener == null) for (type in this) { - if (this.hasOwnProperty(type)) this[type].on(name, null); - } - return this; - } - }; - function d3_dispatch_event(dispatch) { - var listeners = [], listenerByName = new d3_Map(); - function event() { - var z = listeners, i = -1, n = z.length, l; - while (++i < n) if (l = z[i].on) l.apply(this, arguments); - return dispatch; - } - event.on = function(name, listener) { - var l = listenerByName.get(name), i; - if (arguments.length < 2) return l && l.on; - if (l) { - l.on = null; - listeners = listeners.slice(0, i = listeners.indexOf(l)).concat(listeners.slice(i + 1)); - listenerByName.remove(name); - } - if (listener) listeners.push(listenerByName.set(name, { - on: listener - })); - return dispatch; - }; - return event; - } - d3.event = null; - function d3_eventPreventDefault() { - d3.event.preventDefault(); - } - function d3_eventSource() { - var e = d3.event, s; - while (s = e.sourceEvent) e = s; - return e; - } - function d3_eventDispatch(target) { - var dispatch = new d3_dispatch(), i = 0, n = arguments.length; - while (++i < n) dispatch[arguments[i]] = d3_dispatch_event(dispatch); - dispatch.of = function(thiz, argumentz) { - return function(e1) { - try { - var e0 = e1.sourceEvent = d3.event; - e1.target = target; - d3.event = e1; - dispatch[e1.type].apply(thiz, argumentz); - } finally { - d3.event = e0; - } - }; - }; - return dispatch; - } - d3.requote = function(s) { - return s.replace(d3_requote_re, "\\$&"); - }; - var d3_requote_re = /[\\\^\$\*\+\?\|\[\]\(\)\.\{\}]/g; - var d3_subclass = {}.__proto__ ? function(object, prototype) { - object.__proto__ = prototype; - } : function(object, prototype) { - for (var property in prototype) object[property] = prototype[property]; - }; - function d3_selection(groups) { - d3_subclass(groups, d3_selectionPrototype); - return groups; - } - var d3_select = function(s, n) { - return n.querySelector(s); - }, d3_selectAll = function(s, n) { - return n.querySelectorAll(s); - }, d3_selectMatches = function(n, s) { - var d3_selectMatcher = n.matches || n[d3_vendorSymbol(n, "matchesSelector")]; - d3_selectMatches = function(n, s) { - return d3_selectMatcher.call(n, s); - }; - return d3_selectMatches(n, s); - }; - if (typeof Sizzle === "function") { - d3_select = function(s, n) { - return Sizzle(s, n)[0] || null; - }; - d3_selectAll = Sizzle; - d3_selectMatches = Sizzle.matchesSelector; - } - d3.selection = function() { - return d3.select(d3_document.documentElement); - }; - var d3_selectionPrototype = d3.selection.prototype = []; - d3_selectionPrototype.select = function(selector) { - var subgroups = [], subgroup, subnode, group, node; - selector = d3_selection_selector(selector); - for (var j = -1, m = this.length; ++j < m; ) { - subgroups.push(subgroup = []); - subgroup.parentNode = (group = this[j]).parentNode; - for (var i = -1, n = group.length; ++i < n; ) { - if (node = group[i]) { - subgroup.push(subnode = selector.call(node, node.__data__, i, j)); - if (subnode && "__data__" in node) subnode.__data__ = node.__data__; - } else { - subgroup.push(null); - } - } - } - return d3_selection(subgroups); - }; - function d3_selection_selector(selector) { - return typeof selector === "function" ? selector : function() { - return d3_select(selector, this); - }; - } - d3_selectionPrototype.selectAll = function(selector) { - var subgroups = [], subgroup, node; - selector = d3_selection_selectorAll(selector); - for (var j = -1, m = this.length; ++j < m; ) { - for (var group = this[j], i = -1, n = group.length; ++i < n; ) { - if (node = group[i]) { - subgroups.push(subgroup = d3_array(selector.call(node, node.__data__, i, j))); - subgroup.parentNode = node; - } - } - } - return d3_selection(subgroups); - }; - function d3_selection_selectorAll(selector) { - return typeof selector === "function" ? selector : function() { - return d3_selectAll(selector, this); - }; - } - var d3_nsPrefix = { - svg: "http://www.w3.org/2000/svg", - xhtml: "http://www.w3.org/1999/xhtml", - xlink: "http://www.w3.org/1999/xlink", - xml: "http://www.w3.org/XML/1998/namespace", - xmlns: "http://www.w3.org/2000/xmlns/" - }; - d3.ns = { - prefix: d3_nsPrefix, - qualify: function(name) { - var i = name.indexOf(":"), prefix = name; - if (i >= 0) { - prefix = name.slice(0, i); - name = name.slice(i + 1); - } - return d3_nsPrefix.hasOwnProperty(prefix) ? { - space: d3_nsPrefix[prefix], - local: name - } : name; - } - }; - d3_selectionPrototype.attr = function(name, value) { - if (arguments.length < 2) { - if (typeof name === "string") { - var node = this.node(); - name = d3.ns.qualify(name); - return name.local ? node.getAttributeNS(name.space, name.local) : node.getAttribute(name); - } - for (value in name) this.each(d3_selection_attr(value, name[value])); - return this; - } - return this.each(d3_selection_attr(name, value)); - }; - function d3_selection_attr(name, value) { - name = d3.ns.qualify(name); - function attrNull() { - this.removeAttribute(name); - } - function attrNullNS() { - this.removeAttributeNS(name.space, name.local); - } - function attrConstant() { - this.setAttribute(name, value); - } - function attrConstantNS() { - this.setAttributeNS(name.space, name.local, value); - } - function attrFunction() { - var x = value.apply(this, arguments); - if (x == null) this.removeAttribute(name); else this.setAttribute(name, x); - } - function attrFunctionNS() { - var x = value.apply(this, arguments); - if (x == null) this.removeAttributeNS(name.space, name.local); else this.setAttributeNS(name.space, name.local, x); - } - return value == null ? name.local ? attrNullNS : attrNull : typeof value === "function" ? name.local ? attrFunctionNS : attrFunction : name.local ? attrConstantNS : attrConstant; - } - function d3_collapse(s) { - return s.trim().replace(/\s+/g, " "); - } - d3_selectionPrototype.classed = function(name, value) { - if (arguments.length < 2) { - if (typeof name === "string") { - var node = this.node(), n = (name = d3_selection_classes(name)).length, i = -1; - if (value = node.classList) { - while (++i < n) if (!value.contains(name[i])) return false; - } else { - value = node.getAttribute("class"); - while (++i < n) if (!d3_selection_classedRe(name[i]).test(value)) return false; - } - return true; - } - for (value in name) this.each(d3_selection_classed(value, name[value])); - return this; - } - return this.each(d3_selection_classed(name, value)); - }; - function d3_selection_classedRe(name) { - return new RegExp("(?:^|\\s+)" + d3.requote(name) + "(?:\\s+|$)", "g"); - } - function d3_selection_classes(name) { - return (name + "").trim().split(/^|\s+/); - } - function d3_selection_classed(name, value) { - name = d3_selection_classes(name).map(d3_selection_classedName); - var n = name.length; - function classedConstant() { - var i = -1; - while (++i < n) name[i](this, value); - } - function classedFunction() { - var i = -1, x = value.apply(this, arguments); - while (++i < n) name[i](this, x); - } - return typeof value === "function" ? classedFunction : classedConstant; - } - function d3_selection_classedName(name) { - var re = d3_selection_classedRe(name); - return function(node, value) { - if (c = node.classList) return value ? c.add(name) : c.remove(name); - var c = node.getAttribute("class") || ""; - if (value) { - re.lastIndex = 0; - if (!re.test(c)) node.setAttribute("class", d3_collapse(c + " " + name)); - } else { - node.setAttribute("class", d3_collapse(c.replace(re, " "))); - } - }; - } - d3_selectionPrototype.style = function(name, value, priority) { - var n = arguments.length; - if (n < 3) { - if (typeof name !== "string") { - if (n < 2) value = ""; - for (priority in name) this.each(d3_selection_style(priority, name[priority], value)); - return this; - } - if (n < 2) { - var node = this.node(); - return d3_window(node).getComputedStyle(node, null).getPropertyValue(name); - } - priority = ""; - } - return this.each(d3_selection_style(name, value, priority)); - }; - function d3_selection_style(name, value, priority) { - function styleNull() { - this.style.removeProperty(name); - } - function styleConstant() { - this.style.setProperty(name, value, priority); - } - function styleFunction() { - var x = value.apply(this, arguments); - if (x == null) this.style.removeProperty(name); else this.style.setProperty(name, x, priority); - } - return value == null ? styleNull : typeof value === "function" ? styleFunction : styleConstant; - } - d3_selectionPrototype.property = function(name, value) { - if (arguments.length < 2) { - if (typeof name === "string") return this.node()[name]; - for (value in name) this.each(d3_selection_property(value, name[value])); - return this; - } - return this.each(d3_selection_property(name, value)); - }; - function d3_selection_property(name, value) { - function propertyNull() { - delete this[name]; - } - function propertyConstant() { - this[name] = value; - } - function propertyFunction() { - var x = value.apply(this, arguments); - if (x == null) delete this[name]; else this[name] = x; - } - return value == null ? propertyNull : typeof value === "function" ? propertyFunction : propertyConstant; - } - d3_selectionPrototype.text = function(value) { - return arguments.length ? this.each(typeof value === "function" ? function() { - var v = value.apply(this, arguments); - this.textContent = v == null ? "" : v; - } : value == null ? function() { - this.textContent = ""; - } : function() { - this.textContent = value; - }) : this.node().textContent; - }; - d3_selectionPrototype.html = function(value) { - return arguments.length ? this.each(typeof value === "function" ? function() { - var v = value.apply(this, arguments); - this.innerHTML = v == null ? "" : v; - } : value == null ? function() { - this.innerHTML = ""; - } : function() { - this.innerHTML = value; - }) : this.node().innerHTML; - }; - d3_selectionPrototype.append = function(name) { - name = d3_selection_creator(name); - return this.select(function() { - return this.appendChild(name.apply(this, arguments)); - }); - }; - function d3_selection_creator(name) { - function create() { - var document = this.ownerDocument, namespace = this.namespaceURI; - return namespace ? document.createElementNS(namespace, name) : document.createElement(name); - } - function createNS() { - return this.ownerDocument.createElementNS(name.space, name.local); - } - return typeof name === "function" ? name : (name = d3.ns.qualify(name)).local ? createNS : create; - } - d3_selectionPrototype.insert = function(name, before) { - name = d3_selection_creator(name); - before = d3_selection_selector(before); - return this.select(function() { - return this.insertBefore(name.apply(this, arguments), before.apply(this, arguments) || null); - }); - }; - d3_selectionPrototype.remove = function() { - return this.each(d3_selectionRemove); - }; - function d3_selectionRemove() { - var parent = this.parentNode; - if (parent) parent.removeChild(this); - } - d3_selectionPrototype.data = function(value, key) { - var i = -1, n = this.length, group, node; - if (!arguments.length) { - value = new Array(n = (group = this[0]).length); - while (++i < n) { - if (node = group[i]) { - value[i] = node.__data__; - } - } - return value; - } - function bind(group, groupData) { - var i, n = group.length, m = groupData.length, n0 = Math.min(n, m), updateNodes = new Array(m), enterNodes = new Array(m), exitNodes = new Array(n), node, nodeData; - if (key) { - var nodeByKeyValue = new d3_Map(), keyValues = new Array(n), keyValue; - for (i = -1; ++i < n; ) { - if (nodeByKeyValue.has(keyValue = key.call(node = group[i], node.__data__, i))) { - exitNodes[i] = node; - } else { - nodeByKeyValue.set(keyValue, node); - } - keyValues[i] = keyValue; - } - for (i = -1; ++i < m; ) { - if (!(node = nodeByKeyValue.get(keyValue = key.call(groupData, nodeData = groupData[i], i)))) { - enterNodes[i] = d3_selection_dataNode(nodeData); - } else if (node !== true) { - updateNodes[i] = node; - node.__data__ = nodeData; - } - nodeByKeyValue.set(keyValue, true); - } - for (i = -1; ++i < n; ) { - if (nodeByKeyValue.get(keyValues[i]) !== true) { - exitNodes[i] = group[i]; - } - } - } else { - for (i = -1; ++i < n0; ) { - node = group[i]; - nodeData = groupData[i]; - if (node) { - node.__data__ = nodeData; - updateNodes[i] = node; - } else { - enterNodes[i] = d3_selection_dataNode(nodeData); - } - } - for (;i < m; ++i) { - enterNodes[i] = d3_selection_dataNode(groupData[i]); - } - for (;i < n; ++i) { - exitNodes[i] = group[i]; - } - } - enterNodes.update = updateNodes; - enterNodes.parentNode = updateNodes.parentNode = exitNodes.parentNode = group.parentNode; - enter.push(enterNodes); - update.push(updateNodes); - exit.push(exitNodes); - } - var enter = d3_selection_enter([]), update = d3_selection([]), exit = d3_selection([]); - if (typeof value === "function") { - while (++i < n) { - bind(group = this[i], value.call(group, group.parentNode.__data__, i)); - } - } else { - while (++i < n) { - bind(group = this[i], value); - } - } - update.enter = function() { - return enter; - }; - update.exit = function() { - return exit; - }; - return update; - }; - function d3_selection_dataNode(data) { - return { - __data__: data - }; - } - d3_selectionPrototype.datum = function(value) { - return arguments.length ? this.property("__data__", value) : this.property("__data__"); - }; - d3_selectionPrototype.filter = function(filter) { - var subgroups = [], subgroup, group, node; - if (typeof filter !== "function") filter = d3_selection_filter(filter); - for (var j = 0, m = this.length; j < m; j++) { - subgroups.push(subgroup = []); - subgroup.parentNode = (group = this[j]).parentNode; - for (var i = 0, n = group.length; i < n; i++) { - if ((node = group[i]) && filter.call(node, node.__data__, i, j)) { - subgroup.push(node); - } - } - } - return d3_selection(subgroups); - }; - function d3_selection_filter(selector) { - return function() { - return d3_selectMatches(this, selector); - }; - } - d3_selectionPrototype.order = function() { - for (var j = -1, m = this.length; ++j < m; ) { - for (var group = this[j], i = group.length - 1, next = group[i], node; --i >= 0; ) { - if (node = group[i]) { - if (next && next !== node.nextSibling) next.parentNode.insertBefore(node, next); - next = node; - } - } - } - return this; - }; - d3_selectionPrototype.sort = function(comparator) { - comparator = d3_selection_sortComparator.apply(this, arguments); - for (var j = -1, m = this.length; ++j < m; ) this[j].sort(comparator); - return this.order(); - }; - function d3_selection_sortComparator(comparator) { - if (!arguments.length) comparator = d3_ascending; - return function(a, b) { - return a && b ? comparator(a.__data__, b.__data__) : !a - !b; - }; - } - d3_selectionPrototype.each = function(callback) { - return d3_selection_each(this, function(node, i, j) { - callback.call(node, node.__data__, i, j); - }); - }; - function d3_selection_each(groups, callback) { - for (var j = 0, m = groups.length; j < m; j++) { - for (var group = groups[j], i = 0, n = group.length, node; i < n; i++) { - if (node = group[i]) callback(node, i, j); - } - } - return groups; - } - d3_selectionPrototype.call = function(callback) { - var args = d3_array(arguments); - callback.apply(args[0] = this, args); - return this; - }; - d3_selectionPrototype.empty = function() { - return !this.node(); - }; - d3_selectionPrototype.node = function() { - for (var j = 0, m = this.length; j < m; j++) { - for (var group = this[j], i = 0, n = group.length; i < n; i++) { - var node = group[i]; - if (node) return node; - } - } - return null; - }; - d3_selectionPrototype.size = function() { - var n = 0; - d3_selection_each(this, function() { - ++n; - }); - return n; - }; - function d3_selection_enter(selection) { - d3_subclass(selection, d3_selection_enterPrototype); - return selection; - } - var d3_selection_enterPrototype = []; - d3.selection.enter = d3_selection_enter; - d3.selection.enter.prototype = d3_selection_enterPrototype; - d3_selection_enterPrototype.append = d3_selectionPrototype.append; - d3_selection_enterPrototype.empty = d3_selectionPrototype.empty; - d3_selection_enterPrototype.node = d3_selectionPrototype.node; - d3_selection_enterPrototype.call = d3_selectionPrototype.call; - d3_selection_enterPrototype.size = d3_selectionPrototype.size; - d3_selection_enterPrototype.select = function(selector) { - var subgroups = [], subgroup, subnode, upgroup, group, node; - for (var j = -1, m = this.length; ++j < m; ) { - upgroup = (group = this[j]).update; - subgroups.push(subgroup = []); - subgroup.parentNode = group.parentNode; - for (var i = -1, n = group.length; ++i < n; ) { - if (node = group[i]) { - subgroup.push(upgroup[i] = subnode = selector.call(group.parentNode, node.__data__, i, j)); - subnode.__data__ = node.__data__; - } else { - subgroup.push(null); - } - } - } - return d3_selection(subgroups); - }; - d3_selection_enterPrototype.insert = function(name, before) { - if (arguments.length < 2) before = d3_selection_enterInsertBefore(this); - return d3_selectionPrototype.insert.call(this, name, before); - }; - function d3_selection_enterInsertBefore(enter) { - var i0, j0; - return function(d, i, j) { - var group = enter[j].update, n = group.length, node; - if (j != j0) j0 = j, i0 = 0; - if (i >= i0) i0 = i + 1; - while (!(node = group[i0]) && ++i0 < n) ; - return node; - }; - } - d3.select = function(node) { - var group; - if (typeof node === "string") { - group = [ d3_select(node, d3_document) ]; - group.parentNode = d3_document.documentElement; - } else { - group = [ node ]; - group.parentNode = d3_documentElement(node); - } - return d3_selection([ group ]); - }; - d3.selectAll = function(nodes) { - var group; - if (typeof nodes === "string") { - group = d3_array(d3_selectAll(nodes, d3_document)); - group.parentNode = d3_document.documentElement; - } else { - group = nodes; - group.parentNode = null; - } - return d3_selection([ group ]); - }; - d3_selectionPrototype.on = function(type, listener, capture) { - var n = arguments.length; - if (n < 3) { - if (typeof type !== "string") { - if (n < 2) listener = false; - for (capture in type) this.each(d3_selection_on(capture, type[capture], listener)); - return this; - } - if (n < 2) return (n = this.node()["__on" + type]) && n._; - capture = false; - } - return this.each(d3_selection_on(type, listener, capture)); - }; - function d3_selection_on(type, listener, capture) { - var name = "__on" + type, i = type.indexOf("."), wrap = d3_selection_onListener; - if (i > 0) type = type.slice(0, i); - var filter = d3_selection_onFilters.get(type); - if (filter) type = filter, wrap = d3_selection_onFilter; - function onRemove() { - var l = this[name]; - if (l) { - this.removeEventListener(type, l, l.$); - delete this[name]; - } - } - function onAdd() { - var l = wrap(listener, d3_array(arguments)); - onRemove.call(this); - this.addEventListener(type, this[name] = l, l.$ = capture); - l._ = listener; - } - function removeAll() { - var re = new RegExp("^__on([^.]+)" + d3.requote(type) + "$"), match; - for (var name in this) { - if (match = name.match(re)) { - var l = this[name]; - this.removeEventListener(match[1], l, l.$); - delete this[name]; - } - } - } - return i ? listener ? onAdd : onRemove : listener ? d3_noop : removeAll; - } - var d3_selection_onFilters = d3.map({ - mouseenter: "mouseover", - mouseleave: "mouseout" - }); - if (d3_document) { - d3_selection_onFilters.forEach(function(k) { - if ("on" + k in d3_document) d3_selection_onFilters.remove(k); - }); - } - function d3_selection_onListener(listener, argumentz) { - return function(e) { - var o = d3.event; - d3.event = e; - argumentz[0] = this.__data__; - try { - listener.apply(this, argumentz); - } finally { - d3.event = o; - } - }; - } - function d3_selection_onFilter(listener, argumentz) { - var l = d3_selection_onListener(listener, argumentz); - return function(e) { - var target = this, related = e.relatedTarget; - if (!related || related !== target && !(related.compareDocumentPosition(target) & 8)) { - l.call(target, e); - } - }; - } - var d3_event_dragSelect, d3_event_dragId = 0; - function d3_event_dragSuppress(node) { - var name = ".dragsuppress-" + ++d3_event_dragId, click = "click" + name, w = d3.select(d3_window(node)).on("touchmove" + name, d3_eventPreventDefault).on("dragstart" + name, d3_eventPreventDefault).on("selectstart" + name, d3_eventPreventDefault); - if (d3_event_dragSelect == null) { - d3_event_dragSelect = "onselectstart" in node ? false : d3_vendorSymbol(node.style, "userSelect"); - } - if (d3_event_dragSelect) { - var style = d3_documentElement(node).style, select = style[d3_event_dragSelect]; - style[d3_event_dragSelect] = "none"; - } - return function(suppressClick) { - w.on(name, null); - if (d3_event_dragSelect) style[d3_event_dragSelect] = select; - if (suppressClick) { - var off = function() { - w.on(click, null); - }; - w.on(click, function() { - d3_eventPreventDefault(); - off(); - }, true); - setTimeout(off, 0); - } - }; - } - d3.mouse = function(container) { - return d3_mousePoint(container, d3_eventSource()); - }; - var d3_mouse_bug44083 = this.navigator && /WebKit/.test(this.navigator.userAgent) ? -1 : 0; - function d3_mousePoint(container, e) { - if (e.changedTouches) e = e.changedTouches[0]; - var svg = container.ownerSVGElement || container; - if (svg.createSVGPoint) { - var point = svg.createSVGPoint(); - if (d3_mouse_bug44083 < 0) { - var window = d3_window(container); - if (window.scrollX || window.scrollY) { - svg = d3.select("body").append("svg").style({ - position: "absolute", - top: 0, - left: 0, - margin: 0, - padding: 0, - border: "none" - }, "important"); - var ctm = svg[0][0].getScreenCTM(); - d3_mouse_bug44083 = !(ctm.f || ctm.e); - svg.remove(); - } - } - if (d3_mouse_bug44083) point.x = e.pageX, point.y = e.pageY; else point.x = e.clientX, - point.y = e.clientY; - point = point.matrixTransform(container.getScreenCTM().inverse()); - return [ point.x, point.y ]; - } - var rect = container.getBoundingClientRect(); - return [ e.clientX - rect.left - container.clientLeft, e.clientY - rect.top - container.clientTop ]; - } - d3.touch = function(container, touches, identifier) { - if (arguments.length < 3) identifier = touches, touches = d3_eventSource().changedTouches; - if (touches) for (var i = 0, n = touches.length, touch; i < n; ++i) { - if ((touch = touches[i]).identifier === identifier) { - return d3_mousePoint(container, touch); - } - } - }; - d3.behavior.drag = function() { - var event = d3_eventDispatch(drag, "drag", "dragstart", "dragend"), origin = null, mousedown = dragstart(d3_noop, d3.mouse, d3_window, "mousemove", "mouseup"), touchstart = dragstart(d3_behavior_dragTouchId, d3.touch, d3_identity, "touchmove", "touchend"); - function drag() { - this.on("mousedown.drag", mousedown).on("touchstart.drag", touchstart); - } - function dragstart(id, position, subject, move, end) { - return function() { - var that = this, target = d3.event.target, parent = that.parentNode, dispatch = event.of(that, arguments), dragged = 0, dragId = id(), dragName = ".drag" + (dragId == null ? "" : "-" + dragId), dragOffset, dragSubject = d3.select(subject(target)).on(move + dragName, moved).on(end + dragName, ended), dragRestore = d3_event_dragSuppress(target), position0 = position(parent, dragId); - if (origin) { - dragOffset = origin.apply(that, arguments); - dragOffset = [ dragOffset.x - position0[0], dragOffset.y - position0[1] ]; - } else { - dragOffset = [ 0, 0 ]; - } - dispatch({ - type: "dragstart" - }); - function moved() { - var position1 = position(parent, dragId), dx, dy; - if (!position1) return; - dx = position1[0] - position0[0]; - dy = position1[1] - position0[1]; - dragged |= dx | dy; - position0 = position1; - dispatch({ - type: "drag", - x: position1[0] + dragOffset[0], - y: position1[1] + dragOffset[1], - dx: dx, - dy: dy - }); - } - function ended() { - if (!position(parent, dragId)) return; - dragSubject.on(move + dragName, null).on(end + dragName, null); - dragRestore(dragged && d3.event.target === target); - dispatch({ - type: "dragend" - }); - } - }; - } - drag.origin = function(x) { - if (!arguments.length) return origin; - origin = x; - return drag; - }; - return d3.rebind(drag, event, "on"); - }; - function d3_behavior_dragTouchId() { - return d3.event.changedTouches[0].identifier; - } - d3.touches = function(container, touches) { - if (arguments.length < 2) touches = d3_eventSource().touches; - return touches ? d3_array(touches).map(function(touch) { - var point = d3_mousePoint(container, touch); - point.identifier = touch.identifier; - return point; - }) : []; - }; - var ε = 1e-6, ε2 = ε * ε, π = Math.PI, τ = 2 * π, τε = τ - ε, halfπ = π / 2, d3_radians = π / 180, d3_degrees = 180 / π; - function d3_sgn(x) { - return x > 0 ? 1 : x < 0 ? -1 : 0; - } - function d3_cross2d(a, b, c) { - return (b[0] - a[0]) * (c[1] - a[1]) - (b[1] - a[1]) * (c[0] - a[0]); - } - function d3_acos(x) { - return x > 1 ? 0 : x < -1 ? π : Math.acos(x); - } - function d3_asin(x) { - return x > 1 ? halfπ : x < -1 ? -halfπ : Math.asin(x); - } - function d3_sinh(x) { - return ((x = Math.exp(x)) - 1 / x) / 2; - } - function d3_cosh(x) { - return ((x = Math.exp(x)) + 1 / x) / 2; - } - function d3_tanh(x) { - return ((x = Math.exp(2 * x)) - 1) / (x + 1); - } - function d3_haversin(x) { - return (x = Math.sin(x / 2)) * x; - } - var ρ = Math.SQRT2, ρ2 = 2, ρ4 = 4; - d3.interpolateZoom = function(p0, p1) { - var ux0 = p0[0], uy0 = p0[1], w0 = p0[2], ux1 = p1[0], uy1 = p1[1], w1 = p1[2]; - var dx = ux1 - ux0, dy = uy1 - uy0, d2 = dx * dx + dy * dy, d1 = Math.sqrt(d2), b0 = (w1 * w1 - w0 * w0 + ρ4 * d2) / (2 * w0 * ρ2 * d1), b1 = (w1 * w1 - w0 * w0 - ρ4 * d2) / (2 * w1 * ρ2 * d1), r0 = Math.log(Math.sqrt(b0 * b0 + 1) - b0), r1 = Math.log(Math.sqrt(b1 * b1 + 1) - b1), dr = r1 - r0, S = (dr || Math.log(w1 / w0)) / ρ; - function interpolate(t) { - var s = t * S; - if (dr) { - var coshr0 = d3_cosh(r0), u = w0 / (ρ2 * d1) * (coshr0 * d3_tanh(ρ * s + r0) - d3_sinh(r0)); - return [ ux0 + u * dx, uy0 + u * dy, w0 * coshr0 / d3_cosh(ρ * s + r0) ]; - } - return [ ux0 + t * dx, uy0 + t * dy, w0 * Math.exp(ρ * s) ]; - } - interpolate.duration = S * 1e3; - return interpolate; - }; - d3.behavior.zoom = function() { - var view = { - x: 0, - y: 0, - k: 1 - }, translate0, center0, center, size = [ 960, 500 ], scaleExtent = d3_behavior_zoomInfinity, duration = 250, zooming = 0, mousedown = "mousedown.zoom", mousemove = "mousemove.zoom", mouseup = "mouseup.zoom", mousewheelTimer, touchstart = "touchstart.zoom", touchtime, event = d3_eventDispatch(zoom, "zoomstart", "zoom", "zoomend"), x0, x1, y0, y1; - if (!d3_behavior_zoomWheel) { - d3_behavior_zoomWheel = "onwheel" in d3_document ? (d3_behavior_zoomDelta = function() { - return -d3.event.deltaY * (d3.event.deltaMode ? 120 : 1); - }, "wheel") : "onmousewheel" in d3_document ? (d3_behavior_zoomDelta = function() { - return d3.event.wheelDelta; - }, "mousewheel") : (d3_behavior_zoomDelta = function() { - return -d3.event.detail; - }, "MozMousePixelScroll"); - } - function zoom(g) { - g.on(mousedown, mousedowned).on(d3_behavior_zoomWheel + ".zoom", mousewheeled).on("dblclick.zoom", dblclicked).on(touchstart, touchstarted); - } - zoom.event = function(g) { - g.each(function() { - var dispatch = event.of(this, arguments), view1 = view; - if (d3_transitionInheritId) { - d3.select(this).transition().each("start.zoom", function() { - view = this.__chart__ || { - x: 0, - y: 0, - k: 1 - }; - zoomstarted(dispatch); - }).tween("zoom:zoom", function() { - var dx = size[0], dy = size[1], cx = center0 ? center0[0] : dx / 2, cy = center0 ? center0[1] : dy / 2, i = d3.interpolateZoom([ (cx - view.x) / view.k, (cy - view.y) / view.k, dx / view.k ], [ (cx - view1.x) / view1.k, (cy - view1.y) / view1.k, dx / view1.k ]); - return function(t) { - var l = i(t), k = dx / l[2]; - this.__chart__ = view = { - x: cx - l[0] * k, - y: cy - l[1] * k, - k: k - }; - zoomed(dispatch); - }; - }).each("interrupt.zoom", function() { - zoomended(dispatch); - }).each("end.zoom", function() { - zoomended(dispatch); - }); - } else { - this.__chart__ = view; - zoomstarted(dispatch); - zoomed(dispatch); - zoomended(dispatch); - } - }); - }; - zoom.translate = function(_) { - if (!arguments.length) return [ view.x, view.y ]; - view = { - x: +_[0], - y: +_[1], - k: view.k - }; - rescale(); - return zoom; - }; - zoom.scale = function(_) { - if (!arguments.length) return view.k; - view = { - x: view.x, - y: view.y, - k: +_ - }; - rescale(); - return zoom; - }; - zoom.scaleExtent = function(_) { - if (!arguments.length) return scaleExtent; - scaleExtent = _ == null ? d3_behavior_zoomInfinity : [ +_[0], +_[1] ]; - return zoom; - }; - zoom.center = function(_) { - if (!arguments.length) return center; - center = _ && [ +_[0], +_[1] ]; - return zoom; - }; - zoom.size = function(_) { - if (!arguments.length) return size; - size = _ && [ +_[0], +_[1] ]; - return zoom; - }; - zoom.duration = function(_) { - if (!arguments.length) return duration; - duration = +_; - return zoom; - }; - zoom.x = function(z) { - if (!arguments.length) return x1; - x1 = z; - x0 = z.copy(); - view = { - x: 0, - y: 0, - k: 1 - }; - return zoom; - }; - zoom.y = function(z) { - if (!arguments.length) return y1; - y1 = z; - y0 = z.copy(); - view = { - x: 0, - y: 0, - k: 1 - }; - return zoom; - }; - function location(p) { - return [ (p[0] - view.x) / view.k, (p[1] - view.y) / view.k ]; - } - function point(l) { - return [ l[0] * view.k + view.x, l[1] * view.k + view.y ]; - } - function scaleTo(s) { - view.k = Math.max(scaleExtent[0], Math.min(scaleExtent[1], s)); - } - function translateTo(p, l) { - l = point(l); - view.x += p[0] - l[0]; - view.y += p[1] - l[1]; - } - function zoomTo(that, p, l, k) { - that.__chart__ = { - x: view.x, - y: view.y, - k: view.k - }; - scaleTo(Math.pow(2, k)); - translateTo(center0 = p, l); - that = d3.select(that); - if (duration > 0) that = that.transition().duration(duration); - that.call(zoom.event); - } - function rescale() { - if (x1) x1.domain(x0.range().map(function(x) { - return (x - view.x) / view.k; - }).map(x0.invert)); - if (y1) y1.domain(y0.range().map(function(y) { - return (y - view.y) / view.k; - }).map(y0.invert)); - } - function zoomstarted(dispatch) { - if (!zooming++) dispatch({ - type: "zoomstart" - }); - } - function zoomed(dispatch) { - rescale(); - dispatch({ - type: "zoom", - scale: view.k, - translate: [ view.x, view.y ] - }); - } - function zoomended(dispatch) { - if (!--zooming) dispatch({ - type: "zoomend" - }), center0 = null; - } - function mousedowned() { - var that = this, target = d3.event.target, dispatch = event.of(that, arguments), dragged = 0, subject = d3.select(d3_window(that)).on(mousemove, moved).on(mouseup, ended), location0 = location(d3.mouse(that)), dragRestore = d3_event_dragSuppress(that); - d3_selection_interrupt.call(that); - zoomstarted(dispatch); - function moved() { - dragged = 1; - translateTo(d3.mouse(that), location0); - zoomed(dispatch); - } - function ended() { - subject.on(mousemove, null).on(mouseup, null); - dragRestore(dragged && d3.event.target === target); - zoomended(dispatch); - } - } - function touchstarted() { - var that = this, dispatch = event.of(that, arguments), locations0 = {}, distance0 = 0, scale0, zoomName = ".zoom-" + d3.event.changedTouches[0].identifier, touchmove = "touchmove" + zoomName, touchend = "touchend" + zoomName, targets = [], subject = d3.select(that), dragRestore = d3_event_dragSuppress(that); - started(); - zoomstarted(dispatch); - subject.on(mousedown, null).on(touchstart, started); - function relocate() { - var touches = d3.touches(that); - scale0 = view.k; - touches.forEach(function(t) { - if (t.identifier in locations0) locations0[t.identifier] = location(t); - }); - return touches; - } - function started() { - var target = d3.event.target; - d3.select(target).on(touchmove, moved).on(touchend, ended); - targets.push(target); - var changed = d3.event.changedTouches; - for (var i = 0, n = changed.length; i < n; ++i) { - locations0[changed[i].identifier] = null; - } - var touches = relocate(), now = Date.now(); - if (touches.length === 1) { - if (now - touchtime < 500) { - var p = touches[0]; - zoomTo(that, p, locations0[p.identifier], Math.floor(Math.log(view.k) / Math.LN2) + 1); - d3_eventPreventDefault(); - } - touchtime = now; - } else if (touches.length > 1) { - var p = touches[0], q = touches[1], dx = p[0] - q[0], dy = p[1] - q[1]; - distance0 = dx * dx + dy * dy; - } - } - function moved() { - var touches = d3.touches(that), p0, l0, p1, l1; - d3_selection_interrupt.call(that); - for (var i = 0, n = touches.length; i < n; ++i, l1 = null) { - p1 = touches[i]; - if (l1 = locations0[p1.identifier]) { - if (l0) break; - p0 = p1, l0 = l1; - } - } - if (l1) { - var distance1 = (distance1 = p1[0] - p0[0]) * distance1 + (distance1 = p1[1] - p0[1]) * distance1, scale1 = distance0 && Math.sqrt(distance1 / distance0); - p0 = [ (p0[0] + p1[0]) / 2, (p0[1] + p1[1]) / 2 ]; - l0 = [ (l0[0] + l1[0]) / 2, (l0[1] + l1[1]) / 2 ]; - scaleTo(scale1 * scale0); - } - touchtime = null; - translateTo(p0, l0); - zoomed(dispatch); - } - function ended() { - if (d3.event.touches.length) { - var changed = d3.event.changedTouches; - for (var i = 0, n = changed.length; i < n; ++i) { - delete locations0[changed[i].identifier]; - } - for (var identifier in locations0) { - return void relocate(); - } - } - d3.selectAll(targets).on(zoomName, null); - subject.on(mousedown, mousedowned).on(touchstart, touchstarted); - dragRestore(); - zoomended(dispatch); - } - } - function mousewheeled() { - var dispatch = event.of(this, arguments); - if (mousewheelTimer) clearTimeout(mousewheelTimer); else d3_selection_interrupt.call(this), - translate0 = location(center0 = center || d3.mouse(this)), zoomstarted(dispatch); - mousewheelTimer = setTimeout(function() { - mousewheelTimer = null; - zoomended(dispatch); - }, 50); - d3_eventPreventDefault(); - scaleTo(Math.pow(2, d3_behavior_zoomDelta() * .002) * view.k); - translateTo(center0, translate0); - zoomed(dispatch); - } - function dblclicked() { - var p = d3.mouse(this), k = Math.log(view.k) / Math.LN2; - zoomTo(this, p, location(p), d3.event.shiftKey ? Math.ceil(k) - 1 : Math.floor(k) + 1); - } - return d3.rebind(zoom, event, "on"); - }; - var d3_behavior_zoomInfinity = [ 0, Infinity ], d3_behavior_zoomDelta, d3_behavior_zoomWheel; - d3.color = d3_color; - function d3_color() {} - d3_color.prototype.toString = function() { - return this.rgb() + ""; - }; - d3.hsl = d3_hsl; - function d3_hsl(h, s, l) { - return this instanceof d3_hsl ? void (this.h = +h, this.s = +s, this.l = +l) : arguments.length < 2 ? h instanceof d3_hsl ? new d3_hsl(h.h, h.s, h.l) : d3_rgb_parse("" + h, d3_rgb_hsl, d3_hsl) : new d3_hsl(h, s, l); - } - var d3_hslPrototype = d3_hsl.prototype = new d3_color(); - d3_hslPrototype.brighter = function(k) { - k = Math.pow(.7, arguments.length ? k : 1); - return new d3_hsl(this.h, this.s, this.l / k); - }; - d3_hslPrototype.darker = function(k) { - k = Math.pow(.7, arguments.length ? k : 1); - return new d3_hsl(this.h, this.s, k * this.l); - }; - d3_hslPrototype.rgb = function() { - return d3_hsl_rgb(this.h, this.s, this.l); - }; - function d3_hsl_rgb(h, s, l) { - var m1, m2; - h = isNaN(h) ? 0 : (h %= 360) < 0 ? h + 360 : h; - s = isNaN(s) ? 0 : s < 0 ? 0 : s > 1 ? 1 : s; - l = l < 0 ? 0 : l > 1 ? 1 : l; - m2 = l <= .5 ? l * (1 + s) : l + s - l * s; - m1 = 2 * l - m2; - function v(h) { - if (h > 360) h -= 360; else if (h < 0) h += 360; - if (h < 60) return m1 + (m2 - m1) * h / 60; - if (h < 180) return m2; - if (h < 240) return m1 + (m2 - m1) * (240 - h) / 60; - return m1; - } - function vv(h) { - return Math.round(v(h) * 255); - } - return new d3_rgb(vv(h + 120), vv(h), vv(h - 120)); - } - d3.hcl = d3_hcl; - function d3_hcl(h, c, l) { - return this instanceof d3_hcl ? void (this.h = +h, this.c = +c, this.l = +l) : arguments.length < 2 ? h instanceof d3_hcl ? new d3_hcl(h.h, h.c, h.l) : h instanceof d3_lab ? d3_lab_hcl(h.l, h.a, h.b) : d3_lab_hcl((h = d3_rgb_lab((h = d3.rgb(h)).r, h.g, h.b)).l, h.a, h.b) : new d3_hcl(h, c, l); - } - var d3_hclPrototype = d3_hcl.prototype = new d3_color(); - d3_hclPrototype.brighter = function(k) { - return new d3_hcl(this.h, this.c, Math.min(100, this.l + d3_lab_K * (arguments.length ? k : 1))); - }; - d3_hclPrototype.darker = function(k) { - return new d3_hcl(this.h, this.c, Math.max(0, this.l - d3_lab_K * (arguments.length ? k : 1))); - }; - d3_hclPrototype.rgb = function() { - return d3_hcl_lab(this.h, this.c, this.l).rgb(); - }; - function d3_hcl_lab(h, c, l) { - if (isNaN(h)) h = 0; - if (isNaN(c)) c = 0; - return new d3_lab(l, Math.cos(h *= d3_radians) * c, Math.sin(h) * c); - } - d3.lab = d3_lab; - function d3_lab(l, a, b) { - return this instanceof d3_lab ? void (this.l = +l, this.a = +a, this.b = +b) : arguments.length < 2 ? l instanceof d3_lab ? new d3_lab(l.l, l.a, l.b) : l instanceof d3_hcl ? d3_hcl_lab(l.h, l.c, l.l) : d3_rgb_lab((l = d3_rgb(l)).r, l.g, l.b) : new d3_lab(l, a, b); - } - var d3_lab_K = 18; - var d3_lab_X = .95047, d3_lab_Y = 1, d3_lab_Z = 1.08883; - var d3_labPrototype = d3_lab.prototype = new d3_color(); - d3_labPrototype.brighter = function(k) { - return new d3_lab(Math.min(100, this.l + d3_lab_K * (arguments.length ? k : 1)), this.a, this.b); - }; - d3_labPrototype.darker = function(k) { - return new d3_lab(Math.max(0, this.l - d3_lab_K * (arguments.length ? k : 1)), this.a, this.b); - }; - d3_labPrototype.rgb = function() { - return d3_lab_rgb(this.l, this.a, this.b); - }; - function d3_lab_rgb(l, a, b) { - var y = (l + 16) / 116, x = y + a / 500, z = y - b / 200; - x = d3_lab_xyz(x) * d3_lab_X; - y = d3_lab_xyz(y) * d3_lab_Y; - z = d3_lab_xyz(z) * d3_lab_Z; - return new d3_rgb(d3_xyz_rgb(3.2404542 * x - 1.5371385 * y - .4985314 * z), d3_xyz_rgb(-.969266 * x + 1.8760108 * y + .041556 * z), d3_xyz_rgb(.0556434 * x - .2040259 * y + 1.0572252 * z)); - } - function d3_lab_hcl(l, a, b) { - return l > 0 ? new d3_hcl(Math.atan2(b, a) * d3_degrees, Math.sqrt(a * a + b * b), l) : new d3_hcl(NaN, NaN, l); - } - function d3_lab_xyz(x) { - return x > .206893034 ? x * x * x : (x - 4 / 29) / 7.787037; - } - function d3_xyz_lab(x) { - return x > .008856 ? Math.pow(x, 1 / 3) : 7.787037 * x + 4 / 29; - } - function d3_xyz_rgb(r) { - return Math.round(255 * (r <= .00304 ? 12.92 * r : 1.055 * Math.pow(r, 1 / 2.4) - .055)); - } - d3.rgb = d3_rgb; - function d3_rgb(r, g, b) { - return this instanceof d3_rgb ? void (this.r = ~~r, this.g = ~~g, this.b = ~~b) : arguments.length < 2 ? r instanceof d3_rgb ? new d3_rgb(r.r, r.g, r.b) : d3_rgb_parse("" + r, d3_rgb, d3_hsl_rgb) : new d3_rgb(r, g, b); - } - function d3_rgbNumber(value) { - return new d3_rgb(value >> 16, value >> 8 & 255, value & 255); - } - function d3_rgbString(value) { - return d3_rgbNumber(value) + ""; - } - var d3_rgbPrototype = d3_rgb.prototype = new d3_color(); - d3_rgbPrototype.brighter = function(k) { - k = Math.pow(.7, arguments.length ? k : 1); - var r = this.r, g = this.g, b = this.b, i = 30; - if (!r && !g && !b) return new d3_rgb(i, i, i); - if (r && r < i) r = i; - if (g && g < i) g = i; - if (b && b < i) b = i; - return new d3_rgb(Math.min(255, r / k), Math.min(255, g / k), Math.min(255, b / k)); - }; - d3_rgbPrototype.darker = function(k) { - k = Math.pow(.7, arguments.length ? k : 1); - return new d3_rgb(k * this.r, k * this.g, k * this.b); - }; - d3_rgbPrototype.hsl = function() { - return d3_rgb_hsl(this.r, this.g, this.b); - }; - d3_rgbPrototype.toString = function() { - return "#" + d3_rgb_hex(this.r) + d3_rgb_hex(this.g) + d3_rgb_hex(this.b); - }; - function d3_rgb_hex(v) { - return v < 16 ? "0" + Math.max(0, v).toString(16) : Math.min(255, v).toString(16); - } - function d3_rgb_parse(format, rgb, hsl) { - format = format.toLowerCase(); - var r = 0, g = 0, b = 0, m1, m2, color; - m1 = /([a-z]+)\((.*)\)/.exec(format); - if (m1) { - m2 = m1[2].split(","); - switch (m1[1]) { - case "hsl": - { - return hsl(parseFloat(m2[0]), parseFloat(m2[1]) / 100, parseFloat(m2[2]) / 100); - } - - case "rgb": - { - return rgb(d3_rgb_parseNumber(m2[0]), d3_rgb_parseNumber(m2[1]), d3_rgb_parseNumber(m2[2])); - } - } - } - if (color = d3_rgb_names.get(format)) { - return rgb(color.r, color.g, color.b); - } - if (format != null && format.charAt(0) === "#" && !isNaN(color = parseInt(format.slice(1), 16))) { - if (format.length === 4) { - r = (color & 3840) >> 4; - r = r >> 4 | r; - g = color & 240; - g = g >> 4 | g; - b = color & 15; - b = b << 4 | b; - } else if (format.length === 7) { - r = (color & 16711680) >> 16; - g = (color & 65280) >> 8; - b = color & 255; - } - } - return rgb(r, g, b); - } - function d3_rgb_hsl(r, g, b) { - var min = Math.min(r /= 255, g /= 255, b /= 255), max = Math.max(r, g, b), d = max - min, h, s, l = (max + min) / 2; - if (d) { - s = l < .5 ? d / (max + min) : d / (2 - max - min); - if (r == max) h = (g - b) / d + (g < b ? 6 : 0); else if (g == max) h = (b - r) / d + 2; else h = (r - g) / d + 4; - h *= 60; - } else { - h = NaN; - s = l > 0 && l < 1 ? 0 : h; - } - return new d3_hsl(h, s, l); - } - function d3_rgb_lab(r, g, b) { - r = d3_rgb_xyz(r); - g = d3_rgb_xyz(g); - b = d3_rgb_xyz(b); - var x = d3_xyz_lab((.4124564 * r + .3575761 * g + .1804375 * b) / d3_lab_X), y = d3_xyz_lab((.2126729 * r + .7151522 * g + .072175 * b) / d3_lab_Y), z = d3_xyz_lab((.0193339 * r + .119192 * g + .9503041 * b) / d3_lab_Z); - return d3_lab(116 * y - 16, 500 * (x - y), 200 * (y - z)); - } - function d3_rgb_xyz(r) { - return (r /= 255) <= .04045 ? r / 12.92 : Math.pow((r + .055) / 1.055, 2.4); - } - function d3_rgb_parseNumber(c) { - var f = parseFloat(c); - return c.charAt(c.length - 1) === "%" ? Math.round(f * 2.55) : f; - } - var d3_rgb_names = d3.map({ - aliceblue: 15792383, - antiquewhite: 16444375, - aqua: 65535, - aquamarine: 8388564, - azure: 15794175, - beige: 16119260, - bisque: 16770244, - black: 0, - blanchedalmond: 16772045, - blue: 255, - blueviolet: 9055202, - brown: 10824234, - burlywood: 14596231, - cadetblue: 6266528, - chartreuse: 8388352, - chocolate: 13789470, - coral: 16744272, - cornflowerblue: 6591981, - cornsilk: 16775388, - crimson: 14423100, - cyan: 65535, - darkblue: 139, - darkcyan: 35723, - darkgoldenrod: 12092939, - darkgray: 11119017, - darkgreen: 25600, - darkgrey: 11119017, - darkkhaki: 12433259, - darkmagenta: 9109643, - darkolivegreen: 5597999, - darkorange: 16747520, - darkorchid: 10040012, - darkred: 9109504, - darksalmon: 15308410, - darkseagreen: 9419919, - darkslateblue: 4734347, - darkslategray: 3100495, - darkslategrey: 3100495, - darkturquoise: 52945, - darkviolet: 9699539, - deeppink: 16716947, - deepskyblue: 49151, - dimgray: 6908265, - dimgrey: 6908265, - dodgerblue: 2003199, - firebrick: 11674146, - floralwhite: 16775920, - forestgreen: 2263842, - fuchsia: 16711935, - gainsboro: 14474460, - ghostwhite: 16316671, - gold: 16766720, - goldenrod: 14329120, - gray: 8421504, - green: 32768, - greenyellow: 11403055, - grey: 8421504, - honeydew: 15794160, - hotpink: 16738740, - indianred: 13458524, - indigo: 4915330, - ivory: 16777200, - khaki: 15787660, - lavender: 15132410, - lavenderblush: 16773365, - lawngreen: 8190976, - lemonchiffon: 16775885, - lightblue: 11393254, - lightcoral: 15761536, - lightcyan: 14745599, - lightgoldenrodyellow: 16448210, - lightgray: 13882323, - lightgreen: 9498256, - lightgrey: 13882323, - lightpink: 16758465, - lightsalmon: 16752762, - lightseagreen: 2142890, - lightskyblue: 8900346, - lightslategray: 7833753, - lightslategrey: 7833753, - lightsteelblue: 11584734, - lightyellow: 16777184, - lime: 65280, - limegreen: 3329330, - linen: 16445670, - magenta: 16711935, - maroon: 8388608, - mediumaquamarine: 6737322, - mediumblue: 205, - mediumorchid: 12211667, - mediumpurple: 9662683, - mediumseagreen: 3978097, - mediumslateblue: 8087790, - mediumspringgreen: 64154, - mediumturquoise: 4772300, - mediumvioletred: 13047173, - midnightblue: 1644912, - mintcream: 16121850, - mistyrose: 16770273, - moccasin: 16770229, - navajowhite: 16768685, - navy: 128, - oldlace: 16643558, - olive: 8421376, - olivedrab: 7048739, - orange: 16753920, - orangered: 16729344, - orchid: 14315734, - palegoldenrod: 15657130, - palegreen: 10025880, - paleturquoise: 11529966, - palevioletred: 14381203, - papayawhip: 16773077, - peachpuff: 16767673, - peru: 13468991, - pink: 16761035, - plum: 14524637, - powderblue: 11591910, - purple: 8388736, - rebeccapurple: 6697881, - red: 16711680, - rosybrown: 12357519, - royalblue: 4286945, - saddlebrown: 9127187, - salmon: 16416882, - sandybrown: 16032864, - seagreen: 3050327, - seashell: 16774638, - sienna: 10506797, - silver: 12632256, - skyblue: 8900331, - slateblue: 6970061, - slategray: 7372944, - slategrey: 7372944, - snow: 16775930, - springgreen: 65407, - steelblue: 4620980, - tan: 13808780, - teal: 32896, - thistle: 14204888, - tomato: 16737095, - turquoise: 4251856, - violet: 15631086, - wheat: 16113331, - white: 16777215, - whitesmoke: 16119285, - yellow: 16776960, - yellowgreen: 10145074 - }); - d3_rgb_names.forEach(function(key, value) { - d3_rgb_names.set(key, d3_rgbNumber(value)); - }); - function d3_functor(v) { - return typeof v === "function" ? v : function() { - return v; - }; - } - d3.functor = d3_functor; - d3.xhr = d3_xhrType(d3_identity); - function d3_xhrType(response) { - return function(url, mimeType, callback) { - if (arguments.length === 2 && typeof mimeType === "function") callback = mimeType, - mimeType = null; - return d3_xhr(url, mimeType, response, callback); - }; - } - function d3_xhr(url, mimeType, response, callback) { - var xhr = {}, dispatch = d3.dispatch("beforesend", "progress", "load", "error"), headers = {}, request = new XMLHttpRequest(), responseType = null; - if (this.XDomainRequest && !("withCredentials" in request) && /^(http(s)?:)?\/\//.test(url)) request = new XDomainRequest(); - "onload" in request ? request.onload = request.onerror = respond : request.onreadystatechange = function() { - request.readyState > 3 && respond(); - }; - function respond() { - var status = request.status, result; - if (!status && d3_xhrHasResponse(request) || status >= 200 && status < 300 || status === 304) { - try { - result = response.call(xhr, request); - } catch (e) { - dispatch.error.call(xhr, e); - return; - } - dispatch.load.call(xhr, result); - } else { - dispatch.error.call(xhr, request); - } - } - request.onprogress = function(event) { - var o = d3.event; - d3.event = event; - try { - dispatch.progress.call(xhr, request); - } finally { - d3.event = o; - } - }; - xhr.header = function(name, value) { - name = (name + "").toLowerCase(); - if (arguments.length < 2) return headers[name]; - if (value == null) delete headers[name]; else headers[name] = value + ""; - return xhr; - }; - xhr.mimeType = function(value) { - if (!arguments.length) return mimeType; - mimeType = value == null ? null : value + ""; - return xhr; - }; - xhr.responseType = function(value) { - if (!arguments.length) return responseType; - responseType = value; - return xhr; - }; - xhr.response = function(value) { - response = value; - return xhr; - }; - [ "get", "post" ].forEach(function(method) { - xhr[method] = function() { - return xhr.send.apply(xhr, [ method ].concat(d3_array(arguments))); - }; - }); - xhr.send = function(method, data, callback) { - if (arguments.length === 2 && typeof data === "function") callback = data, data = null; - request.open(method, url, true); - if (mimeType != null && !("accept" in headers)) headers["accept"] = mimeType + ",*/*"; - if (request.setRequestHeader) for (var name in headers) request.setRequestHeader(name, headers[name]); - if (mimeType != null && request.overrideMimeType) request.overrideMimeType(mimeType); - if (responseType != null) request.responseType = responseType; - if (callback != null) xhr.on("error", callback).on("load", function(request) { - callback(null, request); - }); - dispatch.beforesend.call(xhr, request); - request.send(data == null ? null : data); - return xhr; - }; - xhr.abort = function() { - request.abort(); - return xhr; - }; - d3.rebind(xhr, dispatch, "on"); - return callback == null ? xhr : xhr.get(d3_xhr_fixCallback(callback)); - } - function d3_xhr_fixCallback(callback) { - return callback.length === 1 ? function(error, request) { - callback(error == null ? request : null); - } : callback; - } - function d3_xhrHasResponse(request) { - var type = request.responseType; - return type && type !== "text" ? request.response : request.responseText; - } - d3.dsv = function(delimiter, mimeType) { - var reFormat = new RegExp('["' + delimiter + "\n]"), delimiterCode = delimiter.charCodeAt(0); - function dsv(url, row, callback) { - if (arguments.length < 3) callback = row, row = null; - var xhr = d3_xhr(url, mimeType, row == null ? response : typedResponse(row), callback); - xhr.row = function(_) { - return arguments.length ? xhr.response((row = _) == null ? response : typedResponse(_)) : row; - }; - return xhr; - } - function response(request) { - return dsv.parse(request.responseText); - } - function typedResponse(f) { - return function(request) { - return dsv.parse(request.responseText, f); - }; - } - dsv.parse = function(text, f) { - var o; - return dsv.parseRows(text, function(row, i) { - if (o) return o(row, i - 1); - var a = new Function("d", "return {" + row.map(function(name, i) { - return JSON.stringify(name) + ": d[" + i + "]"; - }).join(",") + "}"); - o = f ? function(row, i) { - return f(a(row), i); - } : a; - }); - }; - dsv.parseRows = function(text, f) { - var EOL = {}, EOF = {}, rows = [], N = text.length, I = 0, n = 0, t, eol; - function token() { - if (I >= N) return EOF; - if (eol) return eol = false, EOL; - var j = I; - if (text.charCodeAt(j) === 34) { - var i = j; - while (i++ < N) { - if (text.charCodeAt(i) === 34) { - if (text.charCodeAt(i + 1) !== 34) break; - ++i; - } - } - I = i + 2; - var c = text.charCodeAt(i + 1); - if (c === 13) { - eol = true; - if (text.charCodeAt(i + 2) === 10) ++I; - } else if (c === 10) { - eol = true; - } - return text.slice(j + 1, i).replace(/""/g, '"'); - } - while (I < N) { - var c = text.charCodeAt(I++), k = 1; - if (c === 10) eol = true; else if (c === 13) { - eol = true; - if (text.charCodeAt(I) === 10) ++I, ++k; - } else if (c !== delimiterCode) continue; - return text.slice(j, I - k); - } - return text.slice(j); - } - while ((t = token()) !== EOF) { - var a = []; - while (t !== EOL && t !== EOF) { - a.push(t); - t = token(); - } - if (f && (a = f(a, n++)) == null) continue; - rows.push(a); - } - return rows; - }; - dsv.format = function(rows) { - if (Array.isArray(rows[0])) return dsv.formatRows(rows); - var fieldSet = new d3_Set(), fields = []; - rows.forEach(function(row) { - for (var field in row) { - if (!fieldSet.has(field)) { - fields.push(fieldSet.add(field)); - } - } - }); - return [ fields.map(formatValue).join(delimiter) ].concat(rows.map(function(row) { - return fields.map(function(field) { - return formatValue(row[field]); - }).join(delimiter); - })).join("\n"); - }; - dsv.formatRows = function(rows) { - return rows.map(formatRow).join("\n"); - }; - function formatRow(row) { - return row.map(formatValue).join(delimiter); - } - function formatValue(text) { - return reFormat.test(text) ? '"' + text.replace(/\"/g, '""') + '"' : text; - } - return dsv; - }; - d3.csv = d3.dsv(",", "text/csv"); - d3.tsv = d3.dsv(" ", "text/tab-separated-values"); - var d3_timer_queueHead, d3_timer_queueTail, d3_timer_interval, d3_timer_timeout, d3_timer_active, d3_timer_frame = this[d3_vendorSymbol(this, "requestAnimationFrame")] || function(callback) { - setTimeout(callback, 17); - }; - d3.timer = function(callback, delay, then) { - var n = arguments.length; - if (n < 2) delay = 0; - if (n < 3) then = Date.now(); - var time = then + delay, timer = { - c: callback, - t: time, - f: false, - n: null - }; - if (d3_timer_queueTail) d3_timer_queueTail.n = timer; else d3_timer_queueHead = timer; - d3_timer_queueTail = timer; - if (!d3_timer_interval) { - d3_timer_timeout = clearTimeout(d3_timer_timeout); - d3_timer_interval = 1; - d3_timer_frame(d3_timer_step); - } - }; - function d3_timer_step() { - var now = d3_timer_mark(), delay = d3_timer_sweep() - now; - if (delay > 24) { - if (isFinite(delay)) { - clearTimeout(d3_timer_timeout); - d3_timer_timeout = setTimeout(d3_timer_step, delay); - } - d3_timer_interval = 0; - } else { - d3_timer_interval = 1; - d3_timer_frame(d3_timer_step); - } - } - d3.timer.flush = function() { - d3_timer_mark(); - d3_timer_sweep(); - }; - function d3_timer_mark() { - var now = Date.now(); - d3_timer_active = d3_timer_queueHead; - while (d3_timer_active) { - if (now >= d3_timer_active.t) d3_timer_active.f = d3_timer_active.c(now - d3_timer_active.t); - d3_timer_active = d3_timer_active.n; - } - return now; - } - function d3_timer_sweep() { - var t0, t1 = d3_timer_queueHead, time = Infinity; - while (t1) { - if (t1.f) { - t1 = t0 ? t0.n = t1.n : d3_timer_queueHead = t1.n; - } else { - if (t1.t < time) time = t1.t; - t1 = (t0 = t1).n; - } - } - d3_timer_queueTail = t0; - return time; - } - function d3_format_precision(x, p) { - return p - (x ? Math.ceil(Math.log(x) / Math.LN10) : 1); - } - d3.round = function(x, n) { - return n ? Math.round(x * (n = Math.pow(10, n))) / n : Math.round(x); - }; - var d3_formatPrefixes = [ "y", "z", "a", "f", "p", "n", "µ", "m", "", "k", "M", "G", "T", "P", "E", "Z", "Y" ].map(d3_formatPrefix); - d3.formatPrefix = function(value, precision) { - var i = 0; - if (value) { - if (value < 0) value *= -1; - if (precision) value = d3.round(value, d3_format_precision(value, precision)); - i = 1 + Math.floor(1e-12 + Math.log(value) / Math.LN10); - i = Math.max(-24, Math.min(24, Math.floor((i - 1) / 3) * 3)); - } - return d3_formatPrefixes[8 + i / 3]; - }; - function d3_formatPrefix(d, i) { - var k = Math.pow(10, abs(8 - i) * 3); - return { - scale: i > 8 ? function(d) { - return d / k; - } : function(d) { - return d * k; - }, - symbol: d - }; - } - function d3_locale_numberFormat(locale) { - var locale_decimal = locale.decimal, locale_thousands = locale.thousands, locale_grouping = locale.grouping, locale_currency = locale.currency, formatGroup = locale_grouping && locale_thousands ? function(value, width) { - var i = value.length, t = [], j = 0, g = locale_grouping[0], length = 0; - while (i > 0 && g > 0) { - if (length + g + 1 > width) g = Math.max(1, width - length); - t.push(value.substring(i -= g, i + g)); - if ((length += g + 1) > width) break; - g = locale_grouping[j = (j + 1) % locale_grouping.length]; - } - return t.reverse().join(locale_thousands); - } : d3_identity; - return function(specifier) { - var match = d3_format_re.exec(specifier), fill = match[1] || " ", align = match[2] || ">", sign = match[3] || "-", symbol = match[4] || "", zfill = match[5], width = +match[6], comma = match[7], precision = match[8], type = match[9], scale = 1, prefix = "", suffix = "", integer = false, exponent = true; - if (precision) precision = +precision.substring(1); - if (zfill || fill === "0" && align === "=") { - zfill = fill = "0"; - align = "="; - } - switch (type) { - case "n": - comma = true; - type = "g"; - break; - - case "%": - scale = 100; - suffix = "%"; - type = "f"; - break; - - case "p": - scale = 100; - suffix = "%"; - type = "r"; - break; - - case "b": - case "o": - case "x": - case "X": - if (symbol === "#") prefix = "0" + type.toLowerCase(); - - case "c": - exponent = false; - - case "d": - integer = true; - precision = 0; - break; - - case "s": - scale = -1; - type = "r"; - break; - } - if (symbol === "$") prefix = locale_currency[0], suffix = locale_currency[1]; - if (type == "r" && !precision) type = "g"; - if (precision != null) { - if (type == "g") precision = Math.max(1, Math.min(21, precision)); else if (type == "e" || type == "f") precision = Math.max(0, Math.min(20, precision)); - } - type = d3_format_types.get(type) || d3_format_typeDefault; - var zcomma = zfill && comma; - return function(value) { - var fullSuffix = suffix; - if (integer && value % 1) return ""; - var negative = value < 0 || value === 0 && 1 / value < 0 ? (value = -value, "-") : sign === "-" ? "" : sign; - if (scale < 0) { - var unit = d3.formatPrefix(value, precision); - value = unit.scale(value); - fullSuffix = unit.symbol + suffix; - } else { - value *= scale; - } - value = type(value, precision); - var i = value.lastIndexOf("."), before, after; - if (i < 0) { - var j = exponent ? value.lastIndexOf("e") : -1; - if (j < 0) before = value, after = ""; else before = value.substring(0, j), after = value.substring(j); - } else { - before = value.substring(0, i); - after = locale_decimal + value.substring(i + 1); - } - if (!zfill && comma) before = formatGroup(before, Infinity); - var length = prefix.length + before.length + after.length + (zcomma ? 0 : negative.length), padding = length < width ? new Array(length = width - length + 1).join(fill) : ""; - if (zcomma) before = formatGroup(padding + before, padding.length ? width - after.length : Infinity); - negative += prefix; - value = before + after; - return (align === "<" ? negative + value + padding : align === ">" ? padding + negative + value : align === "^" ? padding.substring(0, length >>= 1) + negative + value + padding.substring(length) : negative + (zcomma ? value : padding + value)) + fullSuffix; - }; - }; - } - var d3_format_re = /(?:([^{])?([<>=^]))?([+\- ])?([$#])?(0)?(\d+)?(,)?(\.-?\d+)?([a-z%])?/i; - var d3_format_types = d3.map({ - b: function(x) { - return x.toString(2); - }, - c: function(x) { - return String.fromCharCode(x); - }, - o: function(x) { - return x.toString(8); - }, - x: function(x) { - return x.toString(16); - }, - X: function(x) { - return x.toString(16).toUpperCase(); - }, - g: function(x, p) { - return x.toPrecision(p); - }, - e: function(x, p) { - return x.toExponential(p); - }, - f: function(x, p) { - return x.toFixed(p); - }, - r: function(x, p) { - return (x = d3.round(x, d3_format_precision(x, p))).toFixed(Math.max(0, Math.min(20, d3_format_precision(x * (1 + 1e-15), p)))); - } - }); - function d3_format_typeDefault(x) { - return x + ""; - } - var d3_time = d3.time = {}, d3_date = Date; - function d3_date_utc() { - this._ = new Date(arguments.length > 1 ? Date.UTC.apply(this, arguments) : arguments[0]); - } - d3_date_utc.prototype = { - getDate: function() { - return this._.getUTCDate(); - }, - getDay: function() { - return this._.getUTCDay(); - }, - getFullYear: function() { - return this._.getUTCFullYear(); - }, - getHours: function() { - return this._.getUTCHours(); - }, - getMilliseconds: function() { - return this._.getUTCMilliseconds(); - }, - getMinutes: function() { - return this._.getUTCMinutes(); - }, - getMonth: function() { - return this._.getUTCMonth(); - }, - getSeconds: function() { - return this._.getUTCSeconds(); - }, - getTime: function() { - return this._.getTime(); - }, - getTimezoneOffset: function() { - return 0; - }, - valueOf: function() { - return this._.valueOf(); - }, - setDate: function() { - d3_time_prototype.setUTCDate.apply(this._, arguments); - }, - setDay: function() { - d3_time_prototype.setUTCDay.apply(this._, arguments); - }, - setFullYear: function() { - d3_time_prototype.setUTCFullYear.apply(this._, arguments); - }, - setHours: function() { - d3_time_prototype.setUTCHours.apply(this._, arguments); - }, - setMilliseconds: function() { - d3_time_prototype.setUTCMilliseconds.apply(this._, arguments); - }, - setMinutes: function() { - d3_time_prototype.setUTCMinutes.apply(this._, arguments); - }, - setMonth: function() { - d3_time_prototype.setUTCMonth.apply(this._, arguments); - }, - setSeconds: function() { - d3_time_prototype.setUTCSeconds.apply(this._, arguments); - }, - setTime: function() { - d3_time_prototype.setTime.apply(this._, arguments); - } - }; - var d3_time_prototype = Date.prototype; - function d3_time_interval(local, step, number) { - function round(date) { - var d0 = local(date), d1 = offset(d0, 1); - return date - d0 < d1 - date ? d0 : d1; - } - function ceil(date) { - step(date = local(new d3_date(date - 1)), 1); - return date; - } - function offset(date, k) { - step(date = new d3_date(+date), k); - return date; - } - function range(t0, t1, dt) { - var time = ceil(t0), times = []; - if (dt > 1) { - while (time < t1) { - if (!(number(time) % dt)) times.push(new Date(+time)); - step(time, 1); - } - } else { - while (time < t1) times.push(new Date(+time)), step(time, 1); - } - return times; - } - function range_utc(t0, t1, dt) { - try { - d3_date = d3_date_utc; - var utc = new d3_date_utc(); - utc._ = t0; - return range(utc, t1, dt); - } finally { - d3_date = Date; - } - } - local.floor = local; - local.round = round; - local.ceil = ceil; - local.offset = offset; - local.range = range; - var utc = local.utc = d3_time_interval_utc(local); - utc.floor = utc; - utc.round = d3_time_interval_utc(round); - utc.ceil = d3_time_interval_utc(ceil); - utc.offset = d3_time_interval_utc(offset); - utc.range = range_utc; - return local; - } - function d3_time_interval_utc(method) { - return function(date, k) { - try { - d3_date = d3_date_utc; - var utc = new d3_date_utc(); - utc._ = date; - return method(utc, k)._; - } finally { - d3_date = Date; - } - }; - } - d3_time.year = d3_time_interval(function(date) { - date = d3_time.day(date); - date.setMonth(0, 1); - return date; - }, function(date, offset) { - date.setFullYear(date.getFullYear() + offset); - }, function(date) { - return date.getFullYear(); - }); - d3_time.years = d3_time.year.range; - d3_time.years.utc = d3_time.year.utc.range; - d3_time.day = d3_time_interval(function(date) { - var day = new d3_date(2e3, 0); - day.setFullYear(date.getFullYear(), date.getMonth(), date.getDate()); - return day; - }, function(date, offset) { - date.setDate(date.getDate() + offset); - }, function(date) { - return date.getDate() - 1; - }); - d3_time.days = d3_time.day.range; - d3_time.days.utc = d3_time.day.utc.range; - d3_time.dayOfYear = function(date) { - var year = d3_time.year(date); - return Math.floor((date - year - (date.getTimezoneOffset() - year.getTimezoneOffset()) * 6e4) / 864e5); - }; - [ "sunday", "monday", "tuesday", "wednesday", "thursday", "friday", "saturday" ].forEach(function(day, i) { - i = 7 - i; - var interval = d3_time[day] = d3_time_interval(function(date) { - (date = d3_time.day(date)).setDate(date.getDate() - (date.getDay() + i) % 7); - return date; - }, function(date, offset) { - date.setDate(date.getDate() + Math.floor(offset) * 7); - }, function(date) { - var day = d3_time.year(date).getDay(); - return Math.floor((d3_time.dayOfYear(date) + (day + i) % 7) / 7) - (day !== i); - }); - d3_time[day + "s"] = interval.range; - d3_time[day + "s"].utc = interval.utc.range; - d3_time[day + "OfYear"] = function(date) { - var day = d3_time.year(date).getDay(); - return Math.floor((d3_time.dayOfYear(date) + (day + i) % 7) / 7); - }; - }); - d3_time.week = d3_time.sunday; - d3_time.weeks = d3_time.sunday.range; - d3_time.weeks.utc = d3_time.sunday.utc.range; - d3_time.weekOfYear = d3_time.sundayOfYear; - function d3_locale_timeFormat(locale) { - var locale_dateTime = locale.dateTime, locale_date = locale.date, locale_time = locale.time, locale_periods = locale.periods, locale_days = locale.days, locale_shortDays = locale.shortDays, locale_months = locale.months, locale_shortMonths = locale.shortMonths; - function d3_time_format(template) { - var n = template.length; - function format(date) { - var string = [], i = -1, j = 0, c, p, f; - while (++i < n) { - if (template.charCodeAt(i) === 37) { - string.push(template.slice(j, i)); - if ((p = d3_time_formatPads[c = template.charAt(++i)]) != null) c = template.charAt(++i); - if (f = d3_time_formats[c]) c = f(date, p == null ? c === "e" ? " " : "0" : p); - string.push(c); - j = i + 1; - } - } - string.push(template.slice(j, i)); - return string.join(""); - } - format.parse = function(string) { - var d = { - y: 1900, - m: 0, - d: 1, - H: 0, - M: 0, - S: 0, - L: 0, - Z: null - }, i = d3_time_parse(d, template, string, 0); - if (i != string.length) return null; - if ("p" in d) d.H = d.H % 12 + d.p * 12; - var localZ = d.Z != null && d3_date !== d3_date_utc, date = new (localZ ? d3_date_utc : d3_date)(); - if ("j" in d) date.setFullYear(d.y, 0, d.j); else if ("w" in d && ("W" in d || "U" in d)) { - date.setFullYear(d.y, 0, 1); - date.setFullYear(d.y, 0, "W" in d ? (d.w + 6) % 7 + d.W * 7 - (date.getDay() + 5) % 7 : d.w + d.U * 7 - (date.getDay() + 6) % 7); - } else date.setFullYear(d.y, d.m, d.d); - date.setHours(d.H + (d.Z / 100 | 0), d.M + d.Z % 100, d.S, d.L); - return localZ ? date._ : date; - }; - format.toString = function() { - return template; - }; - return format; - } - function d3_time_parse(date, template, string, j) { - var c, p, t, i = 0, n = template.length, m = string.length; - while (i < n) { - if (j >= m) return -1; - c = template.charCodeAt(i++); - if (c === 37) { - t = template.charAt(i++); - p = d3_time_parsers[t in d3_time_formatPads ? template.charAt(i++) : t]; - if (!p || (j = p(date, string, j)) < 0) return -1; - } else if (c != string.charCodeAt(j++)) { - return -1; - } - } - return j; - } - d3_time_format.utc = function(template) { - var local = d3_time_format(template); - function format(date) { - try { - d3_date = d3_date_utc; - var utc = new d3_date(); - utc._ = date; - return local(utc); - } finally { - d3_date = Date; - } - } - format.parse = function(string) { - try { - d3_date = d3_date_utc; - var date = local.parse(string); - return date && date._; - } finally { - d3_date = Date; - } - }; - format.toString = local.toString; - return format; - }; - d3_time_format.multi = d3_time_format.utc.multi = d3_time_formatMulti; - var d3_time_periodLookup = d3.map(), d3_time_dayRe = d3_time_formatRe(locale_days), d3_time_dayLookup = d3_time_formatLookup(locale_days), d3_time_dayAbbrevRe = d3_time_formatRe(locale_shortDays), d3_time_dayAbbrevLookup = d3_time_formatLookup(locale_shortDays), d3_time_monthRe = d3_time_formatRe(locale_months), d3_time_monthLookup = d3_time_formatLookup(locale_months), d3_time_monthAbbrevRe = d3_time_formatRe(locale_shortMonths), d3_time_monthAbbrevLookup = d3_time_formatLookup(locale_shortMonths); - locale_periods.forEach(function(p, i) { - d3_time_periodLookup.set(p.toLowerCase(), i); - }); - var d3_time_formats = { - a: function(d) { - return locale_shortDays[d.getDay()]; - }, - A: function(d) { - return locale_days[d.getDay()]; - }, - b: function(d) { - return locale_shortMonths[d.getMonth()]; - }, - B: function(d) { - return locale_months[d.getMonth()]; - }, - c: d3_time_format(locale_dateTime), - d: function(d, p) { - return d3_time_formatPad(d.getDate(), p, 2); - }, - e: function(d, p) { - return d3_time_formatPad(d.getDate(), p, 2); - }, - H: function(d, p) { - return d3_time_formatPad(d.getHours(), p, 2); - }, - I: function(d, p) { - return d3_time_formatPad(d.getHours() % 12 || 12, p, 2); - }, - j: function(d, p) { - return d3_time_formatPad(1 + d3_time.dayOfYear(d), p, 3); - }, - L: function(d, p) { - return d3_time_formatPad(d.getMilliseconds(), p, 3); - }, - m: function(d, p) { - return d3_time_formatPad(d.getMonth() + 1, p, 2); - }, - M: function(d, p) { - return d3_time_formatPad(d.getMinutes(), p, 2); - }, - p: function(d) { - return locale_periods[+(d.getHours() >= 12)]; - }, - S: function(d, p) { - return d3_time_formatPad(d.getSeconds(), p, 2); - }, - U: function(d, p) { - return d3_time_formatPad(d3_time.sundayOfYear(d), p, 2); - }, - w: function(d) { - return d.getDay(); - }, - W: function(d, p) { - return d3_time_formatPad(d3_time.mondayOfYear(d), p, 2); - }, - x: d3_time_format(locale_date), - X: d3_time_format(locale_time), - y: function(d, p) { - return d3_time_formatPad(d.getFullYear() % 100, p, 2); - }, - Y: function(d, p) { - return d3_time_formatPad(d.getFullYear() % 1e4, p, 4); - }, - Z: d3_time_zone, - "%": function() { - return "%"; - } - }; - var d3_time_parsers = { - a: d3_time_parseWeekdayAbbrev, - A: d3_time_parseWeekday, - b: d3_time_parseMonthAbbrev, - B: d3_time_parseMonth, - c: d3_time_parseLocaleFull, - d: d3_time_parseDay, - e: d3_time_parseDay, - H: d3_time_parseHour24, - I: d3_time_parseHour24, - j: d3_time_parseDayOfYear, - L: d3_time_parseMilliseconds, - m: d3_time_parseMonthNumber, - M: d3_time_parseMinutes, - p: d3_time_parseAmPm, - S: d3_time_parseSeconds, - U: d3_time_parseWeekNumberSunday, - w: d3_time_parseWeekdayNumber, - W: d3_time_parseWeekNumberMonday, - x: d3_time_parseLocaleDate, - X: d3_time_parseLocaleTime, - y: d3_time_parseYear, - Y: d3_time_parseFullYear, - Z: d3_time_parseZone, - "%": d3_time_parseLiteralPercent - }; - function d3_time_parseWeekdayAbbrev(date, string, i) { - d3_time_dayAbbrevRe.lastIndex = 0; - var n = d3_time_dayAbbrevRe.exec(string.slice(i)); - return n ? (date.w = d3_time_dayAbbrevLookup.get(n[0].toLowerCase()), i + n[0].length) : -1; - } - function d3_time_parseWeekday(date, string, i) { - d3_time_dayRe.lastIndex = 0; - var n = d3_time_dayRe.exec(string.slice(i)); - return n ? (date.w = d3_time_dayLookup.get(n[0].toLowerCase()), i + n[0].length) : -1; - } - function d3_time_parseMonthAbbrev(date, string, i) { - d3_time_monthAbbrevRe.lastIndex = 0; - var n = d3_time_monthAbbrevRe.exec(string.slice(i)); - return n ? (date.m = d3_time_monthAbbrevLookup.get(n[0].toLowerCase()), i + n[0].length) : -1; - } - function d3_time_parseMonth(date, string, i) { - d3_time_monthRe.lastIndex = 0; - var n = d3_time_monthRe.exec(string.slice(i)); - return n ? (date.m = d3_time_monthLookup.get(n[0].toLowerCase()), i + n[0].length) : -1; - } - function d3_time_parseLocaleFull(date, string, i) { - return d3_time_parse(date, d3_time_formats.c.toString(), string, i); - } - function d3_time_parseLocaleDate(date, string, i) { - return d3_time_parse(date, d3_time_formats.x.toString(), string, i); - } - function d3_time_parseLocaleTime(date, string, i) { - return d3_time_parse(date, d3_time_formats.X.toString(), string, i); - } - function d3_time_parseAmPm(date, string, i) { - var n = d3_time_periodLookup.get(string.slice(i, i += 2).toLowerCase()); - return n == null ? -1 : (date.p = n, i); - } - return d3_time_format; - } - var d3_time_formatPads = { - "-": "", - _: " ", - "0": "0" - }, d3_time_numberRe = /^\s*\d+/, d3_time_percentRe = /^%/; - function d3_time_formatPad(value, fill, width) { - var sign = value < 0 ? "-" : "", string = (sign ? -value : value) + "", length = string.length; - return sign + (length < width ? new Array(width - length + 1).join(fill) + string : string); - } - function d3_time_formatRe(names) { - return new RegExp("^(?:" + names.map(d3.requote).join("|") + ")", "i"); - } - function d3_time_formatLookup(names) { - var map = new d3_Map(), i = -1, n = names.length; - while (++i < n) map.set(names[i].toLowerCase(), i); - return map; - } - function d3_time_parseWeekdayNumber(date, string, i) { - d3_time_numberRe.lastIndex = 0; - var n = d3_time_numberRe.exec(string.slice(i, i + 1)); - return n ? (date.w = +n[0], i + n[0].length) : -1; - } - function d3_time_parseWeekNumberSunday(date, string, i) { - d3_time_numberRe.lastIndex = 0; - var n = d3_time_numberRe.exec(string.slice(i)); - return n ? (date.U = +n[0], i + n[0].length) : -1; - } - function d3_time_parseWeekNumberMonday(date, string, i) { - d3_time_numberRe.lastIndex = 0; - var n = d3_time_numberRe.exec(string.slice(i)); - return n ? (date.W = +n[0], i + n[0].length) : -1; - } - function d3_time_parseFullYear(date, string, i) { - d3_time_numberRe.lastIndex = 0; - var n = d3_time_numberRe.exec(string.slice(i, i + 4)); - return n ? (date.y = +n[0], i + n[0].length) : -1; - } - function d3_time_parseYear(date, string, i) { - d3_time_numberRe.lastIndex = 0; - var n = d3_time_numberRe.exec(string.slice(i, i + 2)); - return n ? (date.y = d3_time_expandYear(+n[0]), i + n[0].length) : -1; - } - function d3_time_parseZone(date, string, i) { - return /^[+-]\d{4}$/.test(string = string.slice(i, i + 5)) ? (date.Z = -string, - i + 5) : -1; - } - function d3_time_expandYear(d) { - return d + (d > 68 ? 1900 : 2e3); - } - function d3_time_parseMonthNumber(date, string, i) { - d3_time_numberRe.lastIndex = 0; - var n = d3_time_numberRe.exec(string.slice(i, i + 2)); - return n ? (date.m = n[0] - 1, i + n[0].length) : -1; - } - function d3_time_parseDay(date, string, i) { - d3_time_numberRe.lastIndex = 0; - var n = d3_time_numberRe.exec(string.slice(i, i + 2)); - return n ? (date.d = +n[0], i + n[0].length) : -1; - } - function d3_time_parseDayOfYear(date, string, i) { - d3_time_numberRe.lastIndex = 0; - var n = d3_time_numberRe.exec(string.slice(i, i + 3)); - return n ? (date.j = +n[0], i + n[0].length) : -1; - } - function d3_time_parseHour24(date, string, i) { - d3_time_numberRe.lastIndex = 0; - var n = d3_time_numberRe.exec(string.slice(i, i + 2)); - return n ? (date.H = +n[0], i + n[0].length) : -1; - } - function d3_time_parseMinutes(date, string, i) { - d3_time_numberRe.lastIndex = 0; - var n = d3_time_numberRe.exec(string.slice(i, i + 2)); - return n ? (date.M = +n[0], i + n[0].length) : -1; - } - function d3_time_parseSeconds(date, string, i) { - d3_time_numberRe.lastIndex = 0; - var n = d3_time_numberRe.exec(string.slice(i, i + 2)); - return n ? (date.S = +n[0], i + n[0].length) : -1; - } - function d3_time_parseMilliseconds(date, string, i) { - d3_time_numberRe.lastIndex = 0; - var n = d3_time_numberRe.exec(string.slice(i, i + 3)); - return n ? (date.L = +n[0], i + n[0].length) : -1; - } - function d3_time_zone(d) { - var z = d.getTimezoneOffset(), zs = z > 0 ? "-" : "+", zh = abs(z) / 60 | 0, zm = abs(z) % 60; - return zs + d3_time_formatPad(zh, "0", 2) + d3_time_formatPad(zm, "0", 2); - } - function d3_time_parseLiteralPercent(date, string, i) { - d3_time_percentRe.lastIndex = 0; - var n = d3_time_percentRe.exec(string.slice(i, i + 1)); - return n ? i + n[0].length : -1; - } - function d3_time_formatMulti(formats) { - var n = formats.length, i = -1; - while (++i < n) formats[i][0] = this(formats[i][0]); - return function(date) { - var i = 0, f = formats[i]; - while (!f[1](date)) f = formats[++i]; - return f[0](date); - }; - } - d3.locale = function(locale) { - return { - numberFormat: d3_locale_numberFormat(locale), - timeFormat: d3_locale_timeFormat(locale) - }; - }; - var d3_locale_enUS = d3.locale({ - decimal: ".", - thousands: ",", - grouping: [ 3 ], - currency: [ "$", "" ], - dateTime: "%a %b %e %X %Y", - date: "%m/%d/%Y", - time: "%H:%M:%S", - periods: [ "AM", "PM" ], - days: [ "Sunday", "Monday", "Tuesday", "Wednesday", "Thursday", "Friday", "Saturday" ], - shortDays: [ "Sun", "Mon", "Tue", "Wed", "Thu", "Fri", "Sat" ], - months: [ "January", "February", "March", "April", "May", "June", "July", "August", "September", "October", "November", "December" ], - shortMonths: [ "Jan", "Feb", "Mar", "Apr", "May", "Jun", "Jul", "Aug", "Sep", "Oct", "Nov", "Dec" ] - }); - d3.format = d3_locale_enUS.numberFormat; - d3.geo = {}; - function d3_adder() {} - d3_adder.prototype = { - s: 0, - t: 0, - add: function(y) { - d3_adderSum(y, this.t, d3_adderTemp); - d3_adderSum(d3_adderTemp.s, this.s, this); - if (this.s) this.t += d3_adderTemp.t; else this.s = d3_adderTemp.t; - }, - reset: function() { - this.s = this.t = 0; - }, - valueOf: function() { - return this.s; - } - }; - var d3_adderTemp = new d3_adder(); - function d3_adderSum(a, b, o) { - var x = o.s = a + b, bv = x - a, av = x - bv; - o.t = a - av + (b - bv); - } - d3.geo.stream = function(object, listener) { - if (object && d3_geo_streamObjectType.hasOwnProperty(object.type)) { - d3_geo_streamObjectType[object.type](object, listener); - } else { - d3_geo_streamGeometry(object, listener); - } - }; - function d3_geo_streamGeometry(geometry, listener) { - if (geometry && d3_geo_streamGeometryType.hasOwnProperty(geometry.type)) { - d3_geo_streamGeometryType[geometry.type](geometry, listener); - } - } - var d3_geo_streamObjectType = { - Feature: function(feature, listener) { - d3_geo_streamGeometry(feature.geometry, listener); - }, - FeatureCollection: function(object, listener) { - var features = object.features, i = -1, n = features.length; - while (++i < n) d3_geo_streamGeometry(features[i].geometry, listener); - } - }; - var d3_geo_streamGeometryType = { - Sphere: function(object, listener) { - listener.sphere(); - }, - Point: function(object, listener) { - object = object.coordinates; - listener.point(object[0], object[1], object[2]); - }, - MultiPoint: function(object, listener) { - var coordinates = object.coordinates, i = -1, n = coordinates.length; - while (++i < n) object = coordinates[i], listener.point(object[0], object[1], object[2]); - }, - LineString: function(object, listener) { - d3_geo_streamLine(object.coordinates, listener, 0); - }, - MultiLineString: function(object, listener) { - var coordinates = object.coordinates, i = -1, n = coordinates.length; - while (++i < n) d3_geo_streamLine(coordinates[i], listener, 0); - }, - Polygon: function(object, listener) { - d3_geo_streamPolygon(object.coordinates, listener); - }, - MultiPolygon: function(object, listener) { - var coordinates = object.coordinates, i = -1, n = coordinates.length; - while (++i < n) d3_geo_streamPolygon(coordinates[i], listener); - }, - GeometryCollection: function(object, listener) { - var geometries = object.geometries, i = -1, n = geometries.length; - while (++i < n) d3_geo_streamGeometry(geometries[i], listener); - } - }; - function d3_geo_streamLine(coordinates, listener, closed) { - var i = -1, n = coordinates.length - closed, coordinate; - listener.lineStart(); - while (++i < n) coordinate = coordinates[i], listener.point(coordinate[0], coordinate[1], coordinate[2]); - listener.lineEnd(); - } - function d3_geo_streamPolygon(coordinates, listener) { - var i = -1, n = coordinates.length; - listener.polygonStart(); - while (++i < n) d3_geo_streamLine(coordinates[i], listener, 1); - listener.polygonEnd(); - } - d3.geo.area = function(object) { - d3_geo_areaSum = 0; - d3.geo.stream(object, d3_geo_area); - return d3_geo_areaSum; - }; - var d3_geo_areaSum, d3_geo_areaRingSum = new d3_adder(); - var d3_geo_area = { - sphere: function() { - d3_geo_areaSum += 4 * π; - }, - point: d3_noop, - lineStart: d3_noop, - lineEnd: d3_noop, - polygonStart: function() { - d3_geo_areaRingSum.reset(); - d3_geo_area.lineStart = d3_geo_areaRingStart; - }, - polygonEnd: function() { - var area = 2 * d3_geo_areaRingSum; - d3_geo_areaSum += area < 0 ? 4 * π + area : area; - d3_geo_area.lineStart = d3_geo_area.lineEnd = d3_geo_area.point = d3_noop; - } - }; - function d3_geo_areaRingStart() { - var λ00, φ00, λ0, cosφ0, sinφ0; - d3_geo_area.point = function(λ, φ) { - d3_geo_area.point = nextPoint; - λ0 = (λ00 = λ) * d3_radians, cosφ0 = Math.cos(φ = (φ00 = φ) * d3_radians / 2 + π / 4), - sinφ0 = Math.sin(φ); - }; - function nextPoint(λ, φ) { - λ *= d3_radians; - φ = φ * d3_radians / 2 + π / 4; - var dλ = λ - λ0, sdλ = dλ >= 0 ? 1 : -1, adλ = sdλ * dλ, cosφ = Math.cos(φ), sinφ = Math.sin(φ), k = sinφ0 * sinφ, u = cosφ0 * cosφ + k * Math.cos(adλ), v = k * sdλ * Math.sin(adλ); - d3_geo_areaRingSum.add(Math.atan2(v, u)); - λ0 = λ, cosφ0 = cosφ, sinφ0 = sinφ; - } - d3_geo_area.lineEnd = function() { - nextPoint(λ00, φ00); - }; - } - function d3_geo_cartesian(spherical) { - var λ = spherical[0], φ = spherical[1], cosφ = Math.cos(φ); - return [ cosφ * Math.cos(λ), cosφ * Math.sin(λ), Math.sin(φ) ]; - } - function d3_geo_cartesianDot(a, b) { - return a[0] * b[0] + a[1] * b[1] + a[2] * b[2]; - } - function d3_geo_cartesianCross(a, b) { - return [ a[1] * b[2] - a[2] * b[1], a[2] * b[0] - a[0] * b[2], a[0] * b[1] - a[1] * b[0] ]; - } - function d3_geo_cartesianAdd(a, b) { - a[0] += b[0]; - a[1] += b[1]; - a[2] += b[2]; - } - function d3_geo_cartesianScale(vector, k) { - return [ vector[0] * k, vector[1] * k, vector[2] * k ]; - } - function d3_geo_cartesianNormalize(d) { - var l = Math.sqrt(d[0] * d[0] + d[1] * d[1] + d[2] * d[2]); - d[0] /= l; - d[1] /= l; - d[2] /= l; - } - function d3_geo_spherical(cartesian) { - return [ Math.atan2(cartesian[1], cartesian[0]), d3_asin(cartesian[2]) ]; - } - function d3_geo_sphericalEqual(a, b) { - return abs(a[0] - b[0]) < ε && abs(a[1] - b[1]) < ε; - } - d3.geo.bounds = function() { - var λ0, φ0, λ1, φ1, λ_, λ__, φ__, p0, dλSum, ranges, range; - var bound = { - point: point, - lineStart: lineStart, - lineEnd: lineEnd, - polygonStart: function() { - bound.point = ringPoint; - bound.lineStart = ringStart; - bound.lineEnd = ringEnd; - dλSum = 0; - d3_geo_area.polygonStart(); - }, - polygonEnd: function() { - d3_geo_area.polygonEnd(); - bound.point = point; - bound.lineStart = lineStart; - bound.lineEnd = lineEnd; - if (d3_geo_areaRingSum < 0) λ0 = -(λ1 = 180), φ0 = -(φ1 = 90); else if (dλSum > ε) φ1 = 90; else if (dλSum < -ε) φ0 = -90; - range[0] = λ0, range[1] = λ1; - } - }; - function point(λ, φ) { - ranges.push(range = [ λ0 = λ, λ1 = λ ]); - if (φ < φ0) φ0 = φ; - if (φ > φ1) φ1 = φ; - } - function linePoint(λ, φ) { - var p = d3_geo_cartesian([ λ * d3_radians, φ * d3_radians ]); - if (p0) { - var normal = d3_geo_cartesianCross(p0, p), equatorial = [ normal[1], -normal[0], 0 ], inflection = d3_geo_cartesianCross(equatorial, normal); - d3_geo_cartesianNormalize(inflection); - inflection = d3_geo_spherical(inflection); - var dλ = λ - λ_, s = dλ > 0 ? 1 : -1, λi = inflection[0] * d3_degrees * s, antimeridian = abs(dλ) > 180; - if (antimeridian ^ (s * λ_ < λi && λi < s * λ)) { - var φi = inflection[1] * d3_degrees; - if (φi > φ1) φ1 = φi; - } else if (λi = (λi + 360) % 360 - 180, antimeridian ^ (s * λ_ < λi && λi < s * λ)) { - var φi = -inflection[1] * d3_degrees; - if (φi < φ0) φ0 = φi; - } else { - if (φ < φ0) φ0 = φ; - if (φ > φ1) φ1 = φ; - } - if (antimeridian) { - if (λ < λ_) { - if (angle(λ0, λ) > angle(λ0, λ1)) λ1 = λ; - } else { - if (angle(λ, λ1) > angle(λ0, λ1)) λ0 = λ; - } - } else { - if (λ1 >= λ0) { - if (λ < λ0) λ0 = λ; - if (λ > λ1) λ1 = λ; - } else { - if (λ > λ_) { - if (angle(λ0, λ) > angle(λ0, λ1)) λ1 = λ; - } else { - if (angle(λ, λ1) > angle(λ0, λ1)) λ0 = λ; - } - } - } - } else { - point(λ, φ); - } - p0 = p, λ_ = λ; - } - function lineStart() { - bound.point = linePoint; - } - function lineEnd() { - range[0] = λ0, range[1] = λ1; - bound.point = point; - p0 = null; - } - function ringPoint(λ, φ) { - if (p0) { - var dλ = λ - λ_; - dλSum += abs(dλ) > 180 ? dλ + (dλ > 0 ? 360 : -360) : dλ; - } else λ__ = λ, φ__ = φ; - d3_geo_area.point(λ, φ); - linePoint(λ, φ); - } - function ringStart() { - d3_geo_area.lineStart(); - } - function ringEnd() { - ringPoint(λ__, φ__); - d3_geo_area.lineEnd(); - if (abs(dλSum) > ε) λ0 = -(λ1 = 180); - range[0] = λ0, range[1] = λ1; - p0 = null; - } - function angle(λ0, λ1) { - return (λ1 -= λ0) < 0 ? λ1 + 360 : λ1; - } - function compareRanges(a, b) { - return a[0] - b[0]; - } - function withinRange(x, range) { - return range[0] <= range[1] ? range[0] <= x && x <= range[1] : x < range[0] || range[1] < x; - } - return function(feature) { - φ1 = λ1 = -(λ0 = φ0 = Infinity); - ranges = []; - d3.geo.stream(feature, bound); - var n = ranges.length; - if (n) { - ranges.sort(compareRanges); - for (var i = 1, a = ranges[0], b, merged = [ a ]; i < n; ++i) { - b = ranges[i]; - if (withinRange(b[0], a) || withinRange(b[1], a)) { - if (angle(a[0], b[1]) > angle(a[0], a[1])) a[1] = b[1]; - if (angle(b[0], a[1]) > angle(a[0], a[1])) a[0] = b[0]; - } else { - merged.push(a = b); - } - } - var best = -Infinity, dλ; - for (var n = merged.length - 1, i = 0, a = merged[n], b; i <= n; a = b, ++i) { - b = merged[i]; - if ((dλ = angle(a[1], b[0])) > best) best = dλ, λ0 = b[0], λ1 = a[1]; - } - } - ranges = range = null; - return λ0 === Infinity || φ0 === Infinity ? [ [ NaN, NaN ], [ NaN, NaN ] ] : [ [ λ0, φ0 ], [ λ1, φ1 ] ]; - }; - }(); - d3.geo.centroid = function(object) { - d3_geo_centroidW0 = d3_geo_centroidW1 = d3_geo_centroidX0 = d3_geo_centroidY0 = d3_geo_centroidZ0 = d3_geo_centroidX1 = d3_geo_centroidY1 = d3_geo_centroidZ1 = d3_geo_centroidX2 = d3_geo_centroidY2 = d3_geo_centroidZ2 = 0; - d3.geo.stream(object, d3_geo_centroid); - var x = d3_geo_centroidX2, y = d3_geo_centroidY2, z = d3_geo_centroidZ2, m = x * x + y * y + z * z; - if (m < ε2) { - x = d3_geo_centroidX1, y = d3_geo_centroidY1, z = d3_geo_centroidZ1; - if (d3_geo_centroidW1 < ε) x = d3_geo_centroidX0, y = d3_geo_centroidY0, z = d3_geo_centroidZ0; - m = x * x + y * y + z * z; - if (m < ε2) return [ NaN, NaN ]; - } - return [ Math.atan2(y, x) * d3_degrees, d3_asin(z / Math.sqrt(m)) * d3_degrees ]; - }; - var d3_geo_centroidW0, d3_geo_centroidW1, d3_geo_centroidX0, d3_geo_centroidY0, d3_geo_centroidZ0, d3_geo_centroidX1, d3_geo_centroidY1, d3_geo_centroidZ1, d3_geo_centroidX2, d3_geo_centroidY2, d3_geo_centroidZ2; - var d3_geo_centroid = { - sphere: d3_noop, - point: d3_geo_centroidPoint, - lineStart: d3_geo_centroidLineStart, - lineEnd: d3_geo_centroidLineEnd, - polygonStart: function() { - d3_geo_centroid.lineStart = d3_geo_centroidRingStart; - }, - polygonEnd: function() { - d3_geo_centroid.lineStart = d3_geo_centroidLineStart; - } - }; - function d3_geo_centroidPoint(λ, φ) { - λ *= d3_radians; - var cosφ = Math.cos(φ *= d3_radians); - d3_geo_centroidPointXYZ(cosφ * Math.cos(λ), cosφ * Math.sin(λ), Math.sin(φ)); - } - function d3_geo_centroidPointXYZ(x, y, z) { - ++d3_geo_centroidW0; - d3_geo_centroidX0 += (x - d3_geo_centroidX0) / d3_geo_centroidW0; - d3_geo_centroidY0 += (y - d3_geo_centroidY0) / d3_geo_centroidW0; - d3_geo_centroidZ0 += (z - d3_geo_centroidZ0) / d3_geo_centroidW0; - } - function d3_geo_centroidLineStart() { - var x0, y0, z0; - d3_geo_centroid.point = function(λ, φ) { - λ *= d3_radians; - var cosφ = Math.cos(φ *= d3_radians); - x0 = cosφ * Math.cos(λ); - y0 = cosφ * Math.sin(λ); - z0 = Math.sin(φ); - d3_geo_centroid.point = nextPoint; - d3_geo_centroidPointXYZ(x0, y0, z0); - }; - function nextPoint(λ, φ) { - λ *= d3_radians; - var cosφ = Math.cos(φ *= d3_radians), x = cosφ * Math.cos(λ), y = cosφ * Math.sin(λ), z = Math.sin(φ), w = Math.atan2(Math.sqrt((w = y0 * z - z0 * y) * w + (w = z0 * x - x0 * z) * w + (w = x0 * y - y0 * x) * w), x0 * x + y0 * y + z0 * z); - d3_geo_centroidW1 += w; - d3_geo_centroidX1 += w * (x0 + (x0 = x)); - d3_geo_centroidY1 += w * (y0 + (y0 = y)); - d3_geo_centroidZ1 += w * (z0 + (z0 = z)); - d3_geo_centroidPointXYZ(x0, y0, z0); - } - } - function d3_geo_centroidLineEnd() { - d3_geo_centroid.point = d3_geo_centroidPoint; - } - function d3_geo_centroidRingStart() { - var λ00, φ00, x0, y0, z0; - d3_geo_centroid.point = function(λ, φ) { - λ00 = λ, φ00 = φ; - d3_geo_centroid.point = nextPoint; - λ *= d3_radians; - var cosφ = Math.cos(φ *= d3_radians); - x0 = cosφ * Math.cos(λ); - y0 = cosφ * Math.sin(λ); - z0 = Math.sin(φ); - d3_geo_centroidPointXYZ(x0, y0, z0); - }; - d3_geo_centroid.lineEnd = function() { - nextPoint(λ00, φ00); - d3_geo_centroid.lineEnd = d3_geo_centroidLineEnd; - d3_geo_centroid.point = d3_geo_centroidPoint; - }; - function nextPoint(λ, φ) { - λ *= d3_radians; - var cosφ = Math.cos(φ *= d3_radians), x = cosφ * Math.cos(λ), y = cosφ * Math.sin(λ), z = Math.sin(φ), cx = y0 * z - z0 * y, cy = z0 * x - x0 * z, cz = x0 * y - y0 * x, m = Math.sqrt(cx * cx + cy * cy + cz * cz), u = x0 * x + y0 * y + z0 * z, v = m && -d3_acos(u) / m, w = Math.atan2(m, u); - d3_geo_centroidX2 += v * cx; - d3_geo_centroidY2 += v * cy; - d3_geo_centroidZ2 += v * cz; - d3_geo_centroidW1 += w; - d3_geo_centroidX1 += w * (x0 + (x0 = x)); - d3_geo_centroidY1 += w * (y0 + (y0 = y)); - d3_geo_centroidZ1 += w * (z0 + (z0 = z)); - d3_geo_centroidPointXYZ(x0, y0, z0); - } - } - function d3_geo_compose(a, b) { - function compose(x, y) { - return x = a(x, y), b(x[0], x[1]); - } - if (a.invert && b.invert) compose.invert = function(x, y) { - return x = b.invert(x, y), x && a.invert(x[0], x[1]); - }; - return compose; - } - function d3_true() { - return true; - } - function d3_geo_clipPolygon(segments, compare, clipStartInside, interpolate, listener) { - var subject = [], clip = []; - segments.forEach(function(segment) { - if ((n = segment.length - 1) <= 0) return; - var n, p0 = segment[0], p1 = segment[n]; - if (d3_geo_sphericalEqual(p0, p1)) { - listener.lineStart(); - for (var i = 0; i < n; ++i) listener.point((p0 = segment[i])[0], p0[1]); - listener.lineEnd(); - return; - } - var a = new d3_geo_clipPolygonIntersection(p0, segment, null, true), b = new d3_geo_clipPolygonIntersection(p0, null, a, false); - a.o = b; - subject.push(a); - clip.push(b); - a = new d3_geo_clipPolygonIntersection(p1, segment, null, false); - b = new d3_geo_clipPolygonIntersection(p1, null, a, true); - a.o = b; - subject.push(a); - clip.push(b); - }); - clip.sort(compare); - d3_geo_clipPolygonLinkCircular(subject); - d3_geo_clipPolygonLinkCircular(clip); - if (!subject.length) return; - for (var i = 0, entry = clipStartInside, n = clip.length; i < n; ++i) { - clip[i].e = entry = !entry; - } - var start = subject[0], points, point; - while (1) { - var current = start, isSubject = true; - while (current.v) if ((current = current.n) === start) return; - points = current.z; - listener.lineStart(); - do { - current.v = current.o.v = true; - if (current.e) { - if (isSubject) { - for (var i = 0, n = points.length; i < n; ++i) listener.point((point = points[i])[0], point[1]); - } else { - interpolate(current.x, current.n.x, 1, listener); - } - current = current.n; - } else { - if (isSubject) { - points = current.p.z; - for (var i = points.length - 1; i >= 0; --i) listener.point((point = points[i])[0], point[1]); - } else { - interpolate(current.x, current.p.x, -1, listener); - } - current = current.p; - } - current = current.o; - points = current.z; - isSubject = !isSubject; - } while (!current.v); - listener.lineEnd(); - } - } - function d3_geo_clipPolygonLinkCircular(array) { - if (!(n = array.length)) return; - var n, i = 0, a = array[0], b; - while (++i < n) { - a.n = b = array[i]; - b.p = a; - a = b; - } - a.n = b = array[0]; - b.p = a; - } - function d3_geo_clipPolygonIntersection(point, points, other, entry) { - this.x = point; - this.z = points; - this.o = other; - this.e = entry; - this.v = false; - this.n = this.p = null; - } - function d3_geo_clip(pointVisible, clipLine, interpolate, clipStart) { - return function(rotate, listener) { - var line = clipLine(listener), rotatedClipStart = rotate.invert(clipStart[0], clipStart[1]); - var clip = { - point: point, - lineStart: lineStart, - lineEnd: lineEnd, - polygonStart: function() { - clip.point = pointRing; - clip.lineStart = ringStart; - clip.lineEnd = ringEnd; - segments = []; - polygon = []; - }, - polygonEnd: function() { - clip.point = point; - clip.lineStart = lineStart; - clip.lineEnd = lineEnd; - segments = d3.merge(segments); - var clipStartInside = d3_geo_pointInPolygon(rotatedClipStart, polygon); - if (segments.length) { - if (!polygonStarted) listener.polygonStart(), polygonStarted = true; - d3_geo_clipPolygon(segments, d3_geo_clipSort, clipStartInside, interpolate, listener); - } else if (clipStartInside) { - if (!polygonStarted) listener.polygonStart(), polygonStarted = true; - listener.lineStart(); - interpolate(null, null, 1, listener); - listener.lineEnd(); - } - if (polygonStarted) listener.polygonEnd(), polygonStarted = false; - segments = polygon = null; - }, - sphere: function() { - listener.polygonStart(); - listener.lineStart(); - interpolate(null, null, 1, listener); - listener.lineEnd(); - listener.polygonEnd(); - } - }; - function point(λ, φ) { - var point = rotate(λ, φ); - if (pointVisible(λ = point[0], φ = point[1])) listener.point(λ, φ); - } - function pointLine(λ, φ) { - var point = rotate(λ, φ); - line.point(point[0], point[1]); - } - function lineStart() { - clip.point = pointLine; - line.lineStart(); - } - function lineEnd() { - clip.point = point; - line.lineEnd(); - } - var segments; - var buffer = d3_geo_clipBufferListener(), ringListener = clipLine(buffer), polygonStarted = false, polygon, ring; - function pointRing(λ, φ) { - ring.push([ λ, φ ]); - var point = rotate(λ, φ); - ringListener.point(point[0], point[1]); - } - function ringStart() { - ringListener.lineStart(); - ring = []; - } - function ringEnd() { - pointRing(ring[0][0], ring[0][1]); - ringListener.lineEnd(); - var clean = ringListener.clean(), ringSegments = buffer.buffer(), segment, n = ringSegments.length; - ring.pop(); - polygon.push(ring); - ring = null; - if (!n) return; - if (clean & 1) { - segment = ringSegments[0]; - var n = segment.length - 1, i = -1, point; - if (n > 0) { - if (!polygonStarted) listener.polygonStart(), polygonStarted = true; - listener.lineStart(); - while (++i < n) listener.point((point = segment[i])[0], point[1]); - listener.lineEnd(); - } - return; - } - if (n > 1 && clean & 2) ringSegments.push(ringSegments.pop().concat(ringSegments.shift())); - segments.push(ringSegments.filter(d3_geo_clipSegmentLength1)); - } - return clip; - }; - } - function d3_geo_clipSegmentLength1(segment) { - return segment.length > 1; - } - function d3_geo_clipBufferListener() { - var lines = [], line; - return { - lineStart: function() { - lines.push(line = []); - }, - point: function(λ, φ) { - line.push([ λ, φ ]); - }, - lineEnd: d3_noop, - buffer: function() { - var buffer = lines; - lines = []; - line = null; - return buffer; - }, - rejoin: function() { - if (lines.length > 1) lines.push(lines.pop().concat(lines.shift())); - } - }; - } - function d3_geo_clipSort(a, b) { - return ((a = a.x)[0] < 0 ? a[1] - halfπ - ε : halfπ - a[1]) - ((b = b.x)[0] < 0 ? b[1] - halfπ - ε : halfπ - b[1]); - } - var d3_geo_clipAntimeridian = d3_geo_clip(d3_true, d3_geo_clipAntimeridianLine, d3_geo_clipAntimeridianInterpolate, [ -π, -π / 2 ]); - function d3_geo_clipAntimeridianLine(listener) { - var λ0 = NaN, φ0 = NaN, sλ0 = NaN, clean; - return { - lineStart: function() { - listener.lineStart(); - clean = 1; - }, - point: function(λ1, φ1) { - var sλ1 = λ1 > 0 ? π : -π, dλ = abs(λ1 - λ0); - if (abs(dλ - π) < ε) { - listener.point(λ0, φ0 = (φ0 + φ1) / 2 > 0 ? halfπ : -halfπ); - listener.point(sλ0, φ0); - listener.lineEnd(); - listener.lineStart(); - listener.point(sλ1, φ0); - listener.point(λ1, φ0); - clean = 0; - } else if (sλ0 !== sλ1 && dλ >= π) { - if (abs(λ0 - sλ0) < ε) λ0 -= sλ0 * ε; - if (abs(λ1 - sλ1) < ε) λ1 -= sλ1 * ε; - φ0 = d3_geo_clipAntimeridianIntersect(λ0, φ0, λ1, φ1); - listener.point(sλ0, φ0); - listener.lineEnd(); - listener.lineStart(); - listener.point(sλ1, φ0); - clean = 0; - } - listener.point(λ0 = λ1, φ0 = φ1); - sλ0 = sλ1; - }, - lineEnd: function() { - listener.lineEnd(); - λ0 = φ0 = NaN; - }, - clean: function() { - return 2 - clean; - } - }; - } - function d3_geo_clipAntimeridianIntersect(λ0, φ0, λ1, φ1) { - var cosφ0, cosφ1, sinλ0_λ1 = Math.sin(λ0 - λ1); - return abs(sinλ0_λ1) > ε ? Math.atan((Math.sin(φ0) * (cosφ1 = Math.cos(φ1)) * Math.sin(λ1) - Math.sin(φ1) * (cosφ0 = Math.cos(φ0)) * Math.sin(λ0)) / (cosφ0 * cosφ1 * sinλ0_λ1)) : (φ0 + φ1) / 2; - } - function d3_geo_clipAntimeridianInterpolate(from, to, direction, listener) { - var φ; - if (from == null) { - φ = direction * halfπ; - listener.point(-π, φ); - listener.point(0, φ); - listener.point(π, φ); - listener.point(π, 0); - listener.point(π, -φ); - listener.point(0, -φ); - listener.point(-π, -φ); - listener.point(-π, 0); - listener.point(-π, φ); - } else if (abs(from[0] - to[0]) > ε) { - var s = from[0] < to[0] ? π : -π; - φ = direction * s / 2; - listener.point(-s, φ); - listener.point(0, φ); - listener.point(s, φ); - } else { - listener.point(to[0], to[1]); - } - } - function d3_geo_pointInPolygon(point, polygon) { - var meridian = point[0], parallel = point[1], meridianNormal = [ Math.sin(meridian), -Math.cos(meridian), 0 ], polarAngle = 0, winding = 0; - d3_geo_areaRingSum.reset(); - for (var i = 0, n = polygon.length; i < n; ++i) { - var ring = polygon[i], m = ring.length; - if (!m) continue; - var point0 = ring[0], λ0 = point0[0], φ0 = point0[1] / 2 + π / 4, sinφ0 = Math.sin(φ0), cosφ0 = Math.cos(φ0), j = 1; - while (true) { - if (j === m) j = 0; - point = ring[j]; - var λ = point[0], φ = point[1] / 2 + π / 4, sinφ = Math.sin(φ), cosφ = Math.cos(φ), dλ = λ - λ0, sdλ = dλ >= 0 ? 1 : -1, adλ = sdλ * dλ, antimeridian = adλ > π, k = sinφ0 * sinφ; - d3_geo_areaRingSum.add(Math.atan2(k * sdλ * Math.sin(adλ), cosφ0 * cosφ + k * Math.cos(adλ))); - polarAngle += antimeridian ? dλ + sdλ * τ : dλ; - if (antimeridian ^ λ0 >= meridian ^ λ >= meridian) { - var arc = d3_geo_cartesianCross(d3_geo_cartesian(point0), d3_geo_cartesian(point)); - d3_geo_cartesianNormalize(arc); - var intersection = d3_geo_cartesianCross(meridianNormal, arc); - d3_geo_cartesianNormalize(intersection); - var φarc = (antimeridian ^ dλ >= 0 ? -1 : 1) * d3_asin(intersection[2]); - if (parallel > φarc || parallel === φarc && (arc[0] || arc[1])) { - winding += antimeridian ^ dλ >= 0 ? 1 : -1; - } - } - if (!j++) break; - λ0 = λ, sinφ0 = sinφ, cosφ0 = cosφ, point0 = point; - } - } - return (polarAngle < -ε || polarAngle < ε && d3_geo_areaRingSum < 0) ^ winding & 1; - } - function d3_geo_clipCircle(radius) { - var cr = Math.cos(radius), smallRadius = cr > 0, notHemisphere = abs(cr) > ε, interpolate = d3_geo_circleInterpolate(radius, 6 * d3_radians); - return d3_geo_clip(visible, clipLine, interpolate, smallRadius ? [ 0, -radius ] : [ -π, radius - π ]); - function visible(λ, φ) { - return Math.cos(λ) * Math.cos(φ) > cr; - } - function clipLine(listener) { - var point0, c0, v0, v00, clean; - return { - lineStart: function() { - v00 = v0 = false; - clean = 1; - }, - point: function(λ, φ) { - var point1 = [ λ, φ ], point2, v = visible(λ, φ), c = smallRadius ? v ? 0 : code(λ, φ) : v ? code(λ + (λ < 0 ? π : -π), φ) : 0; - if (!point0 && (v00 = v0 = v)) listener.lineStart(); - if (v !== v0) { - point2 = intersect(point0, point1); - if (d3_geo_sphericalEqual(point0, point2) || d3_geo_sphericalEqual(point1, point2)) { - point1[0] += ε; - point1[1] += ε; - v = visible(point1[0], point1[1]); - } - } - if (v !== v0) { - clean = 0; - if (v) { - listener.lineStart(); - point2 = intersect(point1, point0); - listener.point(point2[0], point2[1]); - } else { - point2 = intersect(point0, point1); - listener.point(point2[0], point2[1]); - listener.lineEnd(); - } - point0 = point2; - } else if (notHemisphere && point0 && smallRadius ^ v) { - var t; - if (!(c & c0) && (t = intersect(point1, point0, true))) { - clean = 0; - if (smallRadius) { - listener.lineStart(); - listener.point(t[0][0], t[0][1]); - listener.point(t[1][0], t[1][1]); - listener.lineEnd(); - } else { - listener.point(t[1][0], t[1][1]); - listener.lineEnd(); - listener.lineStart(); - listener.point(t[0][0], t[0][1]); - } - } - } - if (v && (!point0 || !d3_geo_sphericalEqual(point0, point1))) { - listener.point(point1[0], point1[1]); - } - point0 = point1, v0 = v, c0 = c; - }, - lineEnd: function() { - if (v0) listener.lineEnd(); - point0 = null; - }, - clean: function() { - return clean | (v00 && v0) << 1; - } - }; - } - function intersect(a, b, two) { - var pa = d3_geo_cartesian(a), pb = d3_geo_cartesian(b); - var n1 = [ 1, 0, 0 ], n2 = d3_geo_cartesianCross(pa, pb), n2n2 = d3_geo_cartesianDot(n2, n2), n1n2 = n2[0], determinant = n2n2 - n1n2 * n1n2; - if (!determinant) return !two && a; - var c1 = cr * n2n2 / determinant, c2 = -cr * n1n2 / determinant, n1xn2 = d3_geo_cartesianCross(n1, n2), A = d3_geo_cartesianScale(n1, c1), B = d3_geo_cartesianScale(n2, c2); - d3_geo_cartesianAdd(A, B); - var u = n1xn2, w = d3_geo_cartesianDot(A, u), uu = d3_geo_cartesianDot(u, u), t2 = w * w - uu * (d3_geo_cartesianDot(A, A) - 1); - if (t2 < 0) return; - var t = Math.sqrt(t2), q = d3_geo_cartesianScale(u, (-w - t) / uu); - d3_geo_cartesianAdd(q, A); - q = d3_geo_spherical(q); - if (!two) return q; - var λ0 = a[0], λ1 = b[0], φ0 = a[1], φ1 = b[1], z; - if (λ1 < λ0) z = λ0, λ0 = λ1, λ1 = z; - var δλ = λ1 - λ0, polar = abs(δλ - π) < ε, meridian = polar || δλ < ε; - if (!polar && φ1 < φ0) z = φ0, φ0 = φ1, φ1 = z; - if (meridian ? polar ? φ0 + φ1 > 0 ^ q[1] < (abs(q[0] - λ0) < ε ? φ0 : φ1) : φ0 <= q[1] && q[1] <= φ1 : δλ > π ^ (λ0 <= q[0] && q[0] <= λ1)) { - var q1 = d3_geo_cartesianScale(u, (-w + t) / uu); - d3_geo_cartesianAdd(q1, A); - return [ q, d3_geo_spherical(q1) ]; - } - } - function code(λ, φ) { - var r = smallRadius ? radius : π - radius, code = 0; - if (λ < -r) code |= 1; else if (λ > r) code |= 2; - if (φ < -r) code |= 4; else if (φ > r) code |= 8; - return code; - } - } - function d3_geom_clipLine(x0, y0, x1, y1) { - return function(line) { - var a = line.a, b = line.b, ax = a.x, ay = a.y, bx = b.x, by = b.y, t0 = 0, t1 = 1, dx = bx - ax, dy = by - ay, r; - r = x0 - ax; - if (!dx && r > 0) return; - r /= dx; - if (dx < 0) { - if (r < t0) return; - if (r < t1) t1 = r; - } else if (dx > 0) { - if (r > t1) return; - if (r > t0) t0 = r; - } - r = x1 - ax; - if (!dx && r < 0) return; - r /= dx; - if (dx < 0) { - if (r > t1) return; - if (r > t0) t0 = r; - } else if (dx > 0) { - if (r < t0) return; - if (r < t1) t1 = r; - } - r = y0 - ay; - if (!dy && r > 0) return; - r /= dy; - if (dy < 0) { - if (r < t0) return; - if (r < t1) t1 = r; - } else if (dy > 0) { - if (r > t1) return; - if (r > t0) t0 = r; - } - r = y1 - ay; - if (!dy && r < 0) return; - r /= dy; - if (dy < 0) { - if (r > t1) return; - if (r > t0) t0 = r; - } else if (dy > 0) { - if (r < t0) return; - if (r < t1) t1 = r; - } - if (t0 > 0) line.a = { - x: ax + t0 * dx, - y: ay + t0 * dy - }; - if (t1 < 1) line.b = { - x: ax + t1 * dx, - y: ay + t1 * dy - }; - return line; - }; - } - var d3_geo_clipExtentMAX = 1e9; - d3.geo.clipExtent = function() { - var x0, y0, x1, y1, stream, clip, clipExtent = { - stream: function(output) { - if (stream) stream.valid = false; - stream = clip(output); - stream.valid = true; - return stream; - }, - extent: function(_) { - if (!arguments.length) return [ [ x0, y0 ], [ x1, y1 ] ]; - clip = d3_geo_clipExtent(x0 = +_[0][0], y0 = +_[0][1], x1 = +_[1][0], y1 = +_[1][1]); - if (stream) stream.valid = false, stream = null; - return clipExtent; - } - }; - return clipExtent.extent([ [ 0, 0 ], [ 960, 500 ] ]); - }; - function d3_geo_clipExtent(x0, y0, x1, y1) { - return function(listener) { - var listener_ = listener, bufferListener = d3_geo_clipBufferListener(), clipLine = d3_geom_clipLine(x0, y0, x1, y1), segments, polygon, ring; - var clip = { - point: point, - lineStart: lineStart, - lineEnd: lineEnd, - polygonStart: function() { - listener = bufferListener; - segments = []; - polygon = []; - clean = true; - }, - polygonEnd: function() { - listener = listener_; - segments = d3.merge(segments); - var clipStartInside = insidePolygon([ x0, y1 ]), inside = clean && clipStartInside, visible = segments.length; - if (inside || visible) { - listener.polygonStart(); - if (inside) { - listener.lineStart(); - interpolate(null, null, 1, listener); - listener.lineEnd(); - } - if (visible) { - d3_geo_clipPolygon(segments, compare, clipStartInside, interpolate, listener); - } - listener.polygonEnd(); - } - segments = polygon = ring = null; - } - }; - function insidePolygon(p) { - var wn = 0, n = polygon.length, y = p[1]; - for (var i = 0; i < n; ++i) { - for (var j = 1, v = polygon[i], m = v.length, a = v[0], b; j < m; ++j) { - b = v[j]; - if (a[1] <= y) { - if (b[1] > y && d3_cross2d(a, b, p) > 0) ++wn; - } else { - if (b[1] <= y && d3_cross2d(a, b, p) < 0) --wn; - } - a = b; - } - } - return wn !== 0; - } - function interpolate(from, to, direction, listener) { - var a = 0, a1 = 0; - if (from == null || (a = corner(from, direction)) !== (a1 = corner(to, direction)) || comparePoints(from, to) < 0 ^ direction > 0) { - do { - listener.point(a === 0 || a === 3 ? x0 : x1, a > 1 ? y1 : y0); - } while ((a = (a + direction + 4) % 4) !== a1); - } else { - listener.point(to[0], to[1]); - } - } - function pointVisible(x, y) { - return x0 <= x && x <= x1 && y0 <= y && y <= y1; - } - function point(x, y) { - if (pointVisible(x, y)) listener.point(x, y); - } - var x__, y__, v__, x_, y_, v_, first, clean; - function lineStart() { - clip.point = linePoint; - if (polygon) polygon.push(ring = []); - first = true; - v_ = false; - x_ = y_ = NaN; - } - function lineEnd() { - if (segments) { - linePoint(x__, y__); - if (v__ && v_) bufferListener.rejoin(); - segments.push(bufferListener.buffer()); - } - clip.point = point; - if (v_) listener.lineEnd(); - } - function linePoint(x, y) { - x = Math.max(-d3_geo_clipExtentMAX, Math.min(d3_geo_clipExtentMAX, x)); - y = Math.max(-d3_geo_clipExtentMAX, Math.min(d3_geo_clipExtentMAX, y)); - var v = pointVisible(x, y); - if (polygon) ring.push([ x, y ]); - if (first) { - x__ = x, y__ = y, v__ = v; - first = false; - if (v) { - listener.lineStart(); - listener.point(x, y); - } - } else { - if (v && v_) listener.point(x, y); else { - var l = { - a: { - x: x_, - y: y_ - }, - b: { - x: x, - y: y - } - }; - if (clipLine(l)) { - if (!v_) { - listener.lineStart(); - listener.point(l.a.x, l.a.y); - } - listener.point(l.b.x, l.b.y); - if (!v) listener.lineEnd(); - clean = false; - } else if (v) { - listener.lineStart(); - listener.point(x, y); - clean = false; - } - } - } - x_ = x, y_ = y, v_ = v; - } - return clip; - }; - function corner(p, direction) { - return abs(p[0] - x0) < ε ? direction > 0 ? 0 : 3 : abs(p[0] - x1) < ε ? direction > 0 ? 2 : 1 : abs(p[1] - y0) < ε ? direction > 0 ? 1 : 0 : direction > 0 ? 3 : 2; - } - function compare(a, b) { - return comparePoints(a.x, b.x); - } - function comparePoints(a, b) { - var ca = corner(a, 1), cb = corner(b, 1); - return ca !== cb ? ca - cb : ca === 0 ? b[1] - a[1] : ca === 1 ? a[0] - b[0] : ca === 2 ? a[1] - b[1] : b[0] - a[0]; - } - } - function d3_geo_conic(projectAt) { - var φ0 = 0, φ1 = π / 3, m = d3_geo_projectionMutator(projectAt), p = m(φ0, φ1); - p.parallels = function(_) { - if (!arguments.length) return [ φ0 / π * 180, φ1 / π * 180 ]; - return m(φ0 = _[0] * π / 180, φ1 = _[1] * π / 180); - }; - return p; - } - function d3_geo_conicEqualArea(φ0, φ1) { - var sinφ0 = Math.sin(φ0), n = (sinφ0 + Math.sin(φ1)) / 2, C = 1 + sinφ0 * (2 * n - sinφ0), ρ0 = Math.sqrt(C) / n; - function forward(λ, φ) { - var ρ = Math.sqrt(C - 2 * n * Math.sin(φ)) / n; - return [ ρ * Math.sin(λ *= n), ρ0 - ρ * Math.cos(λ) ]; - } - forward.invert = function(x, y) { - var ρ0_y = ρ0 - y; - return [ Math.atan2(x, ρ0_y) / n, d3_asin((C - (x * x + ρ0_y * ρ0_y) * n * n) / (2 * n)) ]; - }; - return forward; - } - (d3.geo.conicEqualArea = function() { - return d3_geo_conic(d3_geo_conicEqualArea); - }).raw = d3_geo_conicEqualArea; - d3.geo.albers = function() { - return d3.geo.conicEqualArea().rotate([ 96, 0 ]).center([ -.6, 38.7 ]).parallels([ 29.5, 45.5 ]).scale(1070); - }; - d3.geo.albersUsa = function() { - var lower48 = d3.geo.albers(); - var alaska = d3.geo.conicEqualArea().rotate([ 154, 0 ]).center([ -2, 58.5 ]).parallels([ 55, 65 ]); - var hawaii = d3.geo.conicEqualArea().rotate([ 157, 0 ]).center([ -3, 19.9 ]).parallels([ 8, 18 ]); - var point, pointStream = { - point: function(x, y) { - point = [ x, y ]; - } - }, lower48Point, alaskaPoint, hawaiiPoint; - function albersUsa(coordinates) { - var x = coordinates[0], y = coordinates[1]; - point = null; - (lower48Point(x, y), point) || (alaskaPoint(x, y), point) || hawaiiPoint(x, y); - return point; - } - albersUsa.invert = function(coordinates) { - var k = lower48.scale(), t = lower48.translate(), x = (coordinates[0] - t[0]) / k, y = (coordinates[1] - t[1]) / k; - return (y >= .12 && y < .234 && x >= -.425 && x < -.214 ? alaska : y >= .166 && y < .234 && x >= -.214 && x < -.115 ? hawaii : lower48).invert(coordinates); - }; - albersUsa.stream = function(stream) { - var lower48Stream = lower48.stream(stream), alaskaStream = alaska.stream(stream), hawaiiStream = hawaii.stream(stream); - return { - point: function(x, y) { - lower48Stream.point(x, y); - alaskaStream.point(x, y); - hawaiiStream.point(x, y); - }, - sphere: function() { - lower48Stream.sphere(); - alaskaStream.sphere(); - hawaiiStream.sphere(); - }, - lineStart: function() { - lower48Stream.lineStart(); - alaskaStream.lineStart(); - hawaiiStream.lineStart(); - }, - lineEnd: function() { - lower48Stream.lineEnd(); - alaskaStream.lineEnd(); - hawaiiStream.lineEnd(); - }, - polygonStart: function() { - lower48Stream.polygonStart(); - alaskaStream.polygonStart(); - hawaiiStream.polygonStart(); - }, - polygonEnd: function() { - lower48Stream.polygonEnd(); - alaskaStream.polygonEnd(); - hawaiiStream.polygonEnd(); - } - }; - }; - albersUsa.precision = function(_) { - if (!arguments.length) return lower48.precision(); - lower48.precision(_); - alaska.precision(_); - hawaii.precision(_); - return albersUsa; - }; - albersUsa.scale = function(_) { - if (!arguments.length) return lower48.scale(); - lower48.scale(_); - alaska.scale(_ * .35); - hawaii.scale(_); - return albersUsa.translate(lower48.translate()); - }; - albersUsa.translate = function(_) { - if (!arguments.length) return lower48.translate(); - var k = lower48.scale(), x = +_[0], y = +_[1]; - lower48Point = lower48.translate(_).clipExtent([ [ x - .455 * k, y - .238 * k ], [ x + .455 * k, y + .238 * k ] ]).stream(pointStream).point; - alaskaPoint = alaska.translate([ x - .307 * k, y + .201 * k ]).clipExtent([ [ x - .425 * k + ε, y + .12 * k + ε ], [ x - .214 * k - ε, y + .234 * k - ε ] ]).stream(pointStream).point; - hawaiiPoint = hawaii.translate([ x - .205 * k, y + .212 * k ]).clipExtent([ [ x - .214 * k + ε, y + .166 * k + ε ], [ x - .115 * k - ε, y + .234 * k - ε ] ]).stream(pointStream).point; - return albersUsa; - }; - return albersUsa.scale(1070); - }; - var d3_geo_pathAreaSum, d3_geo_pathAreaPolygon, d3_geo_pathArea = { - point: d3_noop, - lineStart: d3_noop, - lineEnd: d3_noop, - polygonStart: function() { - d3_geo_pathAreaPolygon = 0; - d3_geo_pathArea.lineStart = d3_geo_pathAreaRingStart; - }, - polygonEnd: function() { - d3_geo_pathArea.lineStart = d3_geo_pathArea.lineEnd = d3_geo_pathArea.point = d3_noop; - d3_geo_pathAreaSum += abs(d3_geo_pathAreaPolygon / 2); - } - }; - function d3_geo_pathAreaRingStart() { - var x00, y00, x0, y0; - d3_geo_pathArea.point = function(x, y) { - d3_geo_pathArea.point = nextPoint; - x00 = x0 = x, y00 = y0 = y; - }; - function nextPoint(x, y) { - d3_geo_pathAreaPolygon += y0 * x - x0 * y; - x0 = x, y0 = y; - } - d3_geo_pathArea.lineEnd = function() { - nextPoint(x00, y00); - }; - } - var d3_geo_pathBoundsX0, d3_geo_pathBoundsY0, d3_geo_pathBoundsX1, d3_geo_pathBoundsY1; - var d3_geo_pathBounds = { - point: d3_geo_pathBoundsPoint, - lineStart: d3_noop, - lineEnd: d3_noop, - polygonStart: d3_noop, - polygonEnd: d3_noop - }; - function d3_geo_pathBoundsPoint(x, y) { - if (x < d3_geo_pathBoundsX0) d3_geo_pathBoundsX0 = x; - if (x > d3_geo_pathBoundsX1) d3_geo_pathBoundsX1 = x; - if (y < d3_geo_pathBoundsY0) d3_geo_pathBoundsY0 = y; - if (y > d3_geo_pathBoundsY1) d3_geo_pathBoundsY1 = y; - } - function d3_geo_pathBuffer() { - var pointCircle = d3_geo_pathBufferCircle(4.5), buffer = []; - var stream = { - point: point, - lineStart: function() { - stream.point = pointLineStart; - }, - lineEnd: lineEnd, - polygonStart: function() { - stream.lineEnd = lineEndPolygon; - }, - polygonEnd: function() { - stream.lineEnd = lineEnd; - stream.point = point; - }, - pointRadius: function(_) { - pointCircle = d3_geo_pathBufferCircle(_); - return stream; - }, - result: function() { - if (buffer.length) { - var result = buffer.join(""); - buffer = []; - return result; - } - } - }; - function point(x, y) { - buffer.push("M", x, ",", y, pointCircle); - } - function pointLineStart(x, y) { - buffer.push("M", x, ",", y); - stream.point = pointLine; - } - function pointLine(x, y) { - buffer.push("L", x, ",", y); - } - function lineEnd() { - stream.point = point; - } - function lineEndPolygon() { - buffer.push("Z"); - } - return stream; - } - function d3_geo_pathBufferCircle(radius) { - return "m0," + radius + "a" + radius + "," + radius + " 0 1,1 0," + -2 * radius + "a" + radius + "," + radius + " 0 1,1 0," + 2 * radius + "z"; - } - var d3_geo_pathCentroid = { - point: d3_geo_pathCentroidPoint, - lineStart: d3_geo_pathCentroidLineStart, - lineEnd: d3_geo_pathCentroidLineEnd, - polygonStart: function() { - d3_geo_pathCentroid.lineStart = d3_geo_pathCentroidRingStart; - }, - polygonEnd: function() { - d3_geo_pathCentroid.point = d3_geo_pathCentroidPoint; - d3_geo_pathCentroid.lineStart = d3_geo_pathCentroidLineStart; - d3_geo_pathCentroid.lineEnd = d3_geo_pathCentroidLineEnd; - } - }; - function d3_geo_pathCentroidPoint(x, y) { - d3_geo_centroidX0 += x; - d3_geo_centroidY0 += y; - ++d3_geo_centroidZ0; - } - function d3_geo_pathCentroidLineStart() { - var x0, y0; - d3_geo_pathCentroid.point = function(x, y) { - d3_geo_pathCentroid.point = nextPoint; - d3_geo_pathCentroidPoint(x0 = x, y0 = y); - }; - function nextPoint(x, y) { - var dx = x - x0, dy = y - y0, z = Math.sqrt(dx * dx + dy * dy); - d3_geo_centroidX1 += z * (x0 + x) / 2; - d3_geo_centroidY1 += z * (y0 + y) / 2; - d3_geo_centroidZ1 += z; - d3_geo_pathCentroidPoint(x0 = x, y0 = y); - } - } - function d3_geo_pathCentroidLineEnd() { - d3_geo_pathCentroid.point = d3_geo_pathCentroidPoint; - } - function d3_geo_pathCentroidRingStart() { - var x00, y00, x0, y0; - d3_geo_pathCentroid.point = function(x, y) { - d3_geo_pathCentroid.point = nextPoint; - d3_geo_pathCentroidPoint(x00 = x0 = x, y00 = y0 = y); - }; - function nextPoint(x, y) { - var dx = x - x0, dy = y - y0, z = Math.sqrt(dx * dx + dy * dy); - d3_geo_centroidX1 += z * (x0 + x) / 2; - d3_geo_centroidY1 += z * (y0 + y) / 2; - d3_geo_centroidZ1 += z; - z = y0 * x - x0 * y; - d3_geo_centroidX2 += z * (x0 + x); - d3_geo_centroidY2 += z * (y0 + y); - d3_geo_centroidZ2 += z * 3; - d3_geo_pathCentroidPoint(x0 = x, y0 = y); - } - d3_geo_pathCentroid.lineEnd = function() { - nextPoint(x00, y00); - }; - } - function d3_geo_pathContext(context) { - var pointRadius = 4.5; - var stream = { - point: point, - lineStart: function() { - stream.point = pointLineStart; - }, - lineEnd: lineEnd, - polygonStart: function() { - stream.lineEnd = lineEndPolygon; - }, - polygonEnd: function() { - stream.lineEnd = lineEnd; - stream.point = point; - }, - pointRadius: function(_) { - pointRadius = _; - return stream; - }, - result: d3_noop - }; - function point(x, y) { - context.moveTo(x + pointRadius, y); - context.arc(x, y, pointRadius, 0, τ); - } - function pointLineStart(x, y) { - context.moveTo(x, y); - stream.point = pointLine; - } - function pointLine(x, y) { - context.lineTo(x, y); - } - function lineEnd() { - stream.point = point; - } - function lineEndPolygon() { - context.closePath(); - } - return stream; - } - function d3_geo_resample(project) { - var δ2 = .5, cosMinDistance = Math.cos(30 * d3_radians), maxDepth = 16; - function resample(stream) { - return (maxDepth ? resampleRecursive : resampleNone)(stream); - } - function resampleNone(stream) { - return d3_geo_transformPoint(stream, function(x, y) { - x = project(x, y); - stream.point(x[0], x[1]); - }); - } - function resampleRecursive(stream) { - var λ00, φ00, x00, y00, a00, b00, c00, λ0, x0, y0, a0, b0, c0; - var resample = { - point: point, - lineStart: lineStart, - lineEnd: lineEnd, - polygonStart: function() { - stream.polygonStart(); - resample.lineStart = ringStart; - }, - polygonEnd: function() { - stream.polygonEnd(); - resample.lineStart = lineStart; - } - }; - function point(x, y) { - x = project(x, y); - stream.point(x[0], x[1]); - } - function lineStart() { - x0 = NaN; - resample.point = linePoint; - stream.lineStart(); - } - function linePoint(λ, φ) { - var c = d3_geo_cartesian([ λ, φ ]), p = project(λ, φ); - resampleLineTo(x0, y0, λ0, a0, b0, c0, x0 = p[0], y0 = p[1], λ0 = λ, a0 = c[0], b0 = c[1], c0 = c[2], maxDepth, stream); - stream.point(x0, y0); - } - function lineEnd() { - resample.point = point; - stream.lineEnd(); - } - function ringStart() { - lineStart(); - resample.point = ringPoint; - resample.lineEnd = ringEnd; - } - function ringPoint(λ, φ) { - linePoint(λ00 = λ, φ00 = φ), x00 = x0, y00 = y0, a00 = a0, b00 = b0, c00 = c0; - resample.point = linePoint; - } - function ringEnd() { - resampleLineTo(x0, y0, λ0, a0, b0, c0, x00, y00, λ00, a00, b00, c00, maxDepth, stream); - resample.lineEnd = lineEnd; - lineEnd(); - } - return resample; - } - function resampleLineTo(x0, y0, λ0, a0, b0, c0, x1, y1, λ1, a1, b1, c1, depth, stream) { - var dx = x1 - x0, dy = y1 - y0, d2 = dx * dx + dy * dy; - if (d2 > 4 * δ2 && depth--) { - var a = a0 + a1, b = b0 + b1, c = c0 + c1, m = Math.sqrt(a * a + b * b + c * c), φ2 = Math.asin(c /= m), λ2 = abs(abs(c) - 1) < ε || abs(λ0 - λ1) < ε ? (λ0 + λ1) / 2 : Math.atan2(b, a), p = project(λ2, φ2), x2 = p[0], y2 = p[1], dx2 = x2 - x0, dy2 = y2 - y0, dz = dy * dx2 - dx * dy2; - if (dz * dz / d2 > δ2 || abs((dx * dx2 + dy * dy2) / d2 - .5) > .3 || a0 * a1 + b0 * b1 + c0 * c1 < cosMinDistance) { - resampleLineTo(x0, y0, λ0, a0, b0, c0, x2, y2, λ2, a /= m, b /= m, c, depth, stream); - stream.point(x2, y2); - resampleLineTo(x2, y2, λ2, a, b, c, x1, y1, λ1, a1, b1, c1, depth, stream); - } - } - } - resample.precision = function(_) { - if (!arguments.length) return Math.sqrt(δ2); - maxDepth = (δ2 = _ * _) > 0 && 16; - return resample; - }; - return resample; - } - d3.geo.path = function() { - var pointRadius = 4.5, projection, context, projectStream, contextStream, cacheStream; - function path(object) { - if (object) { - if (typeof pointRadius === "function") contextStream.pointRadius(+pointRadius.apply(this, arguments)); - if (!cacheStream || !cacheStream.valid) cacheStream = projectStream(contextStream); - d3.geo.stream(object, cacheStream); - } - return contextStream.result(); - } - path.area = function(object) { - d3_geo_pathAreaSum = 0; - d3.geo.stream(object, projectStream(d3_geo_pathArea)); - return d3_geo_pathAreaSum; - }; - path.centroid = function(object) { - d3_geo_centroidX0 = d3_geo_centroidY0 = d3_geo_centroidZ0 = d3_geo_centroidX1 = d3_geo_centroidY1 = d3_geo_centroidZ1 = d3_geo_centroidX2 = d3_geo_centroidY2 = d3_geo_centroidZ2 = 0; - d3.geo.stream(object, projectStream(d3_geo_pathCentroid)); - return d3_geo_centroidZ2 ? [ d3_geo_centroidX2 / d3_geo_centroidZ2, d3_geo_centroidY2 / d3_geo_centroidZ2 ] : d3_geo_centroidZ1 ? [ d3_geo_centroidX1 / d3_geo_centroidZ1, d3_geo_centroidY1 / d3_geo_centroidZ1 ] : d3_geo_centroidZ0 ? [ d3_geo_centroidX0 / d3_geo_centroidZ0, d3_geo_centroidY0 / d3_geo_centroidZ0 ] : [ NaN, NaN ]; - }; - path.bounds = function(object) { - d3_geo_pathBoundsX1 = d3_geo_pathBoundsY1 = -(d3_geo_pathBoundsX0 = d3_geo_pathBoundsY0 = Infinity); - d3.geo.stream(object, projectStream(d3_geo_pathBounds)); - return [ [ d3_geo_pathBoundsX0, d3_geo_pathBoundsY0 ], [ d3_geo_pathBoundsX1, d3_geo_pathBoundsY1 ] ]; - }; - path.projection = function(_) { - if (!arguments.length) return projection; - projectStream = (projection = _) ? _.stream || d3_geo_pathProjectStream(_) : d3_identity; - return reset(); - }; - path.context = function(_) { - if (!arguments.length) return context; - contextStream = (context = _) == null ? new d3_geo_pathBuffer() : new d3_geo_pathContext(_); - if (typeof pointRadius !== "function") contextStream.pointRadius(pointRadius); - return reset(); - }; - path.pointRadius = function(_) { - if (!arguments.length) return pointRadius; - pointRadius = typeof _ === "function" ? _ : (contextStream.pointRadius(+_), +_); - return path; - }; - function reset() { - cacheStream = null; - return path; - } - return path.projection(d3.geo.albersUsa()).context(null); - }; - function d3_geo_pathProjectStream(project) { - var resample = d3_geo_resample(function(x, y) { - return project([ x * d3_degrees, y * d3_degrees ]); - }); - return function(stream) { - return d3_geo_projectionRadians(resample(stream)); - }; - } - d3.geo.transform = function(methods) { - return { - stream: function(stream) { - var transform = new d3_geo_transform(stream); - for (var k in methods) transform[k] = methods[k]; - return transform; - } - }; - }; - function d3_geo_transform(stream) { - this.stream = stream; - } - d3_geo_transform.prototype = { - point: function(x, y) { - this.stream.point(x, y); - }, - sphere: function() { - this.stream.sphere(); - }, - lineStart: function() { - this.stream.lineStart(); - }, - lineEnd: function() { - this.stream.lineEnd(); - }, - polygonStart: function() { - this.stream.polygonStart(); - }, - polygonEnd: function() { - this.stream.polygonEnd(); - } - }; - function d3_geo_transformPoint(stream, point) { - return { - point: point, - sphere: function() { - stream.sphere(); - }, - lineStart: function() { - stream.lineStart(); - }, - lineEnd: function() { - stream.lineEnd(); - }, - polygonStart: function() { - stream.polygonStart(); - }, - polygonEnd: function() { - stream.polygonEnd(); - } - }; - } - d3.geo.projection = d3_geo_projection; - d3.geo.projectionMutator = d3_geo_projectionMutator; - function d3_geo_projection(project) { - return d3_geo_projectionMutator(function() { - return project; - })(); - } - function d3_geo_projectionMutator(projectAt) { - var project, rotate, projectRotate, projectResample = d3_geo_resample(function(x, y) { - x = project(x, y); - return [ x[0] * k + δx, δy - x[1] * k ]; - }), k = 150, x = 480, y = 250, λ = 0, φ = 0, δλ = 0, δφ = 0, δγ = 0, δx, δy, preclip = d3_geo_clipAntimeridian, postclip = d3_identity, clipAngle = null, clipExtent = null, stream; - function projection(point) { - point = projectRotate(point[0] * d3_radians, point[1] * d3_radians); - return [ point[0] * k + δx, δy - point[1] * k ]; - } - function invert(point) { - point = projectRotate.invert((point[0] - δx) / k, (δy - point[1]) / k); - return point && [ point[0] * d3_degrees, point[1] * d3_degrees ]; - } - projection.stream = function(output) { - if (stream) stream.valid = false; - stream = d3_geo_projectionRadians(preclip(rotate, projectResample(postclip(output)))); - stream.valid = true; - return stream; - }; - projection.clipAngle = function(_) { - if (!arguments.length) return clipAngle; - preclip = _ == null ? (clipAngle = _, d3_geo_clipAntimeridian) : d3_geo_clipCircle((clipAngle = +_) * d3_radians); - return invalidate(); - }; - projection.clipExtent = function(_) { - if (!arguments.length) return clipExtent; - clipExtent = _; - postclip = _ ? d3_geo_clipExtent(_[0][0], _[0][1], _[1][0], _[1][1]) : d3_identity; - return invalidate(); - }; - projection.scale = function(_) { - if (!arguments.length) return k; - k = +_; - return reset(); - }; - projection.translate = function(_) { - if (!arguments.length) return [ x, y ]; - x = +_[0]; - y = +_[1]; - return reset(); - }; - projection.center = function(_) { - if (!arguments.length) return [ λ * d3_degrees, φ * d3_degrees ]; - λ = _[0] % 360 * d3_radians; - φ = _[1] % 360 * d3_radians; - return reset(); - }; - projection.rotate = function(_) { - if (!arguments.length) return [ δλ * d3_degrees, δφ * d3_degrees, δγ * d3_degrees ]; - δλ = _[0] % 360 * d3_radians; - δφ = _[1] % 360 * d3_radians; - δγ = _.length > 2 ? _[2] % 360 * d3_radians : 0; - return reset(); - }; - d3.rebind(projection, projectResample, "precision"); - function reset() { - projectRotate = d3_geo_compose(rotate = d3_geo_rotation(δλ, δφ, δγ), project); - var center = project(λ, φ); - δx = x - center[0] * k; - δy = y + center[1] * k; - return invalidate(); - } - function invalidate() { - if (stream) stream.valid = false, stream = null; - return projection; - } - return function() { - project = projectAt.apply(this, arguments); - projection.invert = project.invert && invert; - return reset(); - }; - } - function d3_geo_projectionRadians(stream) { - return d3_geo_transformPoint(stream, function(x, y) { - stream.point(x * d3_radians, y * d3_radians); - }); - } - function d3_geo_equirectangular(λ, φ) { - return [ λ, φ ]; - } - (d3.geo.equirectangular = function() { - return d3_geo_projection(d3_geo_equirectangular); - }).raw = d3_geo_equirectangular.invert = d3_geo_equirectangular; - d3.geo.rotation = function(rotate) { - rotate = d3_geo_rotation(rotate[0] % 360 * d3_radians, rotate[1] * d3_radians, rotate.length > 2 ? rotate[2] * d3_radians : 0); - function forward(coordinates) { - coordinates = rotate(coordinates[0] * d3_radians, coordinates[1] * d3_radians); - return coordinates[0] *= d3_degrees, coordinates[1] *= d3_degrees, coordinates; - } - forward.invert = function(coordinates) { - coordinates = rotate.invert(coordinates[0] * d3_radians, coordinates[1] * d3_radians); - return coordinates[0] *= d3_degrees, coordinates[1] *= d3_degrees, coordinates; - }; - return forward; - }; - function d3_geo_identityRotation(λ, φ) { - return [ λ > π ? λ - τ : λ < -π ? λ + τ : λ, φ ]; - } - d3_geo_identityRotation.invert = d3_geo_equirectangular; - function d3_geo_rotation(δλ, δφ, δγ) { - return δλ ? δφ || δγ ? d3_geo_compose(d3_geo_rotationλ(δλ), d3_geo_rotationφγ(δφ, δγ)) : d3_geo_rotationλ(δλ) : δφ || δγ ? d3_geo_rotationφγ(δφ, δγ) : d3_geo_identityRotation; - } - function d3_geo_forwardRotationλ(δλ) { - return function(λ, φ) { - return λ += δλ, [ λ > π ? λ - τ : λ < -π ? λ + τ : λ, φ ]; - }; - } - function d3_geo_rotationλ(δλ) { - var rotation = d3_geo_forwardRotationλ(δλ); - rotation.invert = d3_geo_forwardRotationλ(-δλ); - return rotation; - } - function d3_geo_rotationφγ(δφ, δγ) { - var cosδφ = Math.cos(δφ), sinδφ = Math.sin(δφ), cosδγ = Math.cos(δγ), sinδγ = Math.sin(δγ); - function rotation(λ, φ) { - var cosφ = Math.cos(φ), x = Math.cos(λ) * cosφ, y = Math.sin(λ) * cosφ, z = Math.sin(φ), k = z * cosδφ + x * sinδφ; - return [ Math.atan2(y * cosδγ - k * sinδγ, x * cosδφ - z * sinδφ), d3_asin(k * cosδγ + y * sinδγ) ]; - } - rotation.invert = function(λ, φ) { - var cosφ = Math.cos(φ), x = Math.cos(λ) * cosφ, y = Math.sin(λ) * cosφ, z = Math.sin(φ), k = z * cosδγ - y * sinδγ; - return [ Math.atan2(y * cosδγ + z * sinδγ, x * cosδφ + k * sinδφ), d3_asin(k * cosδφ - x * sinδφ) ]; - }; - return rotation; - } - d3.geo.circle = function() { - var origin = [ 0, 0 ], angle, precision = 6, interpolate; - function circle() { - var center = typeof origin === "function" ? origin.apply(this, arguments) : origin, rotate = d3_geo_rotation(-center[0] * d3_radians, -center[1] * d3_radians, 0).invert, ring = []; - interpolate(null, null, 1, { - point: function(x, y) { - ring.push(x = rotate(x, y)); - x[0] *= d3_degrees, x[1] *= d3_degrees; - } - }); - return { - type: "Polygon", - coordinates: [ ring ] - }; - } - circle.origin = function(x) { - if (!arguments.length) return origin; - origin = x; - return circle; - }; - circle.angle = function(x) { - if (!arguments.length) return angle; - interpolate = d3_geo_circleInterpolate((angle = +x) * d3_radians, precision * d3_radians); - return circle; - }; - circle.precision = function(_) { - if (!arguments.length) return precision; - interpolate = d3_geo_circleInterpolate(angle * d3_radians, (precision = +_) * d3_radians); - return circle; - }; - return circle.angle(90); - }; - function d3_geo_circleInterpolate(radius, precision) { - var cr = Math.cos(radius), sr = Math.sin(radius); - return function(from, to, direction, listener) { - var step = direction * precision; - if (from != null) { - from = d3_geo_circleAngle(cr, from); - to = d3_geo_circleAngle(cr, to); - if (direction > 0 ? from < to : from > to) from += direction * τ; - } else { - from = radius + direction * τ; - to = radius - .5 * step; - } - for (var point, t = from; direction > 0 ? t > to : t < to; t -= step) { - listener.point((point = d3_geo_spherical([ cr, -sr * Math.cos(t), -sr * Math.sin(t) ]))[0], point[1]); - } - }; - } - function d3_geo_circleAngle(cr, point) { - var a = d3_geo_cartesian(point); - a[0] -= cr; - d3_geo_cartesianNormalize(a); - var angle = d3_acos(-a[1]); - return ((-a[2] < 0 ? -angle : angle) + 2 * Math.PI - ε) % (2 * Math.PI); - } - d3.geo.distance = function(a, b) { - var Δλ = (b[0] - a[0]) * d3_radians, φ0 = a[1] * d3_radians, φ1 = b[1] * d3_radians, sinΔλ = Math.sin(Δλ), cosΔλ = Math.cos(Δλ), sinφ0 = Math.sin(φ0), cosφ0 = Math.cos(φ0), sinφ1 = Math.sin(φ1), cosφ1 = Math.cos(φ1), t; - return Math.atan2(Math.sqrt((t = cosφ1 * sinΔλ) * t + (t = cosφ0 * sinφ1 - sinφ0 * cosφ1 * cosΔλ) * t), sinφ0 * sinφ1 + cosφ0 * cosφ1 * cosΔλ); - }; - d3.geo.graticule = function() { - var x1, x0, X1, X0, y1, y0, Y1, Y0, dx = 10, dy = dx, DX = 90, DY = 360, x, y, X, Y, precision = 2.5; - function graticule() { - return { - type: "MultiLineString", - coordinates: lines() - }; - } - function lines() { - return d3.range(Math.ceil(X0 / DX) * DX, X1, DX).map(X).concat(d3.range(Math.ceil(Y0 / DY) * DY, Y1, DY).map(Y)).concat(d3.range(Math.ceil(x0 / dx) * dx, x1, dx).filter(function(x) { - return abs(x % DX) > ε; - }).map(x)).concat(d3.range(Math.ceil(y0 / dy) * dy, y1, dy).filter(function(y) { - return abs(y % DY) > ε; - }).map(y)); - } - graticule.lines = function() { - return lines().map(function(coordinates) { - return { - type: "LineString", - coordinates: coordinates - }; - }); - }; - graticule.outline = function() { - return { - type: "Polygon", - coordinates: [ X(X0).concat(Y(Y1).slice(1), X(X1).reverse().slice(1), Y(Y0).reverse().slice(1)) ] - }; - }; - graticule.extent = function(_) { - if (!arguments.length) return graticule.minorExtent(); - return graticule.majorExtent(_).minorExtent(_); - }; - graticule.majorExtent = function(_) { - if (!arguments.length) return [ [ X0, Y0 ], [ X1, Y1 ] ]; - X0 = +_[0][0], X1 = +_[1][0]; - Y0 = +_[0][1], Y1 = +_[1][1]; - if (X0 > X1) _ = X0, X0 = X1, X1 = _; - if (Y0 > Y1) _ = Y0, Y0 = Y1, Y1 = _; - return graticule.precision(precision); - }; - graticule.minorExtent = function(_) { - if (!arguments.length) return [ [ x0, y0 ], [ x1, y1 ] ]; - x0 = +_[0][0], x1 = +_[1][0]; - y0 = +_[0][1], y1 = +_[1][1]; - if (x0 > x1) _ = x0, x0 = x1, x1 = _; - if (y0 > y1) _ = y0, y0 = y1, y1 = _; - return graticule.precision(precision); - }; - graticule.step = function(_) { - if (!arguments.length) return graticule.minorStep(); - return graticule.majorStep(_).minorStep(_); - }; - graticule.majorStep = function(_) { - if (!arguments.length) return [ DX, DY ]; - DX = +_[0], DY = +_[1]; - return graticule; - }; - graticule.minorStep = function(_) { - if (!arguments.length) return [ dx, dy ]; - dx = +_[0], dy = +_[1]; - return graticule; - }; - graticule.precision = function(_) { - if (!arguments.length) return precision; - precision = +_; - x = d3_geo_graticuleX(y0, y1, 90); - y = d3_geo_graticuleY(x0, x1, precision); - X = d3_geo_graticuleX(Y0, Y1, 90); - Y = d3_geo_graticuleY(X0, X1, precision); - return graticule; - }; - return graticule.majorExtent([ [ -180, -90 + ε ], [ 180, 90 - ε ] ]).minorExtent([ [ -180, -80 - ε ], [ 180, 80 + ε ] ]); - }; - function d3_geo_graticuleX(y0, y1, dy) { - var y = d3.range(y0, y1 - ε, dy).concat(y1); - return function(x) { - return y.map(function(y) { - return [ x, y ]; - }); - }; - } - function d3_geo_graticuleY(x0, x1, dx) { - var x = d3.range(x0, x1 - ε, dx).concat(x1); - return function(y) { - return x.map(function(x) { - return [ x, y ]; - }); - }; - } - function d3_source(d) { - return d.source; - } - function d3_target(d) { - return d.target; - } - d3.geo.greatArc = function() { - var source = d3_source, source_, target = d3_target, target_; - function greatArc() { - return { - type: "LineString", - coordinates: [ source_ || source.apply(this, arguments), target_ || target.apply(this, arguments) ] - }; - } - greatArc.distance = function() { - return d3.geo.distance(source_ || source.apply(this, arguments), target_ || target.apply(this, arguments)); - }; - greatArc.source = function(_) { - if (!arguments.length) return source; - source = _, source_ = typeof _ === "function" ? null : _; - return greatArc; - }; - greatArc.target = function(_) { - if (!arguments.length) return target; - target = _, target_ = typeof _ === "function" ? null : _; - return greatArc; - }; - greatArc.precision = function() { - return arguments.length ? greatArc : 0; - }; - return greatArc; - }; - d3.geo.interpolate = function(source, target) { - return d3_geo_interpolate(source[0] * d3_radians, source[1] * d3_radians, target[0] * d3_radians, target[1] * d3_radians); - }; - function d3_geo_interpolate(x0, y0, x1, y1) { - var cy0 = Math.cos(y0), sy0 = Math.sin(y0), cy1 = Math.cos(y1), sy1 = Math.sin(y1), kx0 = cy0 * Math.cos(x0), ky0 = cy0 * Math.sin(x0), kx1 = cy1 * Math.cos(x1), ky1 = cy1 * Math.sin(x1), d = 2 * Math.asin(Math.sqrt(d3_haversin(y1 - y0) + cy0 * cy1 * d3_haversin(x1 - x0))), k = 1 / Math.sin(d); - var interpolate = d ? function(t) { - var B = Math.sin(t *= d) * k, A = Math.sin(d - t) * k, x = A * kx0 + B * kx1, y = A * ky0 + B * ky1, z = A * sy0 + B * sy1; - return [ Math.atan2(y, x) * d3_degrees, Math.atan2(z, Math.sqrt(x * x + y * y)) * d3_degrees ]; - } : function() { - return [ x0 * d3_degrees, y0 * d3_degrees ]; - }; - interpolate.distance = d; - return interpolate; - } - d3.geo.length = function(object) { - d3_geo_lengthSum = 0; - d3.geo.stream(object, d3_geo_length); - return d3_geo_lengthSum; - }; - var d3_geo_lengthSum; - var d3_geo_length = { - sphere: d3_noop, - point: d3_noop, - lineStart: d3_geo_lengthLineStart, - lineEnd: d3_noop, - polygonStart: d3_noop, - polygonEnd: d3_noop - }; - function d3_geo_lengthLineStart() { - var λ0, sinφ0, cosφ0; - d3_geo_length.point = function(λ, φ) { - λ0 = λ * d3_radians, sinφ0 = Math.sin(φ *= d3_radians), cosφ0 = Math.cos(φ); - d3_geo_length.point = nextPoint; - }; - d3_geo_length.lineEnd = function() { - d3_geo_length.point = d3_geo_length.lineEnd = d3_noop; - }; - function nextPoint(λ, φ) { - var sinφ = Math.sin(φ *= d3_radians), cosφ = Math.cos(φ), t = abs((λ *= d3_radians) - λ0), cosΔλ = Math.cos(t); - d3_geo_lengthSum += Math.atan2(Math.sqrt((t = cosφ * Math.sin(t)) * t + (t = cosφ0 * sinφ - sinφ0 * cosφ * cosΔλ) * t), sinφ0 * sinφ + cosφ0 * cosφ * cosΔλ); - λ0 = λ, sinφ0 = sinφ, cosφ0 = cosφ; - } - } - function d3_geo_azimuthal(scale, angle) { - function azimuthal(λ, φ) { - var cosλ = Math.cos(λ), cosφ = Math.cos(φ), k = scale(cosλ * cosφ); - return [ k * cosφ * Math.sin(λ), k * Math.sin(φ) ]; - } - azimuthal.invert = function(x, y) { - var ρ = Math.sqrt(x * x + y * y), c = angle(ρ), sinc = Math.sin(c), cosc = Math.cos(c); - return [ Math.atan2(x * sinc, ρ * cosc), Math.asin(ρ && y * sinc / ρ) ]; - }; - return azimuthal; - } - var d3_geo_azimuthalEqualArea = d3_geo_azimuthal(function(cosλcosφ) { - return Math.sqrt(2 / (1 + cosλcosφ)); - }, function(ρ) { - return 2 * Math.asin(ρ / 2); - }); - (d3.geo.azimuthalEqualArea = function() { - return d3_geo_projection(d3_geo_azimuthalEqualArea); - }).raw = d3_geo_azimuthalEqualArea; - var d3_geo_azimuthalEquidistant = d3_geo_azimuthal(function(cosλcosφ) { - var c = Math.acos(cosλcosφ); - return c && c / Math.sin(c); - }, d3_identity); - (d3.geo.azimuthalEquidistant = function() { - return d3_geo_projection(d3_geo_azimuthalEquidistant); - }).raw = d3_geo_azimuthalEquidistant; - function d3_geo_conicConformal(φ0, φ1) { - var cosφ0 = Math.cos(φ0), t = function(φ) { - return Math.tan(π / 4 + φ / 2); - }, n = φ0 === φ1 ? Math.sin(φ0) : Math.log(cosφ0 / Math.cos(φ1)) / Math.log(t(φ1) / t(φ0)), F = cosφ0 * Math.pow(t(φ0), n) / n; - if (!n) return d3_geo_mercator; - function forward(λ, φ) { - if (F > 0) { - if (φ < -halfπ + ε) φ = -halfπ + ε; - } else { - if (φ > halfπ - ε) φ = halfπ - ε; - } - var ρ = F / Math.pow(t(φ), n); - return [ ρ * Math.sin(n * λ), F - ρ * Math.cos(n * λ) ]; - } - forward.invert = function(x, y) { - var ρ0_y = F - y, ρ = d3_sgn(n) * Math.sqrt(x * x + ρ0_y * ρ0_y); - return [ Math.atan2(x, ρ0_y) / n, 2 * Math.atan(Math.pow(F / ρ, 1 / n)) - halfπ ]; - }; - return forward; - } - (d3.geo.conicConformal = function() { - return d3_geo_conic(d3_geo_conicConformal); - }).raw = d3_geo_conicConformal; - function d3_geo_conicEquidistant(φ0, φ1) { - var cosφ0 = Math.cos(φ0), n = φ0 === φ1 ? Math.sin(φ0) : (cosφ0 - Math.cos(φ1)) / (φ1 - φ0), G = cosφ0 / n + φ0; - if (abs(n) < ε) return d3_geo_equirectangular; - function forward(λ, φ) { - var ρ = G - φ; - return [ ρ * Math.sin(n * λ), G - ρ * Math.cos(n * λ) ]; - } - forward.invert = function(x, y) { - var ρ0_y = G - y; - return [ Math.atan2(x, ρ0_y) / n, G - d3_sgn(n) * Math.sqrt(x * x + ρ0_y * ρ0_y) ]; - }; - return forward; - } - (d3.geo.conicEquidistant = function() { - return d3_geo_conic(d3_geo_conicEquidistant); - }).raw = d3_geo_conicEquidistant; - var d3_geo_gnomonic = d3_geo_azimuthal(function(cosλcosφ) { - return 1 / cosλcosφ; - }, Math.atan); - (d3.geo.gnomonic = function() { - return d3_geo_projection(d3_geo_gnomonic); - }).raw = d3_geo_gnomonic; - function d3_geo_mercator(λ, φ) { - return [ λ, Math.log(Math.tan(π / 4 + φ / 2)) ]; - } - d3_geo_mercator.invert = function(x, y) { - return [ x, 2 * Math.atan(Math.exp(y)) - halfπ ]; - }; - function d3_geo_mercatorProjection(project) { - var m = d3_geo_projection(project), scale = m.scale, translate = m.translate, clipExtent = m.clipExtent, clipAuto; - m.scale = function() { - var v = scale.apply(m, arguments); - return v === m ? clipAuto ? m.clipExtent(null) : m : v; - }; - m.translate = function() { - var v = translate.apply(m, arguments); - return v === m ? clipAuto ? m.clipExtent(null) : m : v; - }; - m.clipExtent = function(_) { - var v = clipExtent.apply(m, arguments); - if (v === m) { - if (clipAuto = _ == null) { - var k = π * scale(), t = translate(); - clipExtent([ [ t[0] - k, t[1] - k ], [ t[0] + k, t[1] + k ] ]); - } - } else if (clipAuto) { - v = null; - } - return v; - }; - return m.clipExtent(null); - } - (d3.geo.mercator = function() { - return d3_geo_mercatorProjection(d3_geo_mercator); - }).raw = d3_geo_mercator; - var d3_geo_orthographic = d3_geo_azimuthal(function() { - return 1; - }, Math.asin); - (d3.geo.orthographic = function() { - return d3_geo_projection(d3_geo_orthographic); - }).raw = d3_geo_orthographic; - var d3_geo_stereographic = d3_geo_azimuthal(function(cosλcosφ) { - return 1 / (1 + cosλcosφ); - }, function(ρ) { - return 2 * Math.atan(ρ); - }); - (d3.geo.stereographic = function() { - return d3_geo_projection(d3_geo_stereographic); - }).raw = d3_geo_stereographic; - function d3_geo_transverseMercator(λ, φ) { - return [ Math.log(Math.tan(π / 4 + φ / 2)), -λ ]; - } - d3_geo_transverseMercator.invert = function(x, y) { - return [ -y, 2 * Math.atan(Math.exp(x)) - halfπ ]; - }; - (d3.geo.transverseMercator = function() { - var projection = d3_geo_mercatorProjection(d3_geo_transverseMercator), center = projection.center, rotate = projection.rotate; - projection.center = function(_) { - return _ ? center([ -_[1], _[0] ]) : (_ = center(), [ _[1], -_[0] ]); - }; - projection.rotate = function(_) { - return _ ? rotate([ _[0], _[1], _.length > 2 ? _[2] + 90 : 90 ]) : (_ = rotate(), - [ _[0], _[1], _[2] - 90 ]); - }; - return rotate([ 0, 0, 90 ]); - }).raw = d3_geo_transverseMercator; - d3.geom = {}; - function d3_geom_pointX(d) { - return d[0]; - } - function d3_geom_pointY(d) { - return d[1]; - } - d3.geom.hull = function(vertices) { - var x = d3_geom_pointX, y = d3_geom_pointY; - if (arguments.length) return hull(vertices); - function hull(data) { - if (data.length < 3) return []; - var fx = d3_functor(x), fy = d3_functor(y), i, n = data.length, points = [], flippedPoints = []; - for (i = 0; i < n; i++) { - points.push([ +fx.call(this, data[i], i), +fy.call(this, data[i], i), i ]); - } - points.sort(d3_geom_hullOrder); - for (i = 0; i < n; i++) flippedPoints.push([ points[i][0], -points[i][1] ]); - var upper = d3_geom_hullUpper(points), lower = d3_geom_hullUpper(flippedPoints); - var skipLeft = lower[0] === upper[0], skipRight = lower[lower.length - 1] === upper[upper.length - 1], polygon = []; - for (i = upper.length - 1; i >= 0; --i) polygon.push(data[points[upper[i]][2]]); - for (i = +skipLeft; i < lower.length - skipRight; ++i) polygon.push(data[points[lower[i]][2]]); - return polygon; - } - hull.x = function(_) { - return arguments.length ? (x = _, hull) : x; - }; - hull.y = function(_) { - return arguments.length ? (y = _, hull) : y; - }; - return hull; - }; - function d3_geom_hullUpper(points) { - var n = points.length, hull = [ 0, 1 ], hs = 2; - for (var i = 2; i < n; i++) { - while (hs > 1 && d3_cross2d(points[hull[hs - 2]], points[hull[hs - 1]], points[i]) <= 0) --hs; - hull[hs++] = i; - } - return hull.slice(0, hs); - } - function d3_geom_hullOrder(a, b) { - return a[0] - b[0] || a[1] - b[1]; - } - d3.geom.polygon = function(coordinates) { - d3_subclass(coordinates, d3_geom_polygonPrototype); - return coordinates; - }; - var d3_geom_polygonPrototype = d3.geom.polygon.prototype = []; - d3_geom_polygonPrototype.area = function() { - var i = -1, n = this.length, a, b = this[n - 1], area = 0; - while (++i < n) { - a = b; - b = this[i]; - area += a[1] * b[0] - a[0] * b[1]; - } - return area * .5; - }; - d3_geom_polygonPrototype.centroid = function(k) { - var i = -1, n = this.length, x = 0, y = 0, a, b = this[n - 1], c; - if (!arguments.length) k = -1 / (6 * this.area()); - while (++i < n) { - a = b; - b = this[i]; - c = a[0] * b[1] - b[0] * a[1]; - x += (a[0] + b[0]) * c; - y += (a[1] + b[1]) * c; - } - return [ x * k, y * k ]; - }; - d3_geom_polygonPrototype.clip = function(subject) { - var input, closed = d3_geom_polygonClosed(subject), i = -1, n = this.length - d3_geom_polygonClosed(this), j, m, a = this[n - 1], b, c, d; - while (++i < n) { - input = subject.slice(); - subject.length = 0; - b = this[i]; - c = input[(m = input.length - closed) - 1]; - j = -1; - while (++j < m) { - d = input[j]; - if (d3_geom_polygonInside(d, a, b)) { - if (!d3_geom_polygonInside(c, a, b)) { - subject.push(d3_geom_polygonIntersect(c, d, a, b)); - } - subject.push(d); - } else if (d3_geom_polygonInside(c, a, b)) { - subject.push(d3_geom_polygonIntersect(c, d, a, b)); - } - c = d; - } - if (closed) subject.push(subject[0]); - a = b; - } - return subject; - }; - function d3_geom_polygonInside(p, a, b) { - return (b[0] - a[0]) * (p[1] - a[1]) < (b[1] - a[1]) * (p[0] - a[0]); - } - function d3_geom_polygonIntersect(c, d, a, b) { - var x1 = c[0], x3 = a[0], x21 = d[0] - x1, x43 = b[0] - x3, y1 = c[1], y3 = a[1], y21 = d[1] - y1, y43 = b[1] - y3, ua = (x43 * (y1 - y3) - y43 * (x1 - x3)) / (y43 * x21 - x43 * y21); - return [ x1 + ua * x21, y1 + ua * y21 ]; - } - function d3_geom_polygonClosed(coordinates) { - var a = coordinates[0], b = coordinates[coordinates.length - 1]; - return !(a[0] - b[0] || a[1] - b[1]); - } - var d3_geom_voronoiEdges, d3_geom_voronoiCells, d3_geom_voronoiBeaches, d3_geom_voronoiBeachPool = [], d3_geom_voronoiFirstCircle, d3_geom_voronoiCircles, d3_geom_voronoiCirclePool = []; - function d3_geom_voronoiBeach() { - d3_geom_voronoiRedBlackNode(this); - this.edge = this.site = this.circle = null; - } - function d3_geom_voronoiCreateBeach(site) { - var beach = d3_geom_voronoiBeachPool.pop() || new d3_geom_voronoiBeach(); - beach.site = site; - return beach; - } - function d3_geom_voronoiDetachBeach(beach) { - d3_geom_voronoiDetachCircle(beach); - d3_geom_voronoiBeaches.remove(beach); - d3_geom_voronoiBeachPool.push(beach); - d3_geom_voronoiRedBlackNode(beach); - } - function d3_geom_voronoiRemoveBeach(beach) { - var circle = beach.circle, x = circle.x, y = circle.cy, vertex = { - x: x, - y: y - }, previous = beach.P, next = beach.N, disappearing = [ beach ]; - d3_geom_voronoiDetachBeach(beach); - var lArc = previous; - while (lArc.circle && abs(x - lArc.circle.x) < ε && abs(y - lArc.circle.cy) < ε) { - previous = lArc.P; - disappearing.unshift(lArc); - d3_geom_voronoiDetachBeach(lArc); - lArc = previous; - } - disappearing.unshift(lArc); - d3_geom_voronoiDetachCircle(lArc); - var rArc = next; - while (rArc.circle && abs(x - rArc.circle.x) < ε && abs(y - rArc.circle.cy) < ε) { - next = rArc.N; - disappearing.push(rArc); - d3_geom_voronoiDetachBeach(rArc); - rArc = next; - } - disappearing.push(rArc); - d3_geom_voronoiDetachCircle(rArc); - var nArcs = disappearing.length, iArc; - for (iArc = 1; iArc < nArcs; ++iArc) { - rArc = disappearing[iArc]; - lArc = disappearing[iArc - 1]; - d3_geom_voronoiSetEdgeEnd(rArc.edge, lArc.site, rArc.site, vertex); - } - lArc = disappearing[0]; - rArc = disappearing[nArcs - 1]; - rArc.edge = d3_geom_voronoiCreateEdge(lArc.site, rArc.site, null, vertex); - d3_geom_voronoiAttachCircle(lArc); - d3_geom_voronoiAttachCircle(rArc); - } - function d3_geom_voronoiAddBeach(site) { - var x = site.x, directrix = site.y, lArc, rArc, dxl, dxr, node = d3_geom_voronoiBeaches._; - while (node) { - dxl = d3_geom_voronoiLeftBreakPoint(node, directrix) - x; - if (dxl > ε) node = node.L; else { - dxr = x - d3_geom_voronoiRightBreakPoint(node, directrix); - if (dxr > ε) { - if (!node.R) { - lArc = node; - break; - } - node = node.R; - } else { - if (dxl > -ε) { - lArc = node.P; - rArc = node; - } else if (dxr > -ε) { - lArc = node; - rArc = node.N; - } else { - lArc = rArc = node; - } - break; - } - } - } - var newArc = d3_geom_voronoiCreateBeach(site); - d3_geom_voronoiBeaches.insert(lArc, newArc); - if (!lArc && !rArc) return; - if (lArc === rArc) { - d3_geom_voronoiDetachCircle(lArc); - rArc = d3_geom_voronoiCreateBeach(lArc.site); - d3_geom_voronoiBeaches.insert(newArc, rArc); - newArc.edge = rArc.edge = d3_geom_voronoiCreateEdge(lArc.site, newArc.site); - d3_geom_voronoiAttachCircle(lArc); - d3_geom_voronoiAttachCircle(rArc); - return; - } - if (!rArc) { - newArc.edge = d3_geom_voronoiCreateEdge(lArc.site, newArc.site); - return; - } - d3_geom_voronoiDetachCircle(lArc); - d3_geom_voronoiDetachCircle(rArc); - var lSite = lArc.site, ax = lSite.x, ay = lSite.y, bx = site.x - ax, by = site.y - ay, rSite = rArc.site, cx = rSite.x - ax, cy = rSite.y - ay, d = 2 * (bx * cy - by * cx), hb = bx * bx + by * by, hc = cx * cx + cy * cy, vertex = { - x: (cy * hb - by * hc) / d + ax, - y: (bx * hc - cx * hb) / d + ay - }; - d3_geom_voronoiSetEdgeEnd(rArc.edge, lSite, rSite, vertex); - newArc.edge = d3_geom_voronoiCreateEdge(lSite, site, null, vertex); - rArc.edge = d3_geom_voronoiCreateEdge(site, rSite, null, vertex); - d3_geom_voronoiAttachCircle(lArc); - d3_geom_voronoiAttachCircle(rArc); - } - function d3_geom_voronoiLeftBreakPoint(arc, directrix) { - var site = arc.site, rfocx = site.x, rfocy = site.y, pby2 = rfocy - directrix; - if (!pby2) return rfocx; - var lArc = arc.P; - if (!lArc) return -Infinity; - site = lArc.site; - var lfocx = site.x, lfocy = site.y, plby2 = lfocy - directrix; - if (!plby2) return lfocx; - var hl = lfocx - rfocx, aby2 = 1 / pby2 - 1 / plby2, b = hl / plby2; - if (aby2) return (-b + Math.sqrt(b * b - 2 * aby2 * (hl * hl / (-2 * plby2) - lfocy + plby2 / 2 + rfocy - pby2 / 2))) / aby2 + rfocx; - return (rfocx + lfocx) / 2; - } - function d3_geom_voronoiRightBreakPoint(arc, directrix) { - var rArc = arc.N; - if (rArc) return d3_geom_voronoiLeftBreakPoint(rArc, directrix); - var site = arc.site; - return site.y === directrix ? site.x : Infinity; - } - function d3_geom_voronoiCell(site) { - this.site = site; - this.edges = []; - } - d3_geom_voronoiCell.prototype.prepare = function() { - var halfEdges = this.edges, iHalfEdge = halfEdges.length, edge; - while (iHalfEdge--) { - edge = halfEdges[iHalfEdge].edge; - if (!edge.b || !edge.a) halfEdges.splice(iHalfEdge, 1); - } - halfEdges.sort(d3_geom_voronoiHalfEdgeOrder); - return halfEdges.length; - }; - function d3_geom_voronoiCloseCells(extent) { - var x0 = extent[0][0], x1 = extent[1][0], y0 = extent[0][1], y1 = extent[1][1], x2, y2, x3, y3, cells = d3_geom_voronoiCells, iCell = cells.length, cell, iHalfEdge, halfEdges, nHalfEdges, start, end; - while (iCell--) { - cell = cells[iCell]; - if (!cell || !cell.prepare()) continue; - halfEdges = cell.edges; - nHalfEdges = halfEdges.length; - iHalfEdge = 0; - while (iHalfEdge < nHalfEdges) { - end = halfEdges[iHalfEdge].end(), x3 = end.x, y3 = end.y; - start = halfEdges[++iHalfEdge % nHalfEdges].start(), x2 = start.x, y2 = start.y; - if (abs(x3 - x2) > ε || abs(y3 - y2) > ε) { - halfEdges.splice(iHalfEdge, 0, new d3_geom_voronoiHalfEdge(d3_geom_voronoiCreateBorderEdge(cell.site, end, abs(x3 - x0) < ε && y1 - y3 > ε ? { - x: x0, - y: abs(x2 - x0) < ε ? y2 : y1 - } : abs(y3 - y1) < ε && x1 - x3 > ε ? { - x: abs(y2 - y1) < ε ? x2 : x1, - y: y1 - } : abs(x3 - x1) < ε && y3 - y0 > ε ? { - x: x1, - y: abs(x2 - x1) < ε ? y2 : y0 - } : abs(y3 - y0) < ε && x3 - x0 > ε ? { - x: abs(y2 - y0) < ε ? x2 : x0, - y: y0 - } : null), cell.site, null)); - ++nHalfEdges; - } - } - } - } - function d3_geom_voronoiHalfEdgeOrder(a, b) { - return b.angle - a.angle; - } - function d3_geom_voronoiCircle() { - d3_geom_voronoiRedBlackNode(this); - this.x = this.y = this.arc = this.site = this.cy = null; - } - function d3_geom_voronoiAttachCircle(arc) { - var lArc = arc.P, rArc = arc.N; - if (!lArc || !rArc) return; - var lSite = lArc.site, cSite = arc.site, rSite = rArc.site; - if (lSite === rSite) return; - var bx = cSite.x, by = cSite.y, ax = lSite.x - bx, ay = lSite.y - by, cx = rSite.x - bx, cy = rSite.y - by; - var d = 2 * (ax * cy - ay * cx); - if (d >= -ε2) return; - var ha = ax * ax + ay * ay, hc = cx * cx + cy * cy, x = (cy * ha - ay * hc) / d, y = (ax * hc - cx * ha) / d, cy = y + by; - var circle = d3_geom_voronoiCirclePool.pop() || new d3_geom_voronoiCircle(); - circle.arc = arc; - circle.site = cSite; - circle.x = x + bx; - circle.y = cy + Math.sqrt(x * x + y * y); - circle.cy = cy; - arc.circle = circle; - var before = null, node = d3_geom_voronoiCircles._; - while (node) { - if (circle.y < node.y || circle.y === node.y && circle.x <= node.x) { - if (node.L) node = node.L; else { - before = node.P; - break; - } - } else { - if (node.R) node = node.R; else { - before = node; - break; - } - } - } - d3_geom_voronoiCircles.insert(before, circle); - if (!before) d3_geom_voronoiFirstCircle = circle; - } - function d3_geom_voronoiDetachCircle(arc) { - var circle = arc.circle; - if (circle) { - if (!circle.P) d3_geom_voronoiFirstCircle = circle.N; - d3_geom_voronoiCircles.remove(circle); - d3_geom_voronoiCirclePool.push(circle); - d3_geom_voronoiRedBlackNode(circle); - arc.circle = null; - } - } - function d3_geom_voronoiClipEdges(extent) { - var edges = d3_geom_voronoiEdges, clip = d3_geom_clipLine(extent[0][0], extent[0][1], extent[1][0], extent[1][1]), i = edges.length, e; - while (i--) { - e = edges[i]; - if (!d3_geom_voronoiConnectEdge(e, extent) || !clip(e) || abs(e.a.x - e.b.x) < ε && abs(e.a.y - e.b.y) < ε) { - e.a = e.b = null; - edges.splice(i, 1); - } - } - } - function d3_geom_voronoiConnectEdge(edge, extent) { - var vb = edge.b; - if (vb) return true; - var va = edge.a, x0 = extent[0][0], x1 = extent[1][0], y0 = extent[0][1], y1 = extent[1][1], lSite = edge.l, rSite = edge.r, lx = lSite.x, ly = lSite.y, rx = rSite.x, ry = rSite.y, fx = (lx + rx) / 2, fy = (ly + ry) / 2, fm, fb; - if (ry === ly) { - if (fx < x0 || fx >= x1) return; - if (lx > rx) { - if (!va) va = { - x: fx, - y: y0 - }; else if (va.y >= y1) return; - vb = { - x: fx, - y: y1 - }; - } else { - if (!va) va = { - x: fx, - y: y1 - }; else if (va.y < y0) return; - vb = { - x: fx, - y: y0 - }; - } - } else { - fm = (lx - rx) / (ry - ly); - fb = fy - fm * fx; - if (fm < -1 || fm > 1) { - if (lx > rx) { - if (!va) va = { - x: (y0 - fb) / fm, - y: y0 - }; else if (va.y >= y1) return; - vb = { - x: (y1 - fb) / fm, - y: y1 - }; - } else { - if (!va) va = { - x: (y1 - fb) / fm, - y: y1 - }; else if (va.y < y0) return; - vb = { - x: (y0 - fb) / fm, - y: y0 - }; - } - } else { - if (ly < ry) { - if (!va) va = { - x: x0, - y: fm * x0 + fb - }; else if (va.x >= x1) return; - vb = { - x: x1, - y: fm * x1 + fb - }; - } else { - if (!va) va = { - x: x1, - y: fm * x1 + fb - }; else if (va.x < x0) return; - vb = { - x: x0, - y: fm * x0 + fb - }; - } - } - } - edge.a = va; - edge.b = vb; - return true; - } - function d3_geom_voronoiEdge(lSite, rSite) { - this.l = lSite; - this.r = rSite; - this.a = this.b = null; - } - function d3_geom_voronoiCreateEdge(lSite, rSite, va, vb) { - var edge = new d3_geom_voronoiEdge(lSite, rSite); - d3_geom_voronoiEdges.push(edge); - if (va) d3_geom_voronoiSetEdgeEnd(edge, lSite, rSite, va); - if (vb) d3_geom_voronoiSetEdgeEnd(edge, rSite, lSite, vb); - d3_geom_voronoiCells[lSite.i].edges.push(new d3_geom_voronoiHalfEdge(edge, lSite, rSite)); - d3_geom_voronoiCells[rSite.i].edges.push(new d3_geom_voronoiHalfEdge(edge, rSite, lSite)); - return edge; - } - function d3_geom_voronoiCreateBorderEdge(lSite, va, vb) { - var edge = new d3_geom_voronoiEdge(lSite, null); - edge.a = va; - edge.b = vb; - d3_geom_voronoiEdges.push(edge); - return edge; - } - function d3_geom_voronoiSetEdgeEnd(edge, lSite, rSite, vertex) { - if (!edge.a && !edge.b) { - edge.a = vertex; - edge.l = lSite; - edge.r = rSite; - } else if (edge.l === rSite) { - edge.b = vertex; - } else { - edge.a = vertex; - } - } - function d3_geom_voronoiHalfEdge(edge, lSite, rSite) { - var va = edge.a, vb = edge.b; - this.edge = edge; - this.site = lSite; - this.angle = rSite ? Math.atan2(rSite.y - lSite.y, rSite.x - lSite.x) : edge.l === lSite ? Math.atan2(vb.x - va.x, va.y - vb.y) : Math.atan2(va.x - vb.x, vb.y - va.y); - } - d3_geom_voronoiHalfEdge.prototype = { - start: function() { - return this.edge.l === this.site ? this.edge.a : this.edge.b; - }, - end: function() { - return this.edge.l === this.site ? this.edge.b : this.edge.a; - } - }; - function d3_geom_voronoiRedBlackTree() { - this._ = null; - } - function d3_geom_voronoiRedBlackNode(node) { - node.U = node.C = node.L = node.R = node.P = node.N = null; - } - d3_geom_voronoiRedBlackTree.prototype = { - insert: function(after, node) { - var parent, grandpa, uncle; - if (after) { - node.P = after; - node.N = after.N; - if (after.N) after.N.P = node; - after.N = node; - if (after.R) { - after = after.R; - while (after.L) after = after.L; - after.L = node; - } else { - after.R = node; - } - parent = after; - } else if (this._) { - after = d3_geom_voronoiRedBlackFirst(this._); - node.P = null; - node.N = after; - after.P = after.L = node; - parent = after; - } else { - node.P = node.N = null; - this._ = node; - parent = null; - } - node.L = node.R = null; - node.U = parent; - node.C = true; - after = node; - while (parent && parent.C) { - grandpa = parent.U; - if (parent === grandpa.L) { - uncle = grandpa.R; - if (uncle && uncle.C) { - parent.C = uncle.C = false; - grandpa.C = true; - after = grandpa; - } else { - if (after === parent.R) { - d3_geom_voronoiRedBlackRotateLeft(this, parent); - after = parent; - parent = after.U; - } - parent.C = false; - grandpa.C = true; - d3_geom_voronoiRedBlackRotateRight(this, grandpa); - } - } else { - uncle = grandpa.L; - if (uncle && uncle.C) { - parent.C = uncle.C = false; - grandpa.C = true; - after = grandpa; - } else { - if (after === parent.L) { - d3_geom_voronoiRedBlackRotateRight(this, parent); - after = parent; - parent = after.U; - } - parent.C = false; - grandpa.C = true; - d3_geom_voronoiRedBlackRotateLeft(this, grandpa); - } - } - parent = after.U; - } - this._.C = false; - }, - remove: function(node) { - if (node.N) node.N.P = node.P; - if (node.P) node.P.N = node.N; - node.N = node.P = null; - var parent = node.U, sibling, left = node.L, right = node.R, next, red; - if (!left) next = right; else if (!right) next = left; else next = d3_geom_voronoiRedBlackFirst(right); - if (parent) { - if (parent.L === node) parent.L = next; else parent.R = next; - } else { - this._ = next; - } - if (left && right) { - red = next.C; - next.C = node.C; - next.L = left; - left.U = next; - if (next !== right) { - parent = next.U; - next.U = node.U; - node = next.R; - parent.L = node; - next.R = right; - right.U = next; - } else { - next.U = parent; - parent = next; - node = next.R; - } - } else { - red = node.C; - node = next; - } - if (node) node.U = parent; - if (red) return; - if (node && node.C) { - node.C = false; - return; - } - do { - if (node === this._) break; - if (node === parent.L) { - sibling = parent.R; - if (sibling.C) { - sibling.C = false; - parent.C = true; - d3_geom_voronoiRedBlackRotateLeft(this, parent); - sibling = parent.R; - } - if (sibling.L && sibling.L.C || sibling.R && sibling.R.C) { - if (!sibling.R || !sibling.R.C) { - sibling.L.C = false; - sibling.C = true; - d3_geom_voronoiRedBlackRotateRight(this, sibling); - sibling = parent.R; - } - sibling.C = parent.C; - parent.C = sibling.R.C = false; - d3_geom_voronoiRedBlackRotateLeft(this, parent); - node = this._; - break; - } - } else { - sibling = parent.L; - if (sibling.C) { - sibling.C = false; - parent.C = true; - d3_geom_voronoiRedBlackRotateRight(this, parent); - sibling = parent.L; - } - if (sibling.L && sibling.L.C || sibling.R && sibling.R.C) { - if (!sibling.L || !sibling.L.C) { - sibling.R.C = false; - sibling.C = true; - d3_geom_voronoiRedBlackRotateLeft(this, sibling); - sibling = parent.L; - } - sibling.C = parent.C; - parent.C = sibling.L.C = false; - d3_geom_voronoiRedBlackRotateRight(this, parent); - node = this._; - break; - } - } - sibling.C = true; - node = parent; - parent = parent.U; - } while (!node.C); - if (node) node.C = false; - } - }; - function d3_geom_voronoiRedBlackRotateLeft(tree, node) { - var p = node, q = node.R, parent = p.U; - if (parent) { - if (parent.L === p) parent.L = q; else parent.R = q; - } else { - tree._ = q; - } - q.U = parent; - p.U = q; - p.R = q.L; - if (p.R) p.R.U = p; - q.L = p; - } - function d3_geom_voronoiRedBlackRotateRight(tree, node) { - var p = node, q = node.L, parent = p.U; - if (parent) { - if (parent.L === p) parent.L = q; else parent.R = q; - } else { - tree._ = q; - } - q.U = parent; - p.U = q; - p.L = q.R; - if (p.L) p.L.U = p; - q.R = p; - } - function d3_geom_voronoiRedBlackFirst(node) { - while (node.L) node = node.L; - return node; - } - function d3_geom_voronoi(sites, bbox) { - var site = sites.sort(d3_geom_voronoiVertexOrder).pop(), x0, y0, circle; - d3_geom_voronoiEdges = []; - d3_geom_voronoiCells = new Array(sites.length); - d3_geom_voronoiBeaches = new d3_geom_voronoiRedBlackTree(); - d3_geom_voronoiCircles = new d3_geom_voronoiRedBlackTree(); - while (true) { - circle = d3_geom_voronoiFirstCircle; - if (site && (!circle || site.y < circle.y || site.y === circle.y && site.x < circle.x)) { - if (site.x !== x0 || site.y !== y0) { - d3_geom_voronoiCells[site.i] = new d3_geom_voronoiCell(site); - d3_geom_voronoiAddBeach(site); - x0 = site.x, y0 = site.y; - } - site = sites.pop(); - } else if (circle) { - d3_geom_voronoiRemoveBeach(circle.arc); - } else { - break; - } - } - if (bbox) d3_geom_voronoiClipEdges(bbox), d3_geom_voronoiCloseCells(bbox); - var diagram = { - cells: d3_geom_voronoiCells, - edges: d3_geom_voronoiEdges - }; - d3_geom_voronoiBeaches = d3_geom_voronoiCircles = d3_geom_voronoiEdges = d3_geom_voronoiCells = null; - return diagram; - } - function d3_geom_voronoiVertexOrder(a, b) { - return b.y - a.y || b.x - a.x; - } - d3.geom.voronoi = function(points) { - var x = d3_geom_pointX, y = d3_geom_pointY, fx = x, fy = y, clipExtent = d3_geom_voronoiClipExtent; - if (points) return voronoi(points); - function voronoi(data) { - var polygons = new Array(data.length), x0 = clipExtent[0][0], y0 = clipExtent[0][1], x1 = clipExtent[1][0], y1 = clipExtent[1][1]; - d3_geom_voronoi(sites(data), clipExtent).cells.forEach(function(cell, i) { - var edges = cell.edges, site = cell.site, polygon = polygons[i] = edges.length ? edges.map(function(e) { - var s = e.start(); - return [ s.x, s.y ]; - }) : site.x >= x0 && site.x <= x1 && site.y >= y0 && site.y <= y1 ? [ [ x0, y1 ], [ x1, y1 ], [ x1, y0 ], [ x0, y0 ] ] : []; - polygon.point = data[i]; - }); - return polygons; - } - function sites(data) { - return data.map(function(d, i) { - return { - x: Math.round(fx(d, i) / ε) * ε, - y: Math.round(fy(d, i) / ε) * ε, - i: i - }; - }); - } - voronoi.links = function(data) { - return d3_geom_voronoi(sites(data)).edges.filter(function(edge) { - return edge.l && edge.r; - }).map(function(edge) { - return { - source: data[edge.l.i], - target: data[edge.r.i] - }; - }); - }; - voronoi.triangles = function(data) { - var triangles = []; - d3_geom_voronoi(sites(data)).cells.forEach(function(cell, i) { - var site = cell.site, edges = cell.edges.sort(d3_geom_voronoiHalfEdgeOrder), j = -1, m = edges.length, e0, s0, e1 = edges[m - 1].edge, s1 = e1.l === site ? e1.r : e1.l; - while (++j < m) { - e0 = e1; - s0 = s1; - e1 = edges[j].edge; - s1 = e1.l === site ? e1.r : e1.l; - if (i < s0.i && i < s1.i && d3_geom_voronoiTriangleArea(site, s0, s1) < 0) { - triangles.push([ data[i], data[s0.i], data[s1.i] ]); - } - } - }); - return triangles; - }; - voronoi.x = function(_) { - return arguments.length ? (fx = d3_functor(x = _), voronoi) : x; - }; - voronoi.y = function(_) { - return arguments.length ? (fy = d3_functor(y = _), voronoi) : y; - }; - voronoi.clipExtent = function(_) { - if (!arguments.length) return clipExtent === d3_geom_voronoiClipExtent ? null : clipExtent; - clipExtent = _ == null ? d3_geom_voronoiClipExtent : _; - return voronoi; - }; - voronoi.size = function(_) { - if (!arguments.length) return clipExtent === d3_geom_voronoiClipExtent ? null : clipExtent && clipExtent[1]; - return voronoi.clipExtent(_ && [ [ 0, 0 ], _ ]); - }; - return voronoi; - }; - var d3_geom_voronoiClipExtent = [ [ -1e6, -1e6 ], [ 1e6, 1e6 ] ]; - function d3_geom_voronoiTriangleArea(a, b, c) { - return (a.x - c.x) * (b.y - a.y) - (a.x - b.x) * (c.y - a.y); - } - d3.geom.delaunay = function(vertices) { - return d3.geom.voronoi().triangles(vertices); - }; - d3.geom.quadtree = function(points, x1, y1, x2, y2) { - var x = d3_geom_pointX, y = d3_geom_pointY, compat; - if (compat = arguments.length) { - x = d3_geom_quadtreeCompatX; - y = d3_geom_quadtreeCompatY; - if (compat === 3) { - y2 = y1; - x2 = x1; - y1 = x1 = 0; - } - return quadtree(points); - } - function quadtree(data) { - var d, fx = d3_functor(x), fy = d3_functor(y), xs, ys, i, n, x1_, y1_, x2_, y2_; - if (x1 != null) { - x1_ = x1, y1_ = y1, x2_ = x2, y2_ = y2; - } else { - x2_ = y2_ = -(x1_ = y1_ = Infinity); - xs = [], ys = []; - n = data.length; - if (compat) for (i = 0; i < n; ++i) { - d = data[i]; - if (d.x < x1_) x1_ = d.x; - if (d.y < y1_) y1_ = d.y; - if (d.x > x2_) x2_ = d.x; - if (d.y > y2_) y2_ = d.y; - xs.push(d.x); - ys.push(d.y); - } else for (i = 0; i < n; ++i) { - var x_ = +fx(d = data[i], i), y_ = +fy(d, i); - if (x_ < x1_) x1_ = x_; - if (y_ < y1_) y1_ = y_; - if (x_ > x2_) x2_ = x_; - if (y_ > y2_) y2_ = y_; - xs.push(x_); - ys.push(y_); - } - } - var dx = x2_ - x1_, dy = y2_ - y1_; - if (dx > dy) y2_ = y1_ + dx; else x2_ = x1_ + dy; - function insert(n, d, x, y, x1, y1, x2, y2) { - if (isNaN(x) || isNaN(y)) return; - if (n.leaf) { - var nx = n.x, ny = n.y; - if (nx != null) { - if (abs(nx - x) + abs(ny - y) < .01) { - insertChild(n, d, x, y, x1, y1, x2, y2); - } else { - var nPoint = n.point; - n.x = n.y = n.point = null; - insertChild(n, nPoint, nx, ny, x1, y1, x2, y2); - insertChild(n, d, x, y, x1, y1, x2, y2); - } - } else { - n.x = x, n.y = y, n.point = d; - } - } else { - insertChild(n, d, x, y, x1, y1, x2, y2); - } - } - function insertChild(n, d, x, y, x1, y1, x2, y2) { - var xm = (x1 + x2) * .5, ym = (y1 + y2) * .5, right = x >= xm, below = y >= ym, i = below << 1 | right; - n.leaf = false; - n = n.nodes[i] || (n.nodes[i] = d3_geom_quadtreeNode()); - if (right) x1 = xm; else x2 = xm; - if (below) y1 = ym; else y2 = ym; - insert(n, d, x, y, x1, y1, x2, y2); - } - var root = d3_geom_quadtreeNode(); - root.add = function(d) { - insert(root, d, +fx(d, ++i), +fy(d, i), x1_, y1_, x2_, y2_); - }; - root.visit = function(f) { - d3_geom_quadtreeVisit(f, root, x1_, y1_, x2_, y2_); - }; - root.find = function(point) { - return d3_geom_quadtreeFind(root, point[0], point[1], x1_, y1_, x2_, y2_); - }; - i = -1; - if (x1 == null) { - while (++i < n) { - insert(root, data[i], xs[i], ys[i], x1_, y1_, x2_, y2_); - } - --i; - } else data.forEach(root.add); - xs = ys = data = d = null; - return root; - } - quadtree.x = function(_) { - return arguments.length ? (x = _, quadtree) : x; - }; - quadtree.y = function(_) { - return arguments.length ? (y = _, quadtree) : y; - }; - quadtree.extent = function(_) { - if (!arguments.length) return x1 == null ? null : [ [ x1, y1 ], [ x2, y2 ] ]; - if (_ == null) x1 = y1 = x2 = y2 = null; else x1 = +_[0][0], y1 = +_[0][1], x2 = +_[1][0], - y2 = +_[1][1]; - return quadtree; - }; - quadtree.size = function(_) { - if (!arguments.length) return x1 == null ? null : [ x2 - x1, y2 - y1 ]; - if (_ == null) x1 = y1 = x2 = y2 = null; else x1 = y1 = 0, x2 = +_[0], y2 = +_[1]; - return quadtree; - }; - return quadtree; - }; - function d3_geom_quadtreeCompatX(d) { - return d.x; - } - function d3_geom_quadtreeCompatY(d) { - return d.y; - } - function d3_geom_quadtreeNode() { - return { - leaf: true, - nodes: [], - point: null, - x: null, - y: null - }; - } - function d3_geom_quadtreeVisit(f, node, x1, y1, x2, y2) { - if (!f(node, x1, y1, x2, y2)) { - var sx = (x1 + x2) * .5, sy = (y1 + y2) * .5, children = node.nodes; - if (children[0]) d3_geom_quadtreeVisit(f, children[0], x1, y1, sx, sy); - if (children[1]) d3_geom_quadtreeVisit(f, children[1], sx, y1, x2, sy); - if (children[2]) d3_geom_quadtreeVisit(f, children[2], x1, sy, sx, y2); - if (children[3]) d3_geom_quadtreeVisit(f, children[3], sx, sy, x2, y2); - } - } - function d3_geom_quadtreeFind(root, x, y, x0, y0, x3, y3) { - var minDistance2 = Infinity, closestPoint; - (function find(node, x1, y1, x2, y2) { - if (x1 > x3 || y1 > y3 || x2 < x0 || y2 < y0) return; - if (point = node.point) { - var point, dx = x - node.x, dy = y - node.y, distance2 = dx * dx + dy * dy; - if (distance2 < minDistance2) { - var distance = Math.sqrt(minDistance2 = distance2); - x0 = x - distance, y0 = y - distance; - x3 = x + distance, y3 = y + distance; - closestPoint = point; - } - } - var children = node.nodes, xm = (x1 + x2) * .5, ym = (y1 + y2) * .5, right = x >= xm, below = y >= ym; - for (var i = below << 1 | right, j = i + 4; i < j; ++i) { - if (node = children[i & 3]) switch (i & 3) { - case 0: - find(node, x1, y1, xm, ym); - break; - - case 1: - find(node, xm, y1, x2, ym); - break; - - case 2: - find(node, x1, ym, xm, y2); - break; - - case 3: - find(node, xm, ym, x2, y2); - break; - } - } - })(root, x0, y0, x3, y3); - return closestPoint; - } - d3.interpolateRgb = d3_interpolateRgb; - function d3_interpolateRgb(a, b) { - a = d3.rgb(a); - b = d3.rgb(b); - var ar = a.r, ag = a.g, ab = a.b, br = b.r - ar, bg = b.g - ag, bb = b.b - ab; - return function(t) { - return "#" + d3_rgb_hex(Math.round(ar + br * t)) + d3_rgb_hex(Math.round(ag + bg * t)) + d3_rgb_hex(Math.round(ab + bb * t)); - }; - } - d3.interpolateObject = d3_interpolateObject; - function d3_interpolateObject(a, b) { - var i = {}, c = {}, k; - for (k in a) { - if (k in b) { - i[k] = d3_interpolate(a[k], b[k]); - } else { - c[k] = a[k]; - } - } - for (k in b) { - if (!(k in a)) { - c[k] = b[k]; - } - } - return function(t) { - for (k in i) c[k] = i[k](t); - return c; - }; - } - d3.interpolateNumber = d3_interpolateNumber; - function d3_interpolateNumber(a, b) { - a = +a, b = +b; - return function(t) { - return a * (1 - t) + b * t; - }; - } - d3.interpolateString = d3_interpolateString; - function d3_interpolateString(a, b) { - var bi = d3_interpolate_numberA.lastIndex = d3_interpolate_numberB.lastIndex = 0, am, bm, bs, i = -1, s = [], q = []; - a = a + "", b = b + ""; - while ((am = d3_interpolate_numberA.exec(a)) && (bm = d3_interpolate_numberB.exec(b))) { - if ((bs = bm.index) > bi) { - bs = b.slice(bi, bs); - if (s[i]) s[i] += bs; else s[++i] = bs; - } - if ((am = am[0]) === (bm = bm[0])) { - if (s[i]) s[i] += bm; else s[++i] = bm; - } else { - s[++i] = null; - q.push({ - i: i, - x: d3_interpolateNumber(am, bm) - }); - } - bi = d3_interpolate_numberB.lastIndex; - } - if (bi < b.length) { - bs = b.slice(bi); - if (s[i]) s[i] += bs; else s[++i] = bs; - } - return s.length < 2 ? q[0] ? (b = q[0].x, function(t) { - return b(t) + ""; - }) : function() { - return b; - } : (b = q.length, function(t) { - for (var i = 0, o; i < b; ++i) s[(o = q[i]).i] = o.x(t); - return s.join(""); - }); - } - var d3_interpolate_numberA = /[-+]?(?:\d+\.?\d*|\.?\d+)(?:[eE][-+]?\d+)?/g, d3_interpolate_numberB = new RegExp(d3_interpolate_numberA.source, "g"); - d3.interpolate = d3_interpolate; - function d3_interpolate(a, b) { - var i = d3.interpolators.length, f; - while (--i >= 0 && !(f = d3.interpolators[i](a, b))) ; - return f; - } - d3.interpolators = [ function(a, b) { - var t = typeof b; - return (t === "string" ? d3_rgb_names.has(b.toLowerCase()) || /^(#|rgb\(|hsl\()/i.test(b) ? d3_interpolateRgb : d3_interpolateString : b instanceof d3_color ? d3_interpolateRgb : Array.isArray(b) ? d3_interpolateArray : t === "object" && isNaN(b) ? d3_interpolateObject : d3_interpolateNumber)(a, b); - } ]; - d3.interpolateArray = d3_interpolateArray; - function d3_interpolateArray(a, b) { - var x = [], c = [], na = a.length, nb = b.length, n0 = Math.min(a.length, b.length), i; - for (i = 0; i < n0; ++i) x.push(d3_interpolate(a[i], b[i])); - for (;i < na; ++i) c[i] = a[i]; - for (;i < nb; ++i) c[i] = b[i]; - return function(t) { - for (i = 0; i < n0; ++i) c[i] = x[i](t); - return c; - }; - } - var d3_ease_default = function() { - return d3_identity; - }; - var d3_ease = d3.map({ - linear: d3_ease_default, - poly: d3_ease_poly, - quad: function() { - return d3_ease_quad; - }, - cubic: function() { - return d3_ease_cubic; - }, - sin: function() { - return d3_ease_sin; - }, - exp: function() { - return d3_ease_exp; - }, - circle: function() { - return d3_ease_circle; - }, - elastic: d3_ease_elastic, - back: d3_ease_back, - bounce: function() { - return d3_ease_bounce; - } - }); - var d3_ease_mode = d3.map({ - "in": d3_identity, - out: d3_ease_reverse, - "in-out": d3_ease_reflect, - "out-in": function(f) { - return d3_ease_reflect(d3_ease_reverse(f)); - } - }); - d3.ease = function(name) { - var i = name.indexOf("-"), t = i >= 0 ? name.slice(0, i) : name, m = i >= 0 ? name.slice(i + 1) : "in"; - t = d3_ease.get(t) || d3_ease_default; - m = d3_ease_mode.get(m) || d3_identity; - return d3_ease_clamp(m(t.apply(null, d3_arraySlice.call(arguments, 1)))); - }; - function d3_ease_clamp(f) { - return function(t) { - return t <= 0 ? 0 : t >= 1 ? 1 : f(t); - }; - } - function d3_ease_reverse(f) { - return function(t) { - return 1 - f(1 - t); - }; - } - function d3_ease_reflect(f) { - return function(t) { - return .5 * (t < .5 ? f(2 * t) : 2 - f(2 - 2 * t)); - }; - } - function d3_ease_quad(t) { - return t * t; - } - function d3_ease_cubic(t) { - return t * t * t; - } - function d3_ease_cubicInOut(t) { - if (t <= 0) return 0; - if (t >= 1) return 1; - var t2 = t * t, t3 = t2 * t; - return 4 * (t < .5 ? t3 : 3 * (t - t2) + t3 - .75); - } - function d3_ease_poly(e) { - return function(t) { - return Math.pow(t, e); - }; - } - function d3_ease_sin(t) { - return 1 - Math.cos(t * halfπ); - } - function d3_ease_exp(t) { - return Math.pow(2, 10 * (t - 1)); - } - function d3_ease_circle(t) { - return 1 - Math.sqrt(1 - t * t); - } - function d3_ease_elastic(a, p) { - var s; - if (arguments.length < 2) p = .45; - if (arguments.length) s = p / τ * Math.asin(1 / a); else a = 1, s = p / 4; - return function(t) { - return 1 + a * Math.pow(2, -10 * t) * Math.sin((t - s) * τ / p); - }; - } - function d3_ease_back(s) { - if (!s) s = 1.70158; - return function(t) { - return t * t * ((s + 1) * t - s); - }; - } - function d3_ease_bounce(t) { - return t < 1 / 2.75 ? 7.5625 * t * t : t < 2 / 2.75 ? 7.5625 * (t -= 1.5 / 2.75) * t + .75 : t < 2.5 / 2.75 ? 7.5625 * (t -= 2.25 / 2.75) * t + .9375 : 7.5625 * (t -= 2.625 / 2.75) * t + .984375; - } - d3.interpolateHcl = d3_interpolateHcl; - function d3_interpolateHcl(a, b) { - a = d3.hcl(a); - b = d3.hcl(b); - var ah = a.h, ac = a.c, al = a.l, bh = b.h - ah, bc = b.c - ac, bl = b.l - al; - if (isNaN(bc)) bc = 0, ac = isNaN(ac) ? b.c : ac; - if (isNaN(bh)) bh = 0, ah = isNaN(ah) ? b.h : ah; else if (bh > 180) bh -= 360; else if (bh < -180) bh += 360; - return function(t) { - return d3_hcl_lab(ah + bh * t, ac + bc * t, al + bl * t) + ""; - }; - } - d3.interpolateHsl = d3_interpolateHsl; - function d3_interpolateHsl(a, b) { - a = d3.hsl(a); - b = d3.hsl(b); - var ah = a.h, as = a.s, al = a.l, bh = b.h - ah, bs = b.s - as, bl = b.l - al; - if (isNaN(bs)) bs = 0, as = isNaN(as) ? b.s : as; - if (isNaN(bh)) bh = 0, ah = isNaN(ah) ? b.h : ah; else if (bh > 180) bh -= 360; else if (bh < -180) bh += 360; - return function(t) { - return d3_hsl_rgb(ah + bh * t, as + bs * t, al + bl * t) + ""; - }; - } - d3.interpolateLab = d3_interpolateLab; - function d3_interpolateLab(a, b) { - a = d3.lab(a); - b = d3.lab(b); - var al = a.l, aa = a.a, ab = a.b, bl = b.l - al, ba = b.a - aa, bb = b.b - ab; - return function(t) { - return d3_lab_rgb(al + bl * t, aa + ba * t, ab + bb * t) + ""; - }; - } - d3.interpolateRound = d3_interpolateRound; - function d3_interpolateRound(a, b) { - b -= a; - return function(t) { - return Math.round(a + b * t); - }; - } - d3.transform = function(string) { - var g = d3_document.createElementNS(d3.ns.prefix.svg, "g"); - return (d3.transform = function(string) { - if (string != null) { - g.setAttribute("transform", string); - var t = g.transform.baseVal.consolidate(); - } - return new d3_transform(t ? t.matrix : d3_transformIdentity); - })(string); - }; - function d3_transform(m) { - var r0 = [ m.a, m.b ], r1 = [ m.c, m.d ], kx = d3_transformNormalize(r0), kz = d3_transformDot(r0, r1), ky = d3_transformNormalize(d3_transformCombine(r1, r0, -kz)) || 0; - if (r0[0] * r1[1] < r1[0] * r0[1]) { - r0[0] *= -1; - r0[1] *= -1; - kx *= -1; - kz *= -1; - } - this.rotate = (kx ? Math.atan2(r0[1], r0[0]) : Math.atan2(-r1[0], r1[1])) * d3_degrees; - this.translate = [ m.e, m.f ]; - this.scale = [ kx, ky ]; - this.skew = ky ? Math.atan2(kz, ky) * d3_degrees : 0; - } - d3_transform.prototype.toString = function() { - return "translate(" + this.translate + ")rotate(" + this.rotate + ")skewX(" + this.skew + ")scale(" + this.scale + ")"; - }; - function d3_transformDot(a, b) { - return a[0] * b[0] + a[1] * b[1]; - } - function d3_transformNormalize(a) { - var k = Math.sqrt(d3_transformDot(a, a)); - if (k) { - a[0] /= k; - a[1] /= k; - } - return k; - } - function d3_transformCombine(a, b, k) { - a[0] += k * b[0]; - a[1] += k * b[1]; - return a; - } - var d3_transformIdentity = { - a: 1, - b: 0, - c: 0, - d: 1, - e: 0, - f: 0 - }; - d3.interpolateTransform = d3_interpolateTransform; - function d3_interpolateTransform(a, b) { - var s = [], q = [], n, A = d3.transform(a), B = d3.transform(b), ta = A.translate, tb = B.translate, ra = A.rotate, rb = B.rotate, wa = A.skew, wb = B.skew, ka = A.scale, kb = B.scale; - if (ta[0] != tb[0] || ta[1] != tb[1]) { - s.push("translate(", null, ",", null, ")"); - q.push({ - i: 1, - x: d3_interpolateNumber(ta[0], tb[0]) - }, { - i: 3, - x: d3_interpolateNumber(ta[1], tb[1]) - }); - } else if (tb[0] || tb[1]) { - s.push("translate(" + tb + ")"); - } else { - s.push(""); - } - if (ra != rb) { - if (ra - rb > 180) rb += 360; else if (rb - ra > 180) ra += 360; - q.push({ - i: s.push(s.pop() + "rotate(", null, ")") - 2, - x: d3_interpolateNumber(ra, rb) - }); - } else if (rb) { - s.push(s.pop() + "rotate(" + rb + ")"); - } - if (wa != wb) { - q.push({ - i: s.push(s.pop() + "skewX(", null, ")") - 2, - x: d3_interpolateNumber(wa, wb) - }); - } else if (wb) { - s.push(s.pop() + "skewX(" + wb + ")"); - } - if (ka[0] != kb[0] || ka[1] != kb[1]) { - n = s.push(s.pop() + "scale(", null, ",", null, ")"); - q.push({ - i: n - 4, - x: d3_interpolateNumber(ka[0], kb[0]) - }, { - i: n - 2, - x: d3_interpolateNumber(ka[1], kb[1]) - }); - } else if (kb[0] != 1 || kb[1] != 1) { - s.push(s.pop() + "scale(" + kb + ")"); - } - n = q.length; - return function(t) { - var i = -1, o; - while (++i < n) s[(o = q[i]).i] = o.x(t); - return s.join(""); - }; - } - function d3_uninterpolateNumber(a, b) { - b = (b -= a = +a) || 1 / b; - return function(x) { - return (x - a) / b; - }; - } - function d3_uninterpolateClamp(a, b) { - b = (b -= a = +a) || 1 / b; - return function(x) { - return Math.max(0, Math.min(1, (x - a) / b)); - }; - } - d3.layout = {}; - d3.layout.bundle = function() { - return function(links) { - var paths = [], i = -1, n = links.length; - while (++i < n) paths.push(d3_layout_bundlePath(links[i])); - return paths; - }; - }; - function d3_layout_bundlePath(link) { - var start = link.source, end = link.target, lca = d3_layout_bundleLeastCommonAncestor(start, end), points = [ start ]; - while (start !== lca) { - start = start.parent; - points.push(start); - } - var k = points.length; - while (end !== lca) { - points.splice(k, 0, end); - end = end.parent; - } - return points; - } - function d3_layout_bundleAncestors(node) { - var ancestors = [], parent = node.parent; - while (parent != null) { - ancestors.push(node); - node = parent; - parent = parent.parent; - } - ancestors.push(node); - return ancestors; - } - function d3_layout_bundleLeastCommonAncestor(a, b) { - if (a === b) return a; - var aNodes = d3_layout_bundleAncestors(a), bNodes = d3_layout_bundleAncestors(b), aNode = aNodes.pop(), bNode = bNodes.pop(), sharedNode = null; - while (aNode === bNode) { - sharedNode = aNode; - aNode = aNodes.pop(); - bNode = bNodes.pop(); - } - return sharedNode; - } - d3.layout.chord = function() { - var chord = {}, chords, groups, matrix, n, padding = 0, sortGroups, sortSubgroups, sortChords; - function relayout() { - var subgroups = {}, groupSums = [], groupIndex = d3.range(n), subgroupIndex = [], k, x, x0, i, j; - chords = []; - groups = []; - k = 0, i = -1; - while (++i < n) { - x = 0, j = -1; - while (++j < n) { - x += matrix[i][j]; - } - groupSums.push(x); - subgroupIndex.push(d3.range(n)); - k += x; - } - if (sortGroups) { - groupIndex.sort(function(a, b) { - return sortGroups(groupSums[a], groupSums[b]); - }); - } - if (sortSubgroups) { - subgroupIndex.forEach(function(d, i) { - d.sort(function(a, b) { - return sortSubgroups(matrix[i][a], matrix[i][b]); - }); - }); - } - k = (τ - padding * n) / k; - x = 0, i = -1; - while (++i < n) { - x0 = x, j = -1; - while (++j < n) { - var di = groupIndex[i], dj = subgroupIndex[di][j], v = matrix[di][dj], a0 = x, a1 = x += v * k; - subgroups[di + "-" + dj] = { - index: di, - subindex: dj, - startAngle: a0, - endAngle: a1, - value: v - }; - } - groups[di] = { - index: di, - startAngle: x0, - endAngle: x, - value: (x - x0) / k - }; - x += padding; - } - i = -1; - while (++i < n) { - j = i - 1; - while (++j < n) { - var source = subgroups[i + "-" + j], target = subgroups[j + "-" + i]; - if (source.value || target.value) { - chords.push(source.value < target.value ? { - source: target, - target: source - } : { - source: source, - target: target - }); - } - } - } - if (sortChords) resort(); - } - function resort() { - chords.sort(function(a, b) { - return sortChords((a.source.value + a.target.value) / 2, (b.source.value + b.target.value) / 2); - }); - } - chord.matrix = function(x) { - if (!arguments.length) return matrix; - n = (matrix = x) && matrix.length; - chords = groups = null; - return chord; - }; - chord.padding = function(x) { - if (!arguments.length) return padding; - padding = x; - chords = groups = null; - return chord; - }; - chord.sortGroups = function(x) { - if (!arguments.length) return sortGroups; - sortGroups = x; - chords = groups = null; - return chord; - }; - chord.sortSubgroups = function(x) { - if (!arguments.length) return sortSubgroups; - sortSubgroups = x; - chords = null; - return chord; - }; - chord.sortChords = function(x) { - if (!arguments.length) return sortChords; - sortChords = x; - if (chords) resort(); - return chord; - }; - chord.chords = function() { - if (!chords) relayout(); - return chords; - }; - chord.groups = function() { - if (!groups) relayout(); - return groups; - }; - return chord; - }; - d3.layout.force = function() { - var force = {}, event = d3.dispatch("start", "tick", "end"), size = [ 1, 1 ], drag, alpha, friction = .9, linkDistance = d3_layout_forceLinkDistance, linkStrength = d3_layout_forceLinkStrength, charge = -30, chargeDistance2 = d3_layout_forceChargeDistance2, gravity = .1, theta2 = .64, nodes = [], links = [], distances, strengths, charges; - function repulse(node) { - return function(quad, x1, _, x2) { - if (quad.point !== node) { - var dx = quad.cx - node.x, dy = quad.cy - node.y, dw = x2 - x1, dn = dx * dx + dy * dy; - if (dw * dw / theta2 < dn) { - if (dn < chargeDistance2) { - var k = quad.charge / dn; - node.px -= dx * k; - node.py -= dy * k; - } - return true; - } - if (quad.point && dn && dn < chargeDistance2) { - var k = quad.pointCharge / dn; - node.px -= dx * k; - node.py -= dy * k; - } - } - return !quad.charge; - }; - } - force.tick = function() { - if ((alpha *= .99) < .005) { - event.end({ - type: "end", - alpha: alpha = 0 - }); - return true; - } - var n = nodes.length, m = links.length, q, i, o, s, t, l, k, x, y; - for (i = 0; i < m; ++i) { - o = links[i]; - s = o.source; - t = o.target; - x = t.x - s.x; - y = t.y - s.y; - if (l = x * x + y * y) { - l = alpha * strengths[i] * ((l = Math.sqrt(l)) - distances[i]) / l; - x *= l; - y *= l; - t.x -= x * (k = s.weight / (t.weight + s.weight)); - t.y -= y * k; - s.x += x * (k = 1 - k); - s.y += y * k; - } - } - if (k = alpha * gravity) { - x = size[0] / 2; - y = size[1] / 2; - i = -1; - if (k) while (++i < n) { - o = nodes[i]; - o.x += (x - o.x) * k; - o.y += (y - o.y) * k; - } - } - if (charge) { - d3_layout_forceAccumulate(q = d3.geom.quadtree(nodes), alpha, charges); - i = -1; - while (++i < n) { - if (!(o = nodes[i]).fixed) { - q.visit(repulse(o)); - } - } - } - i = -1; - while (++i < n) { - o = nodes[i]; - if (o.fixed) { - o.x = o.px; - o.y = o.py; - } else { - o.x -= (o.px - (o.px = o.x)) * friction; - o.y -= (o.py - (o.py = o.y)) * friction; - } - } - event.tick({ - type: "tick", - alpha: alpha - }); - }; - force.nodes = function(x) { - if (!arguments.length) return nodes; - nodes = x; - return force; - }; - force.links = function(x) { - if (!arguments.length) return links; - links = x; - return force; - }; - force.size = function(x) { - if (!arguments.length) return size; - size = x; - return force; - }; - force.linkDistance = function(x) { - if (!arguments.length) return linkDistance; - linkDistance = typeof x === "function" ? x : +x; - return force; - }; - force.distance = force.linkDistance; - force.linkStrength = function(x) { - if (!arguments.length) return linkStrength; - linkStrength = typeof x === "function" ? x : +x; - return force; - }; - force.friction = function(x) { - if (!arguments.length) return friction; - friction = +x; - return force; - }; - force.charge = function(x) { - if (!arguments.length) return charge; - charge = typeof x === "function" ? x : +x; - return force; - }; - force.chargeDistance = function(x) { - if (!arguments.length) return Math.sqrt(chargeDistance2); - chargeDistance2 = x * x; - return force; - }; - force.gravity = function(x) { - if (!arguments.length) return gravity; - gravity = +x; - return force; - }; - force.theta = function(x) { - if (!arguments.length) return Math.sqrt(theta2); - theta2 = x * x; - return force; - }; - force.alpha = function(x) { - if (!arguments.length) return alpha; - x = +x; - if (alpha) { - if (x > 0) alpha = x; else alpha = 0; - } else if (x > 0) { - event.start({ - type: "start", - alpha: alpha = x - }); - d3.timer(force.tick); - } - return force; - }; - force.start = function() { - var i, n = nodes.length, m = links.length, w = size[0], h = size[1], neighbors, o; - for (i = 0; i < n; ++i) { - (o = nodes[i]).index = i; - o.weight = 0; - } - for (i = 0; i < m; ++i) { - o = links[i]; - if (typeof o.source == "number") o.source = nodes[o.source]; - if (typeof o.target == "number") o.target = nodes[o.target]; - ++o.source.weight; - ++o.target.weight; - } - for (i = 0; i < n; ++i) { - o = nodes[i]; - if (isNaN(o.x)) o.x = position("x", w); - if (isNaN(o.y)) o.y = position("y", h); - if (isNaN(o.px)) o.px = o.x; - if (isNaN(o.py)) o.py = o.y; - } - distances = []; - if (typeof linkDistance === "function") for (i = 0; i < m; ++i) distances[i] = +linkDistance.call(this, links[i], i); else for (i = 0; i < m; ++i) distances[i] = linkDistance; - strengths = []; - if (typeof linkStrength === "function") for (i = 0; i < m; ++i) strengths[i] = +linkStrength.call(this, links[i], i); else for (i = 0; i < m; ++i) strengths[i] = linkStrength; - charges = []; - if (typeof charge === "function") for (i = 0; i < n; ++i) charges[i] = +charge.call(this, nodes[i], i); else for (i = 0; i < n; ++i) charges[i] = charge; - function position(dimension, size) { - if (!neighbors) { - neighbors = new Array(n); - for (j = 0; j < n; ++j) { - neighbors[j] = []; - } - for (j = 0; j < m; ++j) { - var o = links[j]; - neighbors[o.source.index].push(o.target); - neighbors[o.target.index].push(o.source); - } - } - var candidates = neighbors[i], j = -1, l = candidates.length, x; - while (++j < l) if (!isNaN(x = candidates[j][dimension])) return x; - return Math.random() * size; - } - return force.resume(); - }; - force.resume = function() { - return force.alpha(.1); - }; - force.stop = function() { - return force.alpha(0); - }; - force.drag = function() { - if (!drag) drag = d3.behavior.drag().origin(d3_identity).on("dragstart.force", d3_layout_forceDragstart).on("drag.force", dragmove).on("dragend.force", d3_layout_forceDragend); - if (!arguments.length) return drag; - this.on("mouseover.force", d3_layout_forceMouseover).on("mouseout.force", d3_layout_forceMouseout).call(drag); - }; - function dragmove(d) { - d.px = d3.event.x, d.py = d3.event.y; - force.resume(); - } - return d3.rebind(force, event, "on"); - }; - function d3_layout_forceDragstart(d) { - d.fixed |= 2; - } - function d3_layout_forceDragend(d) { - d.fixed &= ~6; - } - function d3_layout_forceMouseover(d) { - d.fixed |= 4; - d.px = d.x, d.py = d.y; - } - function d3_layout_forceMouseout(d) { - d.fixed &= ~4; - } - function d3_layout_forceAccumulate(quad, alpha, charges) { - var cx = 0, cy = 0; - quad.charge = 0; - if (!quad.leaf) { - var nodes = quad.nodes, n = nodes.length, i = -1, c; - while (++i < n) { - c = nodes[i]; - if (c == null) continue; - d3_layout_forceAccumulate(c, alpha, charges); - quad.charge += c.charge; - cx += c.charge * c.cx; - cy += c.charge * c.cy; - } - } - if (quad.point) { - if (!quad.leaf) { - quad.point.x += Math.random() - .5; - quad.point.y += Math.random() - .5; - } - var k = alpha * charges[quad.point.index]; - quad.charge += quad.pointCharge = k; - cx += k * quad.point.x; - cy += k * quad.point.y; - } - quad.cx = cx / quad.charge; - quad.cy = cy / quad.charge; - } - var d3_layout_forceLinkDistance = 20, d3_layout_forceLinkStrength = 1, d3_layout_forceChargeDistance2 = Infinity; - d3.layout.hierarchy = function() { - var sort = d3_layout_hierarchySort, children = d3_layout_hierarchyChildren, value = d3_layout_hierarchyValue; - function hierarchy(root) { - var stack = [ root ], nodes = [], node; - root.depth = 0; - while ((node = stack.pop()) != null) { - nodes.push(node); - if ((childs = children.call(hierarchy, node, node.depth)) && (n = childs.length)) { - var n, childs, child; - while (--n >= 0) { - stack.push(child = childs[n]); - child.parent = node; - child.depth = node.depth + 1; - } - if (value) node.value = 0; - node.children = childs; - } else { - if (value) node.value = +value.call(hierarchy, node, node.depth) || 0; - delete node.children; - } - } - d3_layout_hierarchyVisitAfter(root, function(node) { - var childs, parent; - if (sort && (childs = node.children)) childs.sort(sort); - if (value && (parent = node.parent)) parent.value += node.value; - }); - return nodes; - } - hierarchy.sort = function(x) { - if (!arguments.length) return sort; - sort = x; - return hierarchy; - }; - hierarchy.children = function(x) { - if (!arguments.length) return children; - children = x; - return hierarchy; - }; - hierarchy.value = function(x) { - if (!arguments.length) return value; - value = x; - return hierarchy; - }; - hierarchy.revalue = function(root) { - if (value) { - d3_layout_hierarchyVisitBefore(root, function(node) { - if (node.children) node.value = 0; - }); - d3_layout_hierarchyVisitAfter(root, function(node) { - var parent; - if (!node.children) node.value = +value.call(hierarchy, node, node.depth) || 0; - if (parent = node.parent) parent.value += node.value; - }); - } - return root; - }; - return hierarchy; - }; - function d3_layout_hierarchyRebind(object, hierarchy) { - d3.rebind(object, hierarchy, "sort", "children", "value"); - object.nodes = object; - object.links = d3_layout_hierarchyLinks; - return object; - } - function d3_layout_hierarchyVisitBefore(node, callback) { - var nodes = [ node ]; - while ((node = nodes.pop()) != null) { - callback(node); - if ((children = node.children) && (n = children.length)) { - var n, children; - while (--n >= 0) nodes.push(children[n]); - } - } - } - function d3_layout_hierarchyVisitAfter(node, callback) { - var nodes = [ node ], nodes2 = []; - while ((node = nodes.pop()) != null) { - nodes2.push(node); - if ((children = node.children) && (n = children.length)) { - var i = -1, n, children; - while (++i < n) nodes.push(children[i]); - } - } - while ((node = nodes2.pop()) != null) { - callback(node); - } - } - function d3_layout_hierarchyChildren(d) { - return d.children; - } - function d3_layout_hierarchyValue(d) { - return d.value; - } - function d3_layout_hierarchySort(a, b) { - return b.value - a.value; - } - function d3_layout_hierarchyLinks(nodes) { - return d3.merge(nodes.map(function(parent) { - return (parent.children || []).map(function(child) { - return { - source: parent, - target: child - }; - }); - })); - } - d3.layout.partition = function() { - var hierarchy = d3.layout.hierarchy(), size = [ 1, 1 ]; - function position(node, x, dx, dy) { - var children = node.children; - node.x = x; - node.y = node.depth * dy; - node.dx = dx; - node.dy = dy; - if (children && (n = children.length)) { - var i = -1, n, c, d; - dx = node.value ? dx / node.value : 0; - while (++i < n) { - position(c = children[i], x, d = c.value * dx, dy); - x += d; - } - } - } - function depth(node) { - var children = node.children, d = 0; - if (children && (n = children.length)) { - var i = -1, n; - while (++i < n) d = Math.max(d, depth(children[i])); - } - return 1 + d; - } - function partition(d, i) { - var nodes = hierarchy.call(this, d, i); - position(nodes[0], 0, size[0], size[1] / depth(nodes[0])); - return nodes; - } - partition.size = function(x) { - if (!arguments.length) return size; - size = x; - return partition; - }; - return d3_layout_hierarchyRebind(partition, hierarchy); - }; - d3.layout.pie = function() { - var value = Number, sort = d3_layout_pieSortByValue, startAngle = 0, endAngle = τ, padAngle = 0; - function pie(data) { - var n = data.length, values = data.map(function(d, i) { - return +value.call(pie, d, i); - }), a = +(typeof startAngle === "function" ? startAngle.apply(this, arguments) : startAngle), da = (typeof endAngle === "function" ? endAngle.apply(this, arguments) : endAngle) - a, p = Math.min(Math.abs(da) / n, +(typeof padAngle === "function" ? padAngle.apply(this, arguments) : padAngle)), pa = p * (da < 0 ? -1 : 1), k = (da - n * pa) / d3.sum(values), index = d3.range(n), arcs = [], v; - if (sort != null) index.sort(sort === d3_layout_pieSortByValue ? function(i, j) { - return values[j] - values[i]; - } : function(i, j) { - return sort(data[i], data[j]); - }); - index.forEach(function(i) { - arcs[i] = { - data: data[i], - value: v = values[i], - startAngle: a, - endAngle: a += v * k + pa, - padAngle: p - }; - }); - return arcs; - } - pie.value = function(_) { - if (!arguments.length) return value; - value = _; - return pie; - }; - pie.sort = function(_) { - if (!arguments.length) return sort; - sort = _; - return pie; - }; - pie.startAngle = function(_) { - if (!arguments.length) return startAngle; - startAngle = _; - return pie; - }; - pie.endAngle = function(_) { - if (!arguments.length) return endAngle; - endAngle = _; - return pie; - }; - pie.padAngle = function(_) { - if (!arguments.length) return padAngle; - padAngle = _; - return pie; - }; - return pie; - }; - var d3_layout_pieSortByValue = {}; - d3.layout.stack = function() { - var values = d3_identity, order = d3_layout_stackOrderDefault, offset = d3_layout_stackOffsetZero, out = d3_layout_stackOut, x = d3_layout_stackX, y = d3_layout_stackY; - function stack(data, index) { - if (!(n = data.length)) return data; - var series = data.map(function(d, i) { - return values.call(stack, d, i); - }); - var points = series.map(function(d) { - return d.map(function(v, i) { - return [ x.call(stack, v, i), y.call(stack, v, i) ]; - }); - }); - var orders = order.call(stack, points, index); - series = d3.permute(series, orders); - points = d3.permute(points, orders); - var offsets = offset.call(stack, points, index); - var m = series[0].length, n, i, j, o; - for (j = 0; j < m; ++j) { - out.call(stack, series[0][j], o = offsets[j], points[0][j][1]); - for (i = 1; i < n; ++i) { - out.call(stack, series[i][j], o += points[i - 1][j][1], points[i][j][1]); - } - } - return data; - } - stack.values = function(x) { - if (!arguments.length) return values; - values = x; - return stack; - }; - stack.order = function(x) { - if (!arguments.length) return order; - order = typeof x === "function" ? x : d3_layout_stackOrders.get(x) || d3_layout_stackOrderDefault; - return stack; - }; - stack.offset = function(x) { - if (!arguments.length) return offset; - offset = typeof x === "function" ? x : d3_layout_stackOffsets.get(x) || d3_layout_stackOffsetZero; - return stack; - }; - stack.x = function(z) { - if (!arguments.length) return x; - x = z; - return stack; - }; - stack.y = function(z) { - if (!arguments.length) return y; - y = z; - return stack; - }; - stack.out = function(z) { - if (!arguments.length) return out; - out = z; - return stack; - }; - return stack; - }; - function d3_layout_stackX(d) { - return d.x; - } - function d3_layout_stackY(d) { - return d.y; - } - function d3_layout_stackOut(d, y0, y) { - d.y0 = y0; - d.y = y; - } - var d3_layout_stackOrders = d3.map({ - "inside-out": function(data) { - var n = data.length, i, j, max = data.map(d3_layout_stackMaxIndex), sums = data.map(d3_layout_stackReduceSum), index = d3.range(n).sort(function(a, b) { - return max[a] - max[b]; - }), top = 0, bottom = 0, tops = [], bottoms = []; - for (i = 0; i < n; ++i) { - j = index[i]; - if (top < bottom) { - top += sums[j]; - tops.push(j); - } else { - bottom += sums[j]; - bottoms.push(j); - } - } - return bottoms.reverse().concat(tops); - }, - reverse: function(data) { - return d3.range(data.length).reverse(); - }, - "default": d3_layout_stackOrderDefault - }); - var d3_layout_stackOffsets = d3.map({ - silhouette: function(data) { - var n = data.length, m = data[0].length, sums = [], max = 0, i, j, o, y0 = []; - for (j = 0; j < m; ++j) { - for (i = 0, o = 0; i < n; i++) o += data[i][j][1]; - if (o > max) max = o; - sums.push(o); - } - for (j = 0; j < m; ++j) { - y0[j] = (max - sums[j]) / 2; - } - return y0; - }, - wiggle: function(data) { - var n = data.length, x = data[0], m = x.length, i, j, k, s1, s2, s3, dx, o, o0, y0 = []; - y0[0] = o = o0 = 0; - for (j = 1; j < m; ++j) { - for (i = 0, s1 = 0; i < n; ++i) s1 += data[i][j][1]; - for (i = 0, s2 = 0, dx = x[j][0] - x[j - 1][0]; i < n; ++i) { - for (k = 0, s3 = (data[i][j][1] - data[i][j - 1][1]) / (2 * dx); k < i; ++k) { - s3 += (data[k][j][1] - data[k][j - 1][1]) / dx; - } - s2 += s3 * data[i][j][1]; - } - y0[j] = o -= s1 ? s2 / s1 * dx : 0; - if (o < o0) o0 = o; - } - for (j = 0; j < m; ++j) y0[j] -= o0; - return y0; - }, - expand: function(data) { - var n = data.length, m = data[0].length, k = 1 / n, i, j, o, y0 = []; - for (j = 0; j < m; ++j) { - for (i = 0, o = 0; i < n; i++) o += data[i][j][1]; - if (o) for (i = 0; i < n; i++) data[i][j][1] /= o; else for (i = 0; i < n; i++) data[i][j][1] = k; - } - for (j = 0; j < m; ++j) y0[j] = 0; - return y0; - }, - zero: d3_layout_stackOffsetZero - }); - function d3_layout_stackOrderDefault(data) { - return d3.range(data.length); - } - function d3_layout_stackOffsetZero(data) { - var j = -1, m = data[0].length, y0 = []; - while (++j < m) y0[j] = 0; - return y0; - } - function d3_layout_stackMaxIndex(array) { - var i = 1, j = 0, v = array[0][1], k, n = array.length; - for (;i < n; ++i) { - if ((k = array[i][1]) > v) { - j = i; - v = k; - } - } - return j; - } - function d3_layout_stackReduceSum(d) { - return d.reduce(d3_layout_stackSum, 0); - } - function d3_layout_stackSum(p, d) { - return p + d[1]; - } - d3.layout.histogram = function() { - var frequency = true, valuer = Number, ranger = d3_layout_histogramRange, binner = d3_layout_histogramBinSturges; - function histogram(data, i) { - var bins = [], values = data.map(valuer, this), range = ranger.call(this, values, i), thresholds = binner.call(this, range, values, i), bin, i = -1, n = values.length, m = thresholds.length - 1, k = frequency ? 1 : 1 / n, x; - while (++i < m) { - bin = bins[i] = []; - bin.dx = thresholds[i + 1] - (bin.x = thresholds[i]); - bin.y = 0; - } - if (m > 0) { - i = -1; - while (++i < n) { - x = values[i]; - if (x >= range[0] && x <= range[1]) { - bin = bins[d3.bisect(thresholds, x, 1, m) - 1]; - bin.y += k; - bin.push(data[i]); - } - } - } - return bins; - } - histogram.value = function(x) { - if (!arguments.length) return valuer; - valuer = x; - return histogram; - }; - histogram.range = function(x) { - if (!arguments.length) return ranger; - ranger = d3_functor(x); - return histogram; - }; - histogram.bins = function(x) { - if (!arguments.length) return binner; - binner = typeof x === "number" ? function(range) { - return d3_layout_histogramBinFixed(range, x); - } : d3_functor(x); - return histogram; - }; - histogram.frequency = function(x) { - if (!arguments.length) return frequency; - frequency = !!x; - return histogram; - }; - return histogram; - }; - function d3_layout_histogramBinSturges(range, values) { - return d3_layout_histogramBinFixed(range, Math.ceil(Math.log(values.length) / Math.LN2 + 1)); - } - function d3_layout_histogramBinFixed(range, n) { - var x = -1, b = +range[0], m = (range[1] - b) / n, f = []; - while (++x <= n) f[x] = m * x + b; - return f; - } - function d3_layout_histogramRange(values) { - return [ d3.min(values), d3.max(values) ]; - } - d3.layout.pack = function() { - var hierarchy = d3.layout.hierarchy().sort(d3_layout_packSort), padding = 0, size = [ 1, 1 ], radius; - function pack(d, i) { - var nodes = hierarchy.call(this, d, i), root = nodes[0], w = size[0], h = size[1], r = radius == null ? Math.sqrt : typeof radius === "function" ? radius : function() { - return radius; - }; - root.x = root.y = 0; - d3_layout_hierarchyVisitAfter(root, function(d) { - d.r = +r(d.value); - }); - d3_layout_hierarchyVisitAfter(root, d3_layout_packSiblings); - if (padding) { - var dr = padding * (radius ? 1 : Math.max(2 * root.r / w, 2 * root.r / h)) / 2; - d3_layout_hierarchyVisitAfter(root, function(d) { - d.r += dr; - }); - d3_layout_hierarchyVisitAfter(root, d3_layout_packSiblings); - d3_layout_hierarchyVisitAfter(root, function(d) { - d.r -= dr; - }); - } - d3_layout_packTransform(root, w / 2, h / 2, radius ? 1 : 1 / Math.max(2 * root.r / w, 2 * root.r / h)); - return nodes; - } - pack.size = function(_) { - if (!arguments.length) return size; - size = _; - return pack; - }; - pack.radius = function(_) { - if (!arguments.length) return radius; - radius = _ == null || typeof _ === "function" ? _ : +_; - return pack; - }; - pack.padding = function(_) { - if (!arguments.length) return padding; - padding = +_; - return pack; - }; - return d3_layout_hierarchyRebind(pack, hierarchy); - }; - function d3_layout_packSort(a, b) { - return a.value - b.value; - } - function d3_layout_packInsert(a, b) { - var c = a._pack_next; - a._pack_next = b; - b._pack_prev = a; - b._pack_next = c; - c._pack_prev = b; - } - function d3_layout_packSplice(a, b) { - a._pack_next = b; - b._pack_prev = a; - } - function d3_layout_packIntersects(a, b) { - var dx = b.x - a.x, dy = b.y - a.y, dr = a.r + b.r; - return .999 * dr * dr > dx * dx + dy * dy; - } - function d3_layout_packSiblings(node) { - if (!(nodes = node.children) || !(n = nodes.length)) return; - var nodes, xMin = Infinity, xMax = -Infinity, yMin = Infinity, yMax = -Infinity, a, b, c, i, j, k, n; - function bound(node) { - xMin = Math.min(node.x - node.r, xMin); - xMax = Math.max(node.x + node.r, xMax); - yMin = Math.min(node.y - node.r, yMin); - yMax = Math.max(node.y + node.r, yMax); - } - nodes.forEach(d3_layout_packLink); - a = nodes[0]; - a.x = -a.r; - a.y = 0; - bound(a); - if (n > 1) { - b = nodes[1]; - b.x = b.r; - b.y = 0; - bound(b); - if (n > 2) { - c = nodes[2]; - d3_layout_packPlace(a, b, c); - bound(c); - d3_layout_packInsert(a, c); - a._pack_prev = c; - d3_layout_packInsert(c, b); - b = a._pack_next; - for (i = 3; i < n; i++) { - d3_layout_packPlace(a, b, c = nodes[i]); - var isect = 0, s1 = 1, s2 = 1; - for (j = b._pack_next; j !== b; j = j._pack_next, s1++) { - if (d3_layout_packIntersects(j, c)) { - isect = 1; - break; - } - } - if (isect == 1) { - for (k = a._pack_prev; k !== j._pack_prev; k = k._pack_prev, s2++) { - if (d3_layout_packIntersects(k, c)) { - break; - } - } - } - if (isect) { - if (s1 < s2 || s1 == s2 && b.r < a.r) d3_layout_packSplice(a, b = j); else d3_layout_packSplice(a = k, b); - i--; - } else { - d3_layout_packInsert(a, c); - b = c; - bound(c); - } - } - } - } - var cx = (xMin + xMax) / 2, cy = (yMin + yMax) / 2, cr = 0; - for (i = 0; i < n; i++) { - c = nodes[i]; - c.x -= cx; - c.y -= cy; - cr = Math.max(cr, c.r + Math.sqrt(c.x * c.x + c.y * c.y)); - } - node.r = cr; - nodes.forEach(d3_layout_packUnlink); - } - function d3_layout_packLink(node) { - node._pack_next = node._pack_prev = node; - } - function d3_layout_packUnlink(node) { - delete node._pack_next; - delete node._pack_prev; - } - function d3_layout_packTransform(node, x, y, k) { - var children = node.children; - node.x = x += k * node.x; - node.y = y += k * node.y; - node.r *= k; - if (children) { - var i = -1, n = children.length; - while (++i < n) d3_layout_packTransform(children[i], x, y, k); - } - } - function d3_layout_packPlace(a, b, c) { - var db = a.r + c.r, dx = b.x - a.x, dy = b.y - a.y; - if (db && (dx || dy)) { - var da = b.r + c.r, dc = dx * dx + dy * dy; - da *= da; - db *= db; - var x = .5 + (db - da) / (2 * dc), y = Math.sqrt(Math.max(0, 2 * da * (db + dc) - (db -= dc) * db - da * da)) / (2 * dc); - c.x = a.x + x * dx + y * dy; - c.y = a.y + x * dy - y * dx; - } else { - c.x = a.x + db; - c.y = a.y; - } - } - d3.layout.tree = function() { - var hierarchy = d3.layout.hierarchy().sort(null).value(null), separation = d3_layout_treeSeparation, size = [ 1, 1 ], nodeSize = null; - function tree(d, i) { - var nodes = hierarchy.call(this, d, i), root0 = nodes[0], root1 = wrapTree(root0); - d3_layout_hierarchyVisitAfter(root1, firstWalk), root1.parent.m = -root1.z; - d3_layout_hierarchyVisitBefore(root1, secondWalk); - if (nodeSize) d3_layout_hierarchyVisitBefore(root0, sizeNode); else { - var left = root0, right = root0, bottom = root0; - d3_layout_hierarchyVisitBefore(root0, function(node) { - if (node.x < left.x) left = node; - if (node.x > right.x) right = node; - if (node.depth > bottom.depth) bottom = node; - }); - var tx = separation(left, right) / 2 - left.x, kx = size[0] / (right.x + separation(right, left) / 2 + tx), ky = size[1] / (bottom.depth || 1); - d3_layout_hierarchyVisitBefore(root0, function(node) { - node.x = (node.x + tx) * kx; - node.y = node.depth * ky; - }); - } - return nodes; - } - function wrapTree(root0) { - var root1 = { - A: null, - children: [ root0 ] - }, queue = [ root1 ], node1; - while ((node1 = queue.pop()) != null) { - for (var children = node1.children, child, i = 0, n = children.length; i < n; ++i) { - queue.push((children[i] = child = { - _: children[i], - parent: node1, - children: (child = children[i].children) && child.slice() || [], - A: null, - a: null, - z: 0, - m: 0, - c: 0, - s: 0, - t: null, - i: i - }).a = child); - } - } - return root1.children[0]; - } - function firstWalk(v) { - var children = v.children, siblings = v.parent.children, w = v.i ? siblings[v.i - 1] : null; - if (children.length) { - d3_layout_treeShift(v); - var midpoint = (children[0].z + children[children.length - 1].z) / 2; - if (w) { - v.z = w.z + separation(v._, w._); - v.m = v.z - midpoint; - } else { - v.z = midpoint; - } - } else if (w) { - v.z = w.z + separation(v._, w._); - } - v.parent.A = apportion(v, w, v.parent.A || siblings[0]); - } - function secondWalk(v) { - v._.x = v.z + v.parent.m; - v.m += v.parent.m; - } - function apportion(v, w, ancestor) { - if (w) { - var vip = v, vop = v, vim = w, vom = vip.parent.children[0], sip = vip.m, sop = vop.m, sim = vim.m, som = vom.m, shift; - while (vim = d3_layout_treeRight(vim), vip = d3_layout_treeLeft(vip), vim && vip) { - vom = d3_layout_treeLeft(vom); - vop = d3_layout_treeRight(vop); - vop.a = v; - shift = vim.z + sim - vip.z - sip + separation(vim._, vip._); - if (shift > 0) { - d3_layout_treeMove(d3_layout_treeAncestor(vim, v, ancestor), v, shift); - sip += shift; - sop += shift; - } - sim += vim.m; - sip += vip.m; - som += vom.m; - sop += vop.m; - } - if (vim && !d3_layout_treeRight(vop)) { - vop.t = vim; - vop.m += sim - sop; - } - if (vip && !d3_layout_treeLeft(vom)) { - vom.t = vip; - vom.m += sip - som; - ancestor = v; - } - } - return ancestor; - } - function sizeNode(node) { - node.x *= size[0]; - node.y = node.depth * size[1]; - } - tree.separation = function(x) { - if (!arguments.length) return separation; - separation = x; - return tree; - }; - tree.size = function(x) { - if (!arguments.length) return nodeSize ? null : size; - nodeSize = (size = x) == null ? sizeNode : null; - return tree; - }; - tree.nodeSize = function(x) { - if (!arguments.length) return nodeSize ? size : null; - nodeSize = (size = x) == null ? null : sizeNode; - return tree; - }; - return d3_layout_hierarchyRebind(tree, hierarchy); - }; - function d3_layout_treeSeparation(a, b) { - return a.parent == b.parent ? 1 : 2; - } - function d3_layout_treeLeft(v) { - var children = v.children; - return children.length ? children[0] : v.t; - } - function d3_layout_treeRight(v) { - var children = v.children, n; - return (n = children.length) ? children[n - 1] : v.t; - } - function d3_layout_treeMove(wm, wp, shift) { - var change = shift / (wp.i - wm.i); - wp.c -= change; - wp.s += shift; - wm.c += change; - wp.z += shift; - wp.m += shift; - } - function d3_layout_treeShift(v) { - var shift = 0, change = 0, children = v.children, i = children.length, w; - while (--i >= 0) { - w = children[i]; - w.z += shift; - w.m += shift; - shift += w.s + (change += w.c); - } - } - function d3_layout_treeAncestor(vim, v, ancestor) { - return vim.a.parent === v.parent ? vim.a : ancestor; - } - d3.layout.cluster = function() { - var hierarchy = d3.layout.hierarchy().sort(null).value(null), separation = d3_layout_treeSeparation, size = [ 1, 1 ], nodeSize = false; - function cluster(d, i) { - var nodes = hierarchy.call(this, d, i), root = nodes[0], previousNode, x = 0; - d3_layout_hierarchyVisitAfter(root, function(node) { - var children = node.children; - if (children && children.length) { - node.x = d3_layout_clusterX(children); - node.y = d3_layout_clusterY(children); - } else { - node.x = previousNode ? x += separation(node, previousNode) : 0; - node.y = 0; - previousNode = node; - } - }); - var left = d3_layout_clusterLeft(root), right = d3_layout_clusterRight(root), x0 = left.x - separation(left, right) / 2, x1 = right.x + separation(right, left) / 2; - d3_layout_hierarchyVisitAfter(root, nodeSize ? function(node) { - node.x = (node.x - root.x) * size[0]; - node.y = (root.y - node.y) * size[1]; - } : function(node) { - node.x = (node.x - x0) / (x1 - x0) * size[0]; - node.y = (1 - (root.y ? node.y / root.y : 1)) * size[1]; - }); - return nodes; - } - cluster.separation = function(x) { - if (!arguments.length) return separation; - separation = x; - return cluster; - }; - cluster.size = function(x) { - if (!arguments.length) return nodeSize ? null : size; - nodeSize = (size = x) == null; - return cluster; - }; - cluster.nodeSize = function(x) { - if (!arguments.length) return nodeSize ? size : null; - nodeSize = (size = x) != null; - return cluster; - }; - return d3_layout_hierarchyRebind(cluster, hierarchy); - }; - function d3_layout_clusterY(children) { - return 1 + d3.max(children, function(child) { - return child.y; - }); - } - function d3_layout_clusterX(children) { - return children.reduce(function(x, child) { - return x + child.x; - }, 0) / children.length; - } - function d3_layout_clusterLeft(node) { - var children = node.children; - return children && children.length ? d3_layout_clusterLeft(children[0]) : node; - } - function d3_layout_clusterRight(node) { - var children = node.children, n; - return children && (n = children.length) ? d3_layout_clusterRight(children[n - 1]) : node; - } - d3.layout.treemap = function() { - var hierarchy = d3.layout.hierarchy(), round = Math.round, size = [ 1, 1 ], padding = null, pad = d3_layout_treemapPadNull, sticky = false, stickies, mode = "squarify", ratio = .5 * (1 + Math.sqrt(5)); - function scale(children, k) { - var i = -1, n = children.length, child, area; - while (++i < n) { - area = (child = children[i]).value * (k < 0 ? 0 : k); - child.area = isNaN(area) || area <= 0 ? 0 : area; - } - } - function squarify(node) { - var children = node.children; - if (children && children.length) { - var rect = pad(node), row = [], remaining = children.slice(), child, best = Infinity, score, u = mode === "slice" ? rect.dx : mode === "dice" ? rect.dy : mode === "slice-dice" ? node.depth & 1 ? rect.dy : rect.dx : Math.min(rect.dx, rect.dy), n; - scale(remaining, rect.dx * rect.dy / node.value); - row.area = 0; - while ((n = remaining.length) > 0) { - row.push(child = remaining[n - 1]); - row.area += child.area; - if (mode !== "squarify" || (score = worst(row, u)) <= best) { - remaining.pop(); - best = score; - } else { - row.area -= row.pop().area; - position(row, u, rect, false); - u = Math.min(rect.dx, rect.dy); - row.length = row.area = 0; - best = Infinity; - } - } - if (row.length) { - position(row, u, rect, true); - row.length = row.area = 0; - } - children.forEach(squarify); - } - } - function stickify(node) { - var children = node.children; - if (children && children.length) { - var rect = pad(node), remaining = children.slice(), child, row = []; - scale(remaining, rect.dx * rect.dy / node.value); - row.area = 0; - while (child = remaining.pop()) { - row.push(child); - row.area += child.area; - if (child.z != null) { - position(row, child.z ? rect.dx : rect.dy, rect, !remaining.length); - row.length = row.area = 0; - } - } - children.forEach(stickify); - } - } - function worst(row, u) { - var s = row.area, r, rmax = 0, rmin = Infinity, i = -1, n = row.length; - while (++i < n) { - if (!(r = row[i].area)) continue; - if (r < rmin) rmin = r; - if (r > rmax) rmax = r; - } - s *= s; - u *= u; - return s ? Math.max(u * rmax * ratio / s, s / (u * rmin * ratio)) : Infinity; - } - function position(row, u, rect, flush) { - var i = -1, n = row.length, x = rect.x, y = rect.y, v = u ? round(row.area / u) : 0, o; - if (u == rect.dx) { - if (flush || v > rect.dy) v = rect.dy; - while (++i < n) { - o = row[i]; - o.x = x; - o.y = y; - o.dy = v; - x += o.dx = Math.min(rect.x + rect.dx - x, v ? round(o.area / v) : 0); - } - o.z = true; - o.dx += rect.x + rect.dx - x; - rect.y += v; - rect.dy -= v; - } else { - if (flush || v > rect.dx) v = rect.dx; - while (++i < n) { - o = row[i]; - o.x = x; - o.y = y; - o.dx = v; - y += o.dy = Math.min(rect.y + rect.dy - y, v ? round(o.area / v) : 0); - } - o.z = false; - o.dy += rect.y + rect.dy - y; - rect.x += v; - rect.dx -= v; - } - } - function treemap(d) { - var nodes = stickies || hierarchy(d), root = nodes[0]; - root.x = 0; - root.y = 0; - root.dx = size[0]; - root.dy = size[1]; - if (stickies) hierarchy.revalue(root); - scale([ root ], root.dx * root.dy / root.value); - (stickies ? stickify : squarify)(root); - if (sticky) stickies = nodes; - return nodes; - } - treemap.size = function(x) { - if (!arguments.length) return size; - size = x; - return treemap; - }; - treemap.padding = function(x) { - if (!arguments.length) return padding; - function padFunction(node) { - var p = x.call(treemap, node, node.depth); - return p == null ? d3_layout_treemapPadNull(node) : d3_layout_treemapPad(node, typeof p === "number" ? [ p, p, p, p ] : p); - } - function padConstant(node) { - return d3_layout_treemapPad(node, x); - } - var type; - pad = (padding = x) == null ? d3_layout_treemapPadNull : (type = typeof x) === "function" ? padFunction : type === "number" ? (x = [ x, x, x, x ], - padConstant) : padConstant; - return treemap; - }; - treemap.round = function(x) { - if (!arguments.length) return round != Number; - round = x ? Math.round : Number; - return treemap; - }; - treemap.sticky = function(x) { - if (!arguments.length) return sticky; - sticky = x; - stickies = null; - return treemap; - }; - treemap.ratio = function(x) { - if (!arguments.length) return ratio; - ratio = x; - return treemap; - }; - treemap.mode = function(x) { - if (!arguments.length) return mode; - mode = x + ""; - return treemap; - }; - return d3_layout_hierarchyRebind(treemap, hierarchy); - }; - function d3_layout_treemapPadNull(node) { - return { - x: node.x, - y: node.y, - dx: node.dx, - dy: node.dy - }; - } - function d3_layout_treemapPad(node, padding) { - var x = node.x + padding[3], y = node.y + padding[0], dx = node.dx - padding[1] - padding[3], dy = node.dy - padding[0] - padding[2]; - if (dx < 0) { - x += dx / 2; - dx = 0; - } - if (dy < 0) { - y += dy / 2; - dy = 0; - } - return { - x: x, - y: y, - dx: dx, - dy: dy - }; - } - d3.random = { - normal: function(µ, σ) { - var n = arguments.length; - if (n < 2) σ = 1; - if (n < 1) µ = 0; - return function() { - var x, y, r; - do { - x = Math.random() * 2 - 1; - y = Math.random() * 2 - 1; - r = x * x + y * y; - } while (!r || r > 1); - return µ + σ * x * Math.sqrt(-2 * Math.log(r) / r); - }; - }, - logNormal: function() { - var random = d3.random.normal.apply(d3, arguments); - return function() { - return Math.exp(random()); - }; - }, - bates: function(m) { - var random = d3.random.irwinHall(m); - return function() { - return random() / m; - }; - }, - irwinHall: function(m) { - return function() { - for (var s = 0, j = 0; j < m; j++) s += Math.random(); - return s; - }; - } - }; - d3.scale = {}; - function d3_scaleExtent(domain) { - var start = domain[0], stop = domain[domain.length - 1]; - return start < stop ? [ start, stop ] : [ stop, start ]; - } - function d3_scaleRange(scale) { - return scale.rangeExtent ? scale.rangeExtent() : d3_scaleExtent(scale.range()); - } - function d3_scale_bilinear(domain, range, uninterpolate, interpolate) { - var u = uninterpolate(domain[0], domain[1]), i = interpolate(range[0], range[1]); - return function(x) { - return i(u(x)); - }; - } - function d3_scale_nice(domain, nice) { - var i0 = 0, i1 = domain.length - 1, x0 = domain[i0], x1 = domain[i1], dx; - if (x1 < x0) { - dx = i0, i0 = i1, i1 = dx; - dx = x0, x0 = x1, x1 = dx; - } - domain[i0] = nice.floor(x0); - domain[i1] = nice.ceil(x1); - return domain; - } - function d3_scale_niceStep(step) { - return step ? { - floor: function(x) { - return Math.floor(x / step) * step; - }, - ceil: function(x) { - return Math.ceil(x / step) * step; - } - } : d3_scale_niceIdentity; - } - var d3_scale_niceIdentity = { - floor: d3_identity, - ceil: d3_identity - }; - function d3_scale_polylinear(domain, range, uninterpolate, interpolate) { - var u = [], i = [], j = 0, k = Math.min(domain.length, range.length) - 1; - if (domain[k] < domain[0]) { - domain = domain.slice().reverse(); - range = range.slice().reverse(); - } - while (++j <= k) { - u.push(uninterpolate(domain[j - 1], domain[j])); - i.push(interpolate(range[j - 1], range[j])); - } - return function(x) { - var j = d3.bisect(domain, x, 1, k) - 1; - return i[j](u[j](x)); - }; - } - d3.scale.linear = function() { - return d3_scale_linear([ 0, 1 ], [ 0, 1 ], d3_interpolate, false); - }; - function d3_scale_linear(domain, range, interpolate, clamp) { - var output, input; - function rescale() { - var linear = Math.min(domain.length, range.length) > 2 ? d3_scale_polylinear : d3_scale_bilinear, uninterpolate = clamp ? d3_uninterpolateClamp : d3_uninterpolateNumber; - output = linear(domain, range, uninterpolate, interpolate); - input = linear(range, domain, uninterpolate, d3_interpolate); - return scale; - } - function scale(x) { - return output(x); - } - scale.invert = function(y) { - return input(y); - }; - scale.domain = function(x) { - if (!arguments.length) return domain; - domain = x.map(Number); - return rescale(); - }; - scale.range = function(x) { - if (!arguments.length) return range; - range = x; - return rescale(); - }; - scale.rangeRound = function(x) { - return scale.range(x).interpolate(d3_interpolateRound); - }; - scale.clamp = function(x) { - if (!arguments.length) return clamp; - clamp = x; - return rescale(); - }; - scale.interpolate = function(x) { - if (!arguments.length) return interpolate; - interpolate = x; - return rescale(); - }; - scale.ticks = function(m) { - return d3_scale_linearTicks(domain, m); - }; - scale.tickFormat = function(m, format) { - return d3_scale_linearTickFormat(domain, m, format); - }; - scale.nice = function(m) { - d3_scale_linearNice(domain, m); - return rescale(); - }; - scale.copy = function() { - return d3_scale_linear(domain, range, interpolate, clamp); - }; - return rescale(); - } - function d3_scale_linearRebind(scale, linear) { - return d3.rebind(scale, linear, "range", "rangeRound", "interpolate", "clamp"); - } - function d3_scale_linearNice(domain, m) { - return d3_scale_nice(domain, d3_scale_niceStep(d3_scale_linearTickRange(domain, m)[2])); - } - function d3_scale_linearTickRange(domain, m) { - if (m == null) m = 10; - var extent = d3_scaleExtent(domain), span = extent[1] - extent[0], step = Math.pow(10, Math.floor(Math.log(span / m) / Math.LN10)), err = m / span * step; - if (err <= .15) step *= 10; else if (err <= .35) step *= 5; else if (err <= .75) step *= 2; - extent[0] = Math.ceil(extent[0] / step) * step; - extent[1] = Math.floor(extent[1] / step) * step + step * .5; - extent[2] = step; - return extent; - } - function d3_scale_linearTicks(domain, m) { - return d3.range.apply(d3, d3_scale_linearTickRange(domain, m)); - } - function d3_scale_linearTickFormat(domain, m, format) { - var range = d3_scale_linearTickRange(domain, m); - if (format) { - var match = d3_format_re.exec(format); - match.shift(); - if (match[8] === "s") { - var prefix = d3.formatPrefix(Math.max(abs(range[0]), abs(range[1]))); - if (!match[7]) match[7] = "." + d3_scale_linearPrecision(prefix.scale(range[2])); - match[8] = "f"; - format = d3.format(match.join("")); - return function(d) { - return format(prefix.scale(d)) + prefix.symbol; - }; - } - if (!match[7]) match[7] = "." + d3_scale_linearFormatPrecision(match[8], range); - format = match.join(""); - } else { - format = ",." + d3_scale_linearPrecision(range[2]) + "f"; - } - return d3.format(format); - } - var d3_scale_linearFormatSignificant = { - s: 1, - g: 1, - p: 1, - r: 1, - e: 1 - }; - function d3_scale_linearPrecision(value) { - return -Math.floor(Math.log(value) / Math.LN10 + .01); - } - function d3_scale_linearFormatPrecision(type, range) { - var p = d3_scale_linearPrecision(range[2]); - return type in d3_scale_linearFormatSignificant ? Math.abs(p - d3_scale_linearPrecision(Math.max(abs(range[0]), abs(range[1])))) + +(type !== "e") : p - (type === "%") * 2; - } - d3.scale.log = function() { - return d3_scale_log(d3.scale.linear().domain([ 0, 1 ]), 10, true, [ 1, 10 ]); - }; - function d3_scale_log(linear, base, positive, domain) { - function log(x) { - return (positive ? Math.log(x < 0 ? 0 : x) : -Math.log(x > 0 ? 0 : -x)) / Math.log(base); - } - function pow(x) { - return positive ? Math.pow(base, x) : -Math.pow(base, -x); - } - function scale(x) { - return linear(log(x)); - } - scale.invert = function(x) { - return pow(linear.invert(x)); - }; - scale.domain = function(x) { - if (!arguments.length) return domain; - positive = x[0] >= 0; - linear.domain((domain = x.map(Number)).map(log)); - return scale; - }; - scale.base = function(_) { - if (!arguments.length) return base; - base = +_; - linear.domain(domain.map(log)); - return scale; - }; - scale.nice = function() { - var niced = d3_scale_nice(domain.map(log), positive ? Math : d3_scale_logNiceNegative); - linear.domain(niced); - domain = niced.map(pow); - return scale; - }; - scale.ticks = function() { - var extent = d3_scaleExtent(domain), ticks = [], u = extent[0], v = extent[1], i = Math.floor(log(u)), j = Math.ceil(log(v)), n = base % 1 ? 2 : base; - if (isFinite(j - i)) { - if (positive) { - for (;i < j; i++) for (var k = 1; k < n; k++) ticks.push(pow(i) * k); - ticks.push(pow(i)); - } else { - ticks.push(pow(i)); - for (;i++ < j; ) for (var k = n - 1; k > 0; k--) ticks.push(pow(i) * k); - } - for (i = 0; ticks[i] < u; i++) {} - for (j = ticks.length; ticks[j - 1] > v; j--) {} - ticks = ticks.slice(i, j); - } - return ticks; - }; - scale.tickFormat = function(n, format) { - if (!arguments.length) return d3_scale_logFormat; - if (arguments.length < 2) format = d3_scale_logFormat; else if (typeof format !== "function") format = d3.format(format); - var k = Math.max(.1, n / scale.ticks().length), f = positive ? (e = 1e-12, Math.ceil) : (e = -1e-12, - Math.floor), e; - return function(d) { - return d / pow(f(log(d) + e)) <= k ? format(d) : ""; - }; - }; - scale.copy = function() { - return d3_scale_log(linear.copy(), base, positive, domain); - }; - return d3_scale_linearRebind(scale, linear); - } - var d3_scale_logFormat = d3.format(".0e"), d3_scale_logNiceNegative = { - floor: function(x) { - return -Math.ceil(-x); - }, - ceil: function(x) { - return -Math.floor(-x); - } - }; - d3.scale.pow = function() { - return d3_scale_pow(d3.scale.linear(), 1, [ 0, 1 ]); - }; - function d3_scale_pow(linear, exponent, domain) { - var powp = d3_scale_powPow(exponent), powb = d3_scale_powPow(1 / exponent); - function scale(x) { - return linear(powp(x)); - } - scale.invert = function(x) { - return powb(linear.invert(x)); - }; - scale.domain = function(x) { - if (!arguments.length) return domain; - linear.domain((domain = x.map(Number)).map(powp)); - return scale; - }; - scale.ticks = function(m) { - return d3_scale_linearTicks(domain, m); - }; - scale.tickFormat = function(m, format) { - return d3_scale_linearTickFormat(domain, m, format); - }; - scale.nice = function(m) { - return scale.domain(d3_scale_linearNice(domain, m)); - }; - scale.exponent = function(x) { - if (!arguments.length) return exponent; - powp = d3_scale_powPow(exponent = x); - powb = d3_scale_powPow(1 / exponent); - linear.domain(domain.map(powp)); - return scale; - }; - scale.copy = function() { - return d3_scale_pow(linear.copy(), exponent, domain); - }; - return d3_scale_linearRebind(scale, linear); - } - function d3_scale_powPow(e) { - return function(x) { - return x < 0 ? -Math.pow(-x, e) : Math.pow(x, e); - }; - } - d3.scale.sqrt = function() { - return d3.scale.pow().exponent(.5); - }; - d3.scale.ordinal = function() { - return d3_scale_ordinal([], { - t: "range", - a: [ [] ] - }); - }; - function d3_scale_ordinal(domain, ranger) { - var index, range, rangeBand; - function scale(x) { - return range[((index.get(x) || (ranger.t === "range" ? index.set(x, domain.push(x)) : NaN)) - 1) % range.length]; - } - function steps(start, step) { - return d3.range(domain.length).map(function(i) { - return start + step * i; - }); - } - scale.domain = function(x) { - if (!arguments.length) return domain; - domain = []; - index = new d3_Map(); - var i = -1, n = x.length, xi; - while (++i < n) if (!index.has(xi = x[i])) index.set(xi, domain.push(xi)); - return scale[ranger.t].apply(scale, ranger.a); - }; - scale.range = function(x) { - if (!arguments.length) return range; - range = x; - rangeBand = 0; - ranger = { - t: "range", - a: arguments - }; - return scale; - }; - scale.rangePoints = function(x, padding) { - if (arguments.length < 2) padding = 0; - var start = x[0], stop = x[1], step = domain.length < 2 ? (start = (start + stop) / 2, - 0) : (stop - start) / (domain.length - 1 + padding); - range = steps(start + step * padding / 2, step); - rangeBand = 0; - ranger = { - t: "rangePoints", - a: arguments - }; - return scale; - }; - scale.rangeRoundPoints = function(x, padding) { - if (arguments.length < 2) padding = 0; - var start = x[0], stop = x[1], step = domain.length < 2 ? (start = stop = Math.round((start + stop) / 2), - 0) : (stop - start) / (domain.length - 1 + padding) | 0; - range = steps(start + Math.round(step * padding / 2 + (stop - start - (domain.length - 1 + padding) * step) / 2), step); - rangeBand = 0; - ranger = { - t: "rangeRoundPoints", - a: arguments - }; - return scale; - }; - scale.rangeBands = function(x, padding, outerPadding) { - if (arguments.length < 2) padding = 0; - if (arguments.length < 3) outerPadding = padding; - var reverse = x[1] < x[0], start = x[reverse - 0], stop = x[1 - reverse], step = (stop - start) / (domain.length - padding + 2 * outerPadding); - range = steps(start + step * outerPadding, step); - if (reverse) range.reverse(); - rangeBand = step * (1 - padding); - ranger = { - t: "rangeBands", - a: arguments - }; - return scale; - }; - scale.rangeRoundBands = function(x, padding, outerPadding) { - if (arguments.length < 2) padding = 0; - if (arguments.length < 3) outerPadding = padding; - var reverse = x[1] < x[0], start = x[reverse - 0], stop = x[1 - reverse], step = Math.floor((stop - start) / (domain.length - padding + 2 * outerPadding)); - range = steps(start + Math.round((stop - start - (domain.length - padding) * step) / 2), step); - if (reverse) range.reverse(); - rangeBand = Math.round(step * (1 - padding)); - ranger = { - t: "rangeRoundBands", - a: arguments - }; - return scale; - }; - scale.rangeBand = function() { - return rangeBand; - }; - scale.rangeExtent = function() { - return d3_scaleExtent(ranger.a[0]); - }; - scale.copy = function() { - return d3_scale_ordinal(domain, ranger); - }; - return scale.domain(domain); - } - d3.scale.category10 = function() { - return d3.scale.ordinal().range(d3_category10); - }; - d3.scale.category20 = function() { - return d3.scale.ordinal().range(d3_category20); - }; - d3.scale.category20b = function() { - return d3.scale.ordinal().range(d3_category20b); - }; - d3.scale.category20c = function() { - return d3.scale.ordinal().range(d3_category20c); - }; - var d3_category10 = [ 2062260, 16744206, 2924588, 14034728, 9725885, 9197131, 14907330, 8355711, 12369186, 1556175 ].map(d3_rgbString); - var d3_category20 = [ 2062260, 11454440, 16744206, 16759672, 2924588, 10018698, 14034728, 16750742, 9725885, 12955861, 9197131, 12885140, 14907330, 16234194, 8355711, 13092807, 12369186, 14408589, 1556175, 10410725 ].map(d3_rgbString); - var d3_category20b = [ 3750777, 5395619, 7040719, 10264286, 6519097, 9216594, 11915115, 13556636, 9202993, 12426809, 15186514, 15190932, 8666169, 11356490, 14049643, 15177372, 8077683, 10834324, 13528509, 14589654 ].map(d3_rgbString); - var d3_category20c = [ 3244733, 7057110, 10406625, 13032431, 15095053, 16616764, 16625259, 16634018, 3253076, 7652470, 10607003, 13101504, 7695281, 10394312, 12369372, 14342891, 6513507, 9868950, 12434877, 14277081 ].map(d3_rgbString); - d3.scale.quantile = function() { - return d3_scale_quantile([], []); - }; - function d3_scale_quantile(domain, range) { - var thresholds; - function rescale() { - var k = 0, q = range.length; - thresholds = []; - while (++k < q) thresholds[k - 1] = d3.quantile(domain, k / q); - return scale; - } - function scale(x) { - if (!isNaN(x = +x)) return range[d3.bisect(thresholds, x)]; - } - scale.domain = function(x) { - if (!arguments.length) return domain; - domain = x.map(d3_number).filter(d3_numeric).sort(d3_ascending); - return rescale(); - }; - scale.range = function(x) { - if (!arguments.length) return range; - range = x; - return rescale(); - }; - scale.quantiles = function() { - return thresholds; - }; - scale.invertExtent = function(y) { - y = range.indexOf(y); - return y < 0 ? [ NaN, NaN ] : [ y > 0 ? thresholds[y - 1] : domain[0], y < thresholds.length ? thresholds[y] : domain[domain.length - 1] ]; - }; - scale.copy = function() { - return d3_scale_quantile(domain, range); - }; - return rescale(); - } - d3.scale.quantize = function() { - return d3_scale_quantize(0, 1, [ 0, 1 ]); - }; - function d3_scale_quantize(x0, x1, range) { - var kx, i; - function scale(x) { - return range[Math.max(0, Math.min(i, Math.floor(kx * (x - x0))))]; - } - function rescale() { - kx = range.length / (x1 - x0); - i = range.length - 1; - return scale; - } - scale.domain = function(x) { - if (!arguments.length) return [ x0, x1 ]; - x0 = +x[0]; - x1 = +x[x.length - 1]; - return rescale(); - }; - scale.range = function(x) { - if (!arguments.length) return range; - range = x; - return rescale(); - }; - scale.invertExtent = function(y) { - y = range.indexOf(y); - y = y < 0 ? NaN : y / kx + x0; - return [ y, y + 1 / kx ]; - }; - scale.copy = function() { - return d3_scale_quantize(x0, x1, range); - }; - return rescale(); - } - d3.scale.threshold = function() { - return d3_scale_threshold([ .5 ], [ 0, 1 ]); - }; - function d3_scale_threshold(domain, range) { - function scale(x) { - if (x <= x) return range[d3.bisect(domain, x)]; - } - scale.domain = function(_) { - if (!arguments.length) return domain; - domain = _; - return scale; - }; - scale.range = function(_) { - if (!arguments.length) return range; - range = _; - return scale; - }; - scale.invertExtent = function(y) { - y = range.indexOf(y); - return [ domain[y - 1], domain[y] ]; - }; - scale.copy = function() { - return d3_scale_threshold(domain, range); - }; - return scale; - } - d3.scale.identity = function() { - return d3_scale_identity([ 0, 1 ]); - }; - function d3_scale_identity(domain) { - function identity(x) { - return +x; - } - identity.invert = identity; - identity.domain = identity.range = function(x) { - if (!arguments.length) return domain; - domain = x.map(identity); - return identity; - }; - identity.ticks = function(m) { - return d3_scale_linearTicks(domain, m); - }; - identity.tickFormat = function(m, format) { - return d3_scale_linearTickFormat(domain, m, format); - }; - identity.copy = function() { - return d3_scale_identity(domain); - }; - return identity; - } - d3.svg = {}; - function d3_zero() { - return 0; - } - d3.svg.arc = function() { - var innerRadius = d3_svg_arcInnerRadius, outerRadius = d3_svg_arcOuterRadius, cornerRadius = d3_zero, padRadius = d3_svg_arcAuto, startAngle = d3_svg_arcStartAngle, endAngle = d3_svg_arcEndAngle, padAngle = d3_svg_arcPadAngle; - function arc() { - var r0 = Math.max(0, +innerRadius.apply(this, arguments)), r1 = Math.max(0, +outerRadius.apply(this, arguments)), a0 = startAngle.apply(this, arguments) - halfπ, a1 = endAngle.apply(this, arguments) - halfπ, da = Math.abs(a1 - a0), cw = a0 > a1 ? 0 : 1; - if (r1 < r0) rc = r1, r1 = r0, r0 = rc; - if (da >= τε) return circleSegment(r1, cw) + (r0 ? circleSegment(r0, 1 - cw) : "") + "Z"; - var rc, cr, rp, ap, p0 = 0, p1 = 0, x0, y0, x1, y1, x2, y2, x3, y3, path = []; - if (ap = (+padAngle.apply(this, arguments) || 0) / 2) { - rp = padRadius === d3_svg_arcAuto ? Math.sqrt(r0 * r0 + r1 * r1) : +padRadius.apply(this, arguments); - if (!cw) p1 *= -1; - if (r1) p1 = d3_asin(rp / r1 * Math.sin(ap)); - if (r0) p0 = d3_asin(rp / r0 * Math.sin(ap)); - } - if (r1) { - x0 = r1 * Math.cos(a0 + p1); - y0 = r1 * Math.sin(a0 + p1); - x1 = r1 * Math.cos(a1 - p1); - y1 = r1 * Math.sin(a1 - p1); - var l1 = Math.abs(a1 - a0 - 2 * p1) <= π ? 0 : 1; - if (p1 && d3_svg_arcSweep(x0, y0, x1, y1) === cw ^ l1) { - var h1 = (a0 + a1) / 2; - x0 = r1 * Math.cos(h1); - y0 = r1 * Math.sin(h1); - x1 = y1 = null; - } - } else { - x0 = y0 = 0; - } - if (r0) { - x2 = r0 * Math.cos(a1 - p0); - y2 = r0 * Math.sin(a1 - p0); - x3 = r0 * Math.cos(a0 + p0); - y3 = r0 * Math.sin(a0 + p0); - var l0 = Math.abs(a0 - a1 + 2 * p0) <= π ? 0 : 1; - if (p0 && d3_svg_arcSweep(x2, y2, x3, y3) === 1 - cw ^ l0) { - var h0 = (a0 + a1) / 2; - x2 = r0 * Math.cos(h0); - y2 = r0 * Math.sin(h0); - x3 = y3 = null; - } - } else { - x2 = y2 = 0; - } - if ((rc = Math.min(Math.abs(r1 - r0) / 2, +cornerRadius.apply(this, arguments))) > .001) { - cr = r0 < r1 ^ cw ? 0 : 1; - var oc = x3 == null ? [ x2, y2 ] : x1 == null ? [ x0, y0 ] : d3_geom_polygonIntersect([ x0, y0 ], [ x3, y3 ], [ x1, y1 ], [ x2, y2 ]), ax = x0 - oc[0], ay = y0 - oc[1], bx = x1 - oc[0], by = y1 - oc[1], kc = 1 / Math.sin(Math.acos((ax * bx + ay * by) / (Math.sqrt(ax * ax + ay * ay) * Math.sqrt(bx * bx + by * by))) / 2), lc = Math.sqrt(oc[0] * oc[0] + oc[1] * oc[1]); - if (x1 != null) { - var rc1 = Math.min(rc, (r1 - lc) / (kc + 1)), t30 = d3_svg_arcCornerTangents(x3 == null ? [ x2, y2 ] : [ x3, y3 ], [ x0, y0 ], r1, rc1, cw), t12 = d3_svg_arcCornerTangents([ x1, y1 ], [ x2, y2 ], r1, rc1, cw); - if (rc === rc1) { - path.push("M", t30[0], "A", rc1, ",", rc1, " 0 0,", cr, " ", t30[1], "A", r1, ",", r1, " 0 ", 1 - cw ^ d3_svg_arcSweep(t30[1][0], t30[1][1], t12[1][0], t12[1][1]), ",", cw, " ", t12[1], "A", rc1, ",", rc1, " 0 0,", cr, " ", t12[0]); - } else { - path.push("M", t30[0], "A", rc1, ",", rc1, " 0 1,", cr, " ", t12[0]); - } - } else { - path.push("M", x0, ",", y0); - } - if (x3 != null) { - var rc0 = Math.min(rc, (r0 - lc) / (kc - 1)), t03 = d3_svg_arcCornerTangents([ x0, y0 ], [ x3, y3 ], r0, -rc0, cw), t21 = d3_svg_arcCornerTangents([ x2, y2 ], x1 == null ? [ x0, y0 ] : [ x1, y1 ], r0, -rc0, cw); - if (rc === rc0) { - path.push("L", t21[0], "A", rc0, ",", rc0, " 0 0,", cr, " ", t21[1], "A", r0, ",", r0, " 0 ", cw ^ d3_svg_arcSweep(t21[1][0], t21[1][1], t03[1][0], t03[1][1]), ",", 1 - cw, " ", t03[1], "A", rc0, ",", rc0, " 0 0,", cr, " ", t03[0]); - } else { - path.push("L", t21[0], "A", rc0, ",", rc0, " 0 0,", cr, " ", t03[0]); - } - } else { - path.push("L", x2, ",", y2); - } - } else { - path.push("M", x0, ",", y0); - if (x1 != null) path.push("A", r1, ",", r1, " 0 ", l1, ",", cw, " ", x1, ",", y1); - path.push("L", x2, ",", y2); - if (x3 != null) path.push("A", r0, ",", r0, " 0 ", l0, ",", 1 - cw, " ", x3, ",", y3); - } - path.push("Z"); - return path.join(""); - } - function circleSegment(r1, cw) { - return "M0," + r1 + "A" + r1 + "," + r1 + " 0 1," + cw + " 0," + -r1 + "A" + r1 + "," + r1 + " 0 1," + cw + " 0," + r1; - } - arc.innerRadius = function(v) { - if (!arguments.length) return innerRadius; - innerRadius = d3_functor(v); - return arc; - }; - arc.outerRadius = function(v) { - if (!arguments.length) return outerRadius; - outerRadius = d3_functor(v); - return arc; - }; - arc.cornerRadius = function(v) { - if (!arguments.length) return cornerRadius; - cornerRadius = d3_functor(v); - return arc; - }; - arc.padRadius = function(v) { - if (!arguments.length) return padRadius; - padRadius = v == d3_svg_arcAuto ? d3_svg_arcAuto : d3_functor(v); - return arc; - }; - arc.startAngle = function(v) { - if (!arguments.length) return startAngle; - startAngle = d3_functor(v); - return arc; - }; - arc.endAngle = function(v) { - if (!arguments.length) return endAngle; - endAngle = d3_functor(v); - return arc; - }; - arc.padAngle = function(v) { - if (!arguments.length) return padAngle; - padAngle = d3_functor(v); - return arc; - }; - arc.centroid = function() { - var r = (+innerRadius.apply(this, arguments) + +outerRadius.apply(this, arguments)) / 2, a = (+startAngle.apply(this, arguments) + +endAngle.apply(this, arguments)) / 2 - halfπ; - return [ Math.cos(a) * r, Math.sin(a) * r ]; - }; - return arc; - }; - var d3_svg_arcAuto = "auto"; - function d3_svg_arcInnerRadius(d) { - return d.innerRadius; - } - function d3_svg_arcOuterRadius(d) { - return d.outerRadius; - } - function d3_svg_arcStartAngle(d) { - return d.startAngle; - } - function d3_svg_arcEndAngle(d) { - return d.endAngle; - } - function d3_svg_arcPadAngle(d) { - return d && d.padAngle; - } - function d3_svg_arcSweep(x0, y0, x1, y1) { - return (x0 - x1) * y0 - (y0 - y1) * x0 > 0 ? 0 : 1; - } - function d3_svg_arcCornerTangents(p0, p1, r1, rc, cw) { - var x01 = p0[0] - p1[0], y01 = p0[1] - p1[1], lo = (cw ? rc : -rc) / Math.sqrt(x01 * x01 + y01 * y01), ox = lo * y01, oy = -lo * x01, x1 = p0[0] + ox, y1 = p0[1] + oy, x2 = p1[0] + ox, y2 = p1[1] + oy, x3 = (x1 + x2) / 2, y3 = (y1 + y2) / 2, dx = x2 - x1, dy = y2 - y1, d2 = dx * dx + dy * dy, r = r1 - rc, D = x1 * y2 - x2 * y1, d = (dy < 0 ? -1 : 1) * Math.sqrt(r * r * d2 - D * D), cx0 = (D * dy - dx * d) / d2, cy0 = (-D * dx - dy * d) / d2, cx1 = (D * dy + dx * d) / d2, cy1 = (-D * dx + dy * d) / d2, dx0 = cx0 - x3, dy0 = cy0 - y3, dx1 = cx1 - x3, dy1 = cy1 - y3; - if (dx0 * dx0 + dy0 * dy0 > dx1 * dx1 + dy1 * dy1) cx0 = cx1, cy0 = cy1; - return [ [ cx0 - ox, cy0 - oy ], [ cx0 * r1 / r, cy0 * r1 / r ] ]; - } - function d3_svg_line(projection) { - var x = d3_geom_pointX, y = d3_geom_pointY, defined = d3_true, interpolate = d3_svg_lineLinear, interpolateKey = interpolate.key, tension = .7; - function line(data) { - var segments = [], points = [], i = -1, n = data.length, d, fx = d3_functor(x), fy = d3_functor(y); - function segment() { - segments.push("M", interpolate(projection(points), tension)); - } - while (++i < n) { - if (defined.call(this, d = data[i], i)) { - points.push([ +fx.call(this, d, i), +fy.call(this, d, i) ]); - } else if (points.length) { - segment(); - points = []; - } - } - if (points.length) segment(); - return segments.length ? segments.join("") : null; - } - line.x = function(_) { - if (!arguments.length) return x; - x = _; - return line; - }; - line.y = function(_) { - if (!arguments.length) return y; - y = _; - return line; - }; - line.defined = function(_) { - if (!arguments.length) return defined; - defined = _; - return line; - }; - line.interpolate = function(_) { - if (!arguments.length) return interpolateKey; - if (typeof _ === "function") interpolateKey = interpolate = _; else interpolateKey = (interpolate = d3_svg_lineInterpolators.get(_) || d3_svg_lineLinear).key; - return line; - }; - line.tension = function(_) { - if (!arguments.length) return tension; - tension = _; - return line; - }; - return line; - } - d3.svg.line = function() { - return d3_svg_line(d3_identity); - }; - var d3_svg_lineInterpolators = d3.map({ - linear: d3_svg_lineLinear, - "linear-closed": d3_svg_lineLinearClosed, - step: d3_svg_lineStep, - "step-before": d3_svg_lineStepBefore, - "step-after": d3_svg_lineStepAfter, - basis: d3_svg_lineBasis, - "basis-open": d3_svg_lineBasisOpen, - "basis-closed": d3_svg_lineBasisClosed, - bundle: d3_svg_lineBundle, - cardinal: d3_svg_lineCardinal, - "cardinal-open": d3_svg_lineCardinalOpen, - "cardinal-closed": d3_svg_lineCardinalClosed, - monotone: d3_svg_lineMonotone - }); - d3_svg_lineInterpolators.forEach(function(key, value) { - value.key = key; - value.closed = /-closed$/.test(key); - }); - function d3_svg_lineLinear(points) { - return points.join("L"); - } - function d3_svg_lineLinearClosed(points) { - return d3_svg_lineLinear(points) + "Z"; - } - function d3_svg_lineStep(points) { - var i = 0, n = points.length, p = points[0], path = [ p[0], ",", p[1] ]; - while (++i < n) path.push("H", (p[0] + (p = points[i])[0]) / 2, "V", p[1]); - if (n > 1) path.push("H", p[0]); - return path.join(""); - } - function d3_svg_lineStepBefore(points) { - var i = 0, n = points.length, p = points[0], path = [ p[0], ",", p[1] ]; - while (++i < n) path.push("V", (p = points[i])[1], "H", p[0]); - return path.join(""); - } - function d3_svg_lineStepAfter(points) { - var i = 0, n = points.length, p = points[0], path = [ p[0], ",", p[1] ]; - while (++i < n) path.push("H", (p = points[i])[0], "V", p[1]); - return path.join(""); - } - function d3_svg_lineCardinalOpen(points, tension) { - return points.length < 4 ? d3_svg_lineLinear(points) : points[1] + d3_svg_lineHermite(points.slice(1, -1), d3_svg_lineCardinalTangents(points, tension)); - } - function d3_svg_lineCardinalClosed(points, tension) { - return points.length < 3 ? d3_svg_lineLinear(points) : points[0] + d3_svg_lineHermite((points.push(points[0]), - points), d3_svg_lineCardinalTangents([ points[points.length - 2] ].concat(points, [ points[1] ]), tension)); - } - function d3_svg_lineCardinal(points, tension) { - return points.length < 3 ? d3_svg_lineLinear(points) : points[0] + d3_svg_lineHermite(points, d3_svg_lineCardinalTangents(points, tension)); - } - function d3_svg_lineHermite(points, tangents) { - if (tangents.length < 1 || points.length != tangents.length && points.length != tangents.length + 2) { - return d3_svg_lineLinear(points); - } - var quad = points.length != tangents.length, path = "", p0 = points[0], p = points[1], t0 = tangents[0], t = t0, pi = 1; - if (quad) { - path += "Q" + (p[0] - t0[0] * 2 / 3) + "," + (p[1] - t0[1] * 2 / 3) + "," + p[0] + "," + p[1]; - p0 = points[1]; - pi = 2; - } - if (tangents.length > 1) { - t = tangents[1]; - p = points[pi]; - pi++; - path += "C" + (p0[0] + t0[0]) + "," + (p0[1] + t0[1]) + "," + (p[0] - t[0]) + "," + (p[1] - t[1]) + "," + p[0] + "," + p[1]; - for (var i = 2; i < tangents.length; i++, pi++) { - p = points[pi]; - t = tangents[i]; - path += "S" + (p[0] - t[0]) + "," + (p[1] - t[1]) + "," + p[0] + "," + p[1]; - } - } - if (quad) { - var lp = points[pi]; - path += "Q" + (p[0] + t[0] * 2 / 3) + "," + (p[1] + t[1] * 2 / 3) + "," + lp[0] + "," + lp[1]; - } - return path; - } - function d3_svg_lineCardinalTangents(points, tension) { - var tangents = [], a = (1 - tension) / 2, p0, p1 = points[0], p2 = points[1], i = 1, n = points.length; - while (++i < n) { - p0 = p1; - p1 = p2; - p2 = points[i]; - tangents.push([ a * (p2[0] - p0[0]), a * (p2[1] - p0[1]) ]); - } - return tangents; - } - function d3_svg_lineBasis(points) { - if (points.length < 3) return d3_svg_lineLinear(points); - var i = 1, n = points.length, pi = points[0], x0 = pi[0], y0 = pi[1], px = [ x0, x0, x0, (pi = points[1])[0] ], py = [ y0, y0, y0, pi[1] ], path = [ x0, ",", y0, "L", d3_svg_lineDot4(d3_svg_lineBasisBezier3, px), ",", d3_svg_lineDot4(d3_svg_lineBasisBezier3, py) ]; - points.push(points[n - 1]); - while (++i <= n) { - pi = points[i]; - px.shift(); - px.push(pi[0]); - py.shift(); - py.push(pi[1]); - d3_svg_lineBasisBezier(path, px, py); - } - points.pop(); - path.push("L", pi); - return path.join(""); - } - function d3_svg_lineBasisOpen(points) { - if (points.length < 4) return d3_svg_lineLinear(points); - var path = [], i = -1, n = points.length, pi, px = [ 0 ], py = [ 0 ]; - while (++i < 3) { - pi = points[i]; - px.push(pi[0]); - py.push(pi[1]); - } - path.push(d3_svg_lineDot4(d3_svg_lineBasisBezier3, px) + "," + d3_svg_lineDot4(d3_svg_lineBasisBezier3, py)); - --i; - while (++i < n) { - pi = points[i]; - px.shift(); - px.push(pi[0]); - py.shift(); - py.push(pi[1]); - d3_svg_lineBasisBezier(path, px, py); - } - return path.join(""); - } - function d3_svg_lineBasisClosed(points) { - var path, i = -1, n = points.length, m = n + 4, pi, px = [], py = []; - while (++i < 4) { - pi = points[i % n]; - px.push(pi[0]); - py.push(pi[1]); - } - path = [ d3_svg_lineDot4(d3_svg_lineBasisBezier3, px), ",", d3_svg_lineDot4(d3_svg_lineBasisBezier3, py) ]; - --i; - while (++i < m) { - pi = points[i % n]; - px.shift(); - px.push(pi[0]); - py.shift(); - py.push(pi[1]); - d3_svg_lineBasisBezier(path, px, py); - } - return path.join(""); - } - function d3_svg_lineBundle(points, tension) { - var n = points.length - 1; - if (n) { - var x0 = points[0][0], y0 = points[0][1], dx = points[n][0] - x0, dy = points[n][1] - y0, i = -1, p, t; - while (++i <= n) { - p = points[i]; - t = i / n; - p[0] = tension * p[0] + (1 - tension) * (x0 + t * dx); - p[1] = tension * p[1] + (1 - tension) * (y0 + t * dy); - } - } - return d3_svg_lineBasis(points); - } - function d3_svg_lineDot4(a, b) { - return a[0] * b[0] + a[1] * b[1] + a[2] * b[2] + a[3] * b[3]; - } - var d3_svg_lineBasisBezier1 = [ 0, 2 / 3, 1 / 3, 0 ], d3_svg_lineBasisBezier2 = [ 0, 1 / 3, 2 / 3, 0 ], d3_svg_lineBasisBezier3 = [ 0, 1 / 6, 2 / 3, 1 / 6 ]; - function d3_svg_lineBasisBezier(path, x, y) { - path.push("C", d3_svg_lineDot4(d3_svg_lineBasisBezier1, x), ",", d3_svg_lineDot4(d3_svg_lineBasisBezier1, y), ",", d3_svg_lineDot4(d3_svg_lineBasisBezier2, x), ",", d3_svg_lineDot4(d3_svg_lineBasisBezier2, y), ",", d3_svg_lineDot4(d3_svg_lineBasisBezier3, x), ",", d3_svg_lineDot4(d3_svg_lineBasisBezier3, y)); - } - function d3_svg_lineSlope(p0, p1) { - return (p1[1] - p0[1]) / (p1[0] - p0[0]); - } - function d3_svg_lineFiniteDifferences(points) { - var i = 0, j = points.length - 1, m = [], p0 = points[0], p1 = points[1], d = m[0] = d3_svg_lineSlope(p0, p1); - while (++i < j) { - m[i] = (d + (d = d3_svg_lineSlope(p0 = p1, p1 = points[i + 1]))) / 2; - } - m[i] = d; - return m; - } - function d3_svg_lineMonotoneTangents(points) { - var tangents = [], d, a, b, s, m = d3_svg_lineFiniteDifferences(points), i = -1, j = points.length - 1; - while (++i < j) { - d = d3_svg_lineSlope(points[i], points[i + 1]); - if (abs(d) < ε) { - m[i] = m[i + 1] = 0; - } else { - a = m[i] / d; - b = m[i + 1] / d; - s = a * a + b * b; - if (s > 9) { - s = d * 3 / Math.sqrt(s); - m[i] = s * a; - m[i + 1] = s * b; - } - } - } - i = -1; - while (++i <= j) { - s = (points[Math.min(j, i + 1)][0] - points[Math.max(0, i - 1)][0]) / (6 * (1 + m[i] * m[i])); - tangents.push([ s || 0, m[i] * s || 0 ]); - } - return tangents; - } - function d3_svg_lineMonotone(points) { - return points.length < 3 ? d3_svg_lineLinear(points) : points[0] + d3_svg_lineHermite(points, d3_svg_lineMonotoneTangents(points)); - } - d3.svg.line.radial = function() { - var line = d3_svg_line(d3_svg_lineRadial); - line.radius = line.x, delete line.x; - line.angle = line.y, delete line.y; - return line; - }; - function d3_svg_lineRadial(points) { - var point, i = -1, n = points.length, r, a; - while (++i < n) { - point = points[i]; - r = point[0]; - a = point[1] - halfπ; - point[0] = r * Math.cos(a); - point[1] = r * Math.sin(a); - } - return points; - } - function d3_svg_area(projection) { - var x0 = d3_geom_pointX, x1 = d3_geom_pointX, y0 = 0, y1 = d3_geom_pointY, defined = d3_true, interpolate = d3_svg_lineLinear, interpolateKey = interpolate.key, interpolateReverse = interpolate, L = "L", tension = .7; - function area(data) { - var segments = [], points0 = [], points1 = [], i = -1, n = data.length, d, fx0 = d3_functor(x0), fy0 = d3_functor(y0), fx1 = x0 === x1 ? function() { - return x; - } : d3_functor(x1), fy1 = y0 === y1 ? function() { - return y; - } : d3_functor(y1), x, y; - function segment() { - segments.push("M", interpolate(projection(points1), tension), L, interpolateReverse(projection(points0.reverse()), tension), "Z"); - } - while (++i < n) { - if (defined.call(this, d = data[i], i)) { - points0.push([ x = +fx0.call(this, d, i), y = +fy0.call(this, d, i) ]); - points1.push([ +fx1.call(this, d, i), +fy1.call(this, d, i) ]); - } else if (points0.length) { - segment(); - points0 = []; - points1 = []; - } - } - if (points0.length) segment(); - return segments.length ? segments.join("") : null; - } - area.x = function(_) { - if (!arguments.length) return x1; - x0 = x1 = _; - return area; - }; - area.x0 = function(_) { - if (!arguments.length) return x0; - x0 = _; - return area; - }; - area.x1 = function(_) { - if (!arguments.length) return x1; - x1 = _; - return area; - }; - area.y = function(_) { - if (!arguments.length) return y1; - y0 = y1 = _; - return area; - }; - area.y0 = function(_) { - if (!arguments.length) return y0; - y0 = _; - return area; - }; - area.y1 = function(_) { - if (!arguments.length) return y1; - y1 = _; - return area; - }; - area.defined = function(_) { - if (!arguments.length) return defined; - defined = _; - return area; - }; - area.interpolate = function(_) { - if (!arguments.length) return interpolateKey; - if (typeof _ === "function") interpolateKey = interpolate = _; else interpolateKey = (interpolate = d3_svg_lineInterpolators.get(_) || d3_svg_lineLinear).key; - interpolateReverse = interpolate.reverse || interpolate; - L = interpolate.closed ? "M" : "L"; - return area; - }; - area.tension = function(_) { - if (!arguments.length) return tension; - tension = _; - return area; - }; - return area; - } - d3_svg_lineStepBefore.reverse = d3_svg_lineStepAfter; - d3_svg_lineStepAfter.reverse = d3_svg_lineStepBefore; - d3.svg.area = function() { - return d3_svg_area(d3_identity); - }; - d3.svg.area.radial = function() { - var area = d3_svg_area(d3_svg_lineRadial); - area.radius = area.x, delete area.x; - area.innerRadius = area.x0, delete area.x0; - area.outerRadius = area.x1, delete area.x1; - area.angle = area.y, delete area.y; - area.startAngle = area.y0, delete area.y0; - area.endAngle = area.y1, delete area.y1; - return area; - }; - d3.svg.chord = function() { - var source = d3_source, target = d3_target, radius = d3_svg_chordRadius, startAngle = d3_svg_arcStartAngle, endAngle = d3_svg_arcEndAngle; - function chord(d, i) { - var s = subgroup(this, source, d, i), t = subgroup(this, target, d, i); - return "M" + s.p0 + arc(s.r, s.p1, s.a1 - s.a0) + (equals(s, t) ? curve(s.r, s.p1, s.r, s.p0) : curve(s.r, s.p1, t.r, t.p0) + arc(t.r, t.p1, t.a1 - t.a0) + curve(t.r, t.p1, s.r, s.p0)) + "Z"; - } - function subgroup(self, f, d, i) { - var subgroup = f.call(self, d, i), r = radius.call(self, subgroup, i), a0 = startAngle.call(self, subgroup, i) - halfπ, a1 = endAngle.call(self, subgroup, i) - halfπ; - return { - r: r, - a0: a0, - a1: a1, - p0: [ r * Math.cos(a0), r * Math.sin(a0) ], - p1: [ r * Math.cos(a1), r * Math.sin(a1) ] - }; - } - function equals(a, b) { - return a.a0 == b.a0 && a.a1 == b.a1; - } - function arc(r, p, a) { - return "A" + r + "," + r + " 0 " + +(a > π) + ",1 " + p; - } - function curve(r0, p0, r1, p1) { - return "Q 0,0 " + p1; - } - chord.radius = function(v) { - if (!arguments.length) return radius; - radius = d3_functor(v); - return chord; - }; - chord.source = function(v) { - if (!arguments.length) return source; - source = d3_functor(v); - return chord; - }; - chord.target = function(v) { - if (!arguments.length) return target; - target = d3_functor(v); - return chord; - }; - chord.startAngle = function(v) { - if (!arguments.length) return startAngle; - startAngle = d3_functor(v); - return chord; - }; - chord.endAngle = function(v) { - if (!arguments.length) return endAngle; - endAngle = d3_functor(v); - return chord; - }; - return chord; - }; - function d3_svg_chordRadius(d) { - return d.radius; - } - d3.svg.diagonal = function() { - var source = d3_source, target = d3_target, projection = d3_svg_diagonalProjection; - function diagonal(d, i) { - var p0 = source.call(this, d, i), p3 = target.call(this, d, i), m = (p0.y + p3.y) / 2, p = [ p0, { - x: p0.x, - y: m - }, { - x: p3.x, - y: m - }, p3 ]; - p = p.map(projection); - return "M" + p[0] + "C" + p[1] + " " + p[2] + " " + p[3]; - } - diagonal.source = function(x) { - if (!arguments.length) return source; - source = d3_functor(x); - return diagonal; - }; - diagonal.target = function(x) { - if (!arguments.length) return target; - target = d3_functor(x); - return diagonal; - }; - diagonal.projection = function(x) { - if (!arguments.length) return projection; - projection = x; - return diagonal; - }; - return diagonal; - }; - function d3_svg_diagonalProjection(d) { - return [ d.x, d.y ]; - } - d3.svg.diagonal.radial = function() { - var diagonal = d3.svg.diagonal(), projection = d3_svg_diagonalProjection, projection_ = diagonal.projection; - diagonal.projection = function(x) { - return arguments.length ? projection_(d3_svg_diagonalRadialProjection(projection = x)) : projection; - }; - return diagonal; - }; - function d3_svg_diagonalRadialProjection(projection) { - return function() { - var d = projection.apply(this, arguments), r = d[0], a = d[1] - halfπ; - return [ r * Math.cos(a), r * Math.sin(a) ]; - }; - } - d3.svg.symbol = function() { - var type = d3_svg_symbolType, size = d3_svg_symbolSize; - function symbol(d, i) { - return (d3_svg_symbols.get(type.call(this, d, i)) || d3_svg_symbolCircle)(size.call(this, d, i)); - } - symbol.type = function(x) { - if (!arguments.length) return type; - type = d3_functor(x); - return symbol; - }; - symbol.size = function(x) { - if (!arguments.length) return size; - size = d3_functor(x); - return symbol; - }; - return symbol; - }; - function d3_svg_symbolSize() { - return 64; - } - function d3_svg_symbolType() { - return "circle"; - } - function d3_svg_symbolCircle(size) { - var r = Math.sqrt(size / π); - return "M0," + r + "A" + r + "," + r + " 0 1,1 0," + -r + "A" + r + "," + r + " 0 1,1 0," + r + "Z"; - } - var d3_svg_symbols = d3.map({ - circle: d3_svg_symbolCircle, - cross: function(size) { - var r = Math.sqrt(size / 5) / 2; - return "M" + -3 * r + "," + -r + "H" + -r + "V" + -3 * r + "H" + r + "V" + -r + "H" + 3 * r + "V" + r + "H" + r + "V" + 3 * r + "H" + -r + "V" + r + "H" + -3 * r + "Z"; - }, - diamond: function(size) { - var ry = Math.sqrt(size / (2 * d3_svg_symbolTan30)), rx = ry * d3_svg_symbolTan30; - return "M0," + -ry + "L" + rx + ",0" + " 0," + ry + " " + -rx + ",0" + "Z"; - }, - square: function(size) { - var r = Math.sqrt(size) / 2; - return "M" + -r + "," + -r + "L" + r + "," + -r + " " + r + "," + r + " " + -r + "," + r + "Z"; - }, - "triangle-down": function(size) { - var rx = Math.sqrt(size / d3_svg_symbolSqrt3), ry = rx * d3_svg_symbolSqrt3 / 2; - return "M0," + ry + "L" + rx + "," + -ry + " " + -rx + "," + -ry + "Z"; - }, - "triangle-up": function(size) { - var rx = Math.sqrt(size / d3_svg_symbolSqrt3), ry = rx * d3_svg_symbolSqrt3 / 2; - return "M0," + -ry + "L" + rx + "," + ry + " " + -rx + "," + ry + "Z"; - } - }); - d3.svg.symbolTypes = d3_svg_symbols.keys(); - var d3_svg_symbolSqrt3 = Math.sqrt(3), d3_svg_symbolTan30 = Math.tan(30 * d3_radians); - d3_selectionPrototype.transition = function(name) { - var id = d3_transitionInheritId || ++d3_transitionId, ns = d3_transitionNamespace(name), subgroups = [], subgroup, node, transition = d3_transitionInherit || { - time: Date.now(), - ease: d3_ease_cubicInOut, - delay: 0, - duration: 250 - }; - for (var j = -1, m = this.length; ++j < m; ) { - subgroups.push(subgroup = []); - for (var group = this[j], i = -1, n = group.length; ++i < n; ) { - if (node = group[i]) d3_transitionNode(node, i, ns, id, transition); - subgroup.push(node); - } - } - return d3_transition(subgroups, ns, id); - }; - d3_selectionPrototype.interrupt = function(name) { - return this.each(name == null ? d3_selection_interrupt : d3_selection_interruptNS(d3_transitionNamespace(name))); - }; - var d3_selection_interrupt = d3_selection_interruptNS(d3_transitionNamespace()); - function d3_selection_interruptNS(ns) { - return function() { - var lock, active; - if ((lock = this[ns]) && (active = lock[lock.active])) { - if (--lock.count) delete lock[lock.active]; else delete this[ns]; - lock.active += .5; - active.event && active.event.interrupt.call(this, this.__data__, active.index); - } - }; - } - function d3_transition(groups, ns, id) { - d3_subclass(groups, d3_transitionPrototype); - groups.namespace = ns; - groups.id = id; - return groups; - } - var d3_transitionPrototype = [], d3_transitionId = 0, d3_transitionInheritId, d3_transitionInherit; - d3_transitionPrototype.call = d3_selectionPrototype.call; - d3_transitionPrototype.empty = d3_selectionPrototype.empty; - d3_transitionPrototype.node = d3_selectionPrototype.node; - d3_transitionPrototype.size = d3_selectionPrototype.size; - d3.transition = function(selection, name) { - return selection && selection.transition ? d3_transitionInheritId ? selection.transition(name) : selection : d3.selection().transition(selection); - }; - d3.transition.prototype = d3_transitionPrototype; - d3_transitionPrototype.select = function(selector) { - var id = this.id, ns = this.namespace, subgroups = [], subgroup, subnode, node; - selector = d3_selection_selector(selector); - for (var j = -1, m = this.length; ++j < m; ) { - subgroups.push(subgroup = []); - for (var group = this[j], i = -1, n = group.length; ++i < n; ) { - if ((node = group[i]) && (subnode = selector.call(node, node.__data__, i, j))) { - if ("__data__" in node) subnode.__data__ = node.__data__; - d3_transitionNode(subnode, i, ns, id, node[ns][id]); - subgroup.push(subnode); - } else { - subgroup.push(null); - } - } - } - return d3_transition(subgroups, ns, id); - }; - d3_transitionPrototype.selectAll = function(selector) { - var id = this.id, ns = this.namespace, subgroups = [], subgroup, subnodes, node, subnode, transition; - selector = d3_selection_selectorAll(selector); - for (var j = -1, m = this.length; ++j < m; ) { - for (var group = this[j], i = -1, n = group.length; ++i < n; ) { - if (node = group[i]) { - transition = node[ns][id]; - subnodes = selector.call(node, node.__data__, i, j); - subgroups.push(subgroup = []); - for (var k = -1, o = subnodes.length; ++k < o; ) { - if (subnode = subnodes[k]) d3_transitionNode(subnode, k, ns, id, transition); - subgroup.push(subnode); - } - } - } - } - return d3_transition(subgroups, ns, id); - }; - d3_transitionPrototype.filter = function(filter) { - var subgroups = [], subgroup, group, node; - if (typeof filter !== "function") filter = d3_selection_filter(filter); - for (var j = 0, m = this.length; j < m; j++) { - subgroups.push(subgroup = []); - for (var group = this[j], i = 0, n = group.length; i < n; i++) { - if ((node = group[i]) && filter.call(node, node.__data__, i, j)) { - subgroup.push(node); - } - } - } - return d3_transition(subgroups, this.namespace, this.id); - }; - d3_transitionPrototype.tween = function(name, tween) { - var id = this.id, ns = this.namespace; - if (arguments.length < 2) return this.node()[ns][id].tween.get(name); - return d3_selection_each(this, tween == null ? function(node) { - node[ns][id].tween.remove(name); - } : function(node) { - node[ns][id].tween.set(name, tween); - }); - }; - function d3_transition_tween(groups, name, value, tween) { - var id = groups.id, ns = groups.namespace; - return d3_selection_each(groups, typeof value === "function" ? function(node, i, j) { - node[ns][id].tween.set(name, tween(value.call(node, node.__data__, i, j))); - } : (value = tween(value), function(node) { - node[ns][id].tween.set(name, value); - })); - } - d3_transitionPrototype.attr = function(nameNS, value) { - if (arguments.length < 2) { - for (value in nameNS) this.attr(value, nameNS[value]); - return this; - } - var interpolate = nameNS == "transform" ? d3_interpolateTransform : d3_interpolate, name = d3.ns.qualify(nameNS); - function attrNull() { - this.removeAttribute(name); - } - function attrNullNS() { - this.removeAttributeNS(name.space, name.local); - } - function attrTween(b) { - return b == null ? attrNull : (b += "", function() { - var a = this.getAttribute(name), i; - return a !== b && (i = interpolate(a, b), function(t) { - this.setAttribute(name, i(t)); - }); - }); - } - function attrTweenNS(b) { - return b == null ? attrNullNS : (b += "", function() { - var a = this.getAttributeNS(name.space, name.local), i; - return a !== b && (i = interpolate(a, b), function(t) { - this.setAttributeNS(name.space, name.local, i(t)); - }); - }); - } - return d3_transition_tween(this, "attr." + nameNS, value, name.local ? attrTweenNS : attrTween); - }; - d3_transitionPrototype.attrTween = function(nameNS, tween) { - var name = d3.ns.qualify(nameNS); - function attrTween(d, i) { - var f = tween.call(this, d, i, this.getAttribute(name)); - return f && function(t) { - this.setAttribute(name, f(t)); - }; - } - function attrTweenNS(d, i) { - var f = tween.call(this, d, i, this.getAttributeNS(name.space, name.local)); - return f && function(t) { - this.setAttributeNS(name.space, name.local, f(t)); - }; - } - return this.tween("attr." + nameNS, name.local ? attrTweenNS : attrTween); - }; - d3_transitionPrototype.style = function(name, value, priority) { - var n = arguments.length; - if (n < 3) { - if (typeof name !== "string") { - if (n < 2) value = ""; - for (priority in name) this.style(priority, name[priority], value); - return this; - } - priority = ""; - } - function styleNull() { - this.style.removeProperty(name); - } - function styleString(b) { - return b == null ? styleNull : (b += "", function() { - var a = d3_window(this).getComputedStyle(this, null).getPropertyValue(name), i; - return a !== b && (i = d3_interpolate(a, b), function(t) { - this.style.setProperty(name, i(t), priority); - }); - }); - } - return d3_transition_tween(this, "style." + name, value, styleString); - }; - d3_transitionPrototype.styleTween = function(name, tween, priority) { - if (arguments.length < 3) priority = ""; - function styleTween(d, i) { - var f = tween.call(this, d, i, d3_window(this).getComputedStyle(this, null).getPropertyValue(name)); - return f && function(t) { - this.style.setProperty(name, f(t), priority); - }; - } - return this.tween("style." + name, styleTween); - }; - d3_transitionPrototype.text = function(value) { - return d3_transition_tween(this, "text", value, d3_transition_text); - }; - function d3_transition_text(b) { - if (b == null) b = ""; - return function() { - this.textContent = b; - }; - } - d3_transitionPrototype.remove = function() { - var ns = this.namespace; - return this.each("end.transition", function() { - var p; - if (this[ns].count < 2 && (p = this.parentNode)) p.removeChild(this); - }); - }; - d3_transitionPrototype.ease = function(value) { - var id = this.id, ns = this.namespace; - if (arguments.length < 1) return this.node()[ns][id].ease; - if (typeof value !== "function") value = d3.ease.apply(d3, arguments); - return d3_selection_each(this, function(node) { - node[ns][id].ease = value; - }); - }; - d3_transitionPrototype.delay = function(value) { - var id = this.id, ns = this.namespace; - if (arguments.length < 1) return this.node()[ns][id].delay; - return d3_selection_each(this, typeof value === "function" ? function(node, i, j) { - node[ns][id].delay = +value.call(node, node.__data__, i, j); - } : (value = +value, function(node) { - node[ns][id].delay = value; - })); - }; - d3_transitionPrototype.duration = function(value) { - var id = this.id, ns = this.namespace; - if (arguments.length < 1) return this.node()[ns][id].duration; - return d3_selection_each(this, typeof value === "function" ? function(node, i, j) { - node[ns][id].duration = Math.max(1, value.call(node, node.__data__, i, j)); - } : (value = Math.max(1, value), function(node) { - node[ns][id].duration = value; - })); - }; - d3_transitionPrototype.each = function(type, listener) { - var id = this.id, ns = this.namespace; - if (arguments.length < 2) { - var inherit = d3_transitionInherit, inheritId = d3_transitionInheritId; - try { - d3_transitionInheritId = id; - d3_selection_each(this, function(node, i, j) { - d3_transitionInherit = node[ns][id]; - type.call(node, node.__data__, i, j); - }); - } finally { - d3_transitionInherit = inherit; - d3_transitionInheritId = inheritId; - } - } else { - d3_selection_each(this, function(node) { - var transition = node[ns][id]; - (transition.event || (transition.event = d3.dispatch("start", "end", "interrupt"))).on(type, listener); - }); - } - return this; - }; - d3_transitionPrototype.transition = function() { - var id0 = this.id, id1 = ++d3_transitionId, ns = this.namespace, subgroups = [], subgroup, group, node, transition; - for (var j = 0, m = this.length; j < m; j++) { - subgroups.push(subgroup = []); - for (var group = this[j], i = 0, n = group.length; i < n; i++) { - if (node = group[i]) { - transition = node[ns][id0]; - d3_transitionNode(node, i, ns, id1, { - time: transition.time, - ease: transition.ease, - delay: transition.delay + transition.duration, - duration: transition.duration - }); - } - subgroup.push(node); - } - } - return d3_transition(subgroups, ns, id1); - }; - function d3_transitionNamespace(name) { - return name == null ? "__transition__" : "__transition_" + name + "__"; - } - function d3_transitionNode(node, i, ns, id, inherit) { - var lock = node[ns] || (node[ns] = { - active: 0, - count: 0 - }), transition = lock[id]; - if (!transition) { - var time = inherit.time; - transition = lock[id] = { - tween: new d3_Map(), - time: time, - delay: inherit.delay, - duration: inherit.duration, - ease: inherit.ease, - index: i - }; - inherit = null; - ++lock.count; - d3.timer(function(elapsed) { - var delay = transition.delay, duration, ease, timer = d3_timer_active, tweened = []; - timer.t = delay + time; - if (delay <= elapsed) return start(elapsed - delay); - timer.c = start; - function start(elapsed) { - if (lock.active > id) return stop(); - var active = lock[lock.active]; - if (active) { - --lock.count; - delete lock[lock.active]; - active.event && active.event.interrupt.call(node, node.__data__, active.index); - } - lock.active = id; - transition.event && transition.event.start.call(node, node.__data__, i); - transition.tween.forEach(function(key, value) { - if (value = value.call(node, node.__data__, i)) { - tweened.push(value); - } - }); - ease = transition.ease; - duration = transition.duration; - d3.timer(function() { - timer.c = tick(elapsed || 1) ? d3_true : tick; - return 1; - }, 0, time); - } - function tick(elapsed) { - if (lock.active !== id) return 1; - var t = elapsed / duration, e = ease(t), n = tweened.length; - while (n > 0) { - tweened[--n].call(node, e); - } - if (t >= 1) { - transition.event && transition.event.end.call(node, node.__data__, i); - return stop(); - } - } - function stop() { - if (--lock.count) delete lock[id]; else delete node[ns]; - return 1; - } - }, 0, time); - } - } - d3.svg.axis = function() { - var scale = d3.scale.linear(), orient = d3_svg_axisDefaultOrient, innerTickSize = 6, outerTickSize = 6, tickPadding = 3, tickArguments_ = [ 10 ], tickValues = null, tickFormat_; - function axis(g) { - g.each(function() { - var g = d3.select(this); - var scale0 = this.__chart__ || scale, scale1 = this.__chart__ = scale.copy(); - var ticks = tickValues == null ? scale1.ticks ? scale1.ticks.apply(scale1, tickArguments_) : scale1.domain() : tickValues, tickFormat = tickFormat_ == null ? scale1.tickFormat ? scale1.tickFormat.apply(scale1, tickArguments_) : d3_identity : tickFormat_, tick = g.selectAll(".tick").data(ticks, scale1), tickEnter = tick.enter().insert("g", ".domain").attr("class", "tick").style("opacity", ε), tickExit = d3.transition(tick.exit()).style("opacity", ε).remove(), tickUpdate = d3.transition(tick.order()).style("opacity", 1), tickSpacing = Math.max(innerTickSize, 0) + tickPadding, tickTransform; - var range = d3_scaleRange(scale1), path = g.selectAll(".domain").data([ 0 ]), pathUpdate = (path.enter().append("path").attr("class", "domain"), - d3.transition(path)); - tickEnter.append("line"); - tickEnter.append("text"); - var lineEnter = tickEnter.select("line"), lineUpdate = tickUpdate.select("line"), text = tick.select("text").text(tickFormat), textEnter = tickEnter.select("text"), textUpdate = tickUpdate.select("text"), sign = orient === "top" || orient === "left" ? -1 : 1, x1, x2, y1, y2; - if (orient === "bottom" || orient === "top") { - tickTransform = d3_svg_axisX, x1 = "x", y1 = "y", x2 = "x2", y2 = "y2"; - text.attr("dy", sign < 0 ? "0em" : ".71em").style("text-anchor", "middle"); - pathUpdate.attr("d", "M" + range[0] + "," + sign * outerTickSize + "V0H" + range[1] + "V" + sign * outerTickSize); - } else { - tickTransform = d3_svg_axisY, x1 = "y", y1 = "x", x2 = "y2", y2 = "x2"; - text.attr("dy", ".32em").style("text-anchor", sign < 0 ? "end" : "start"); - pathUpdate.attr("d", "M" + sign * outerTickSize + "," + range[0] + "H0V" + range[1] + "H" + sign * outerTickSize); - } - lineEnter.attr(y2, sign * innerTickSize); - textEnter.attr(y1, sign * tickSpacing); - lineUpdate.attr(x2, 0).attr(y2, sign * innerTickSize); - textUpdate.attr(x1, 0).attr(y1, sign * tickSpacing); - if (scale1.rangeBand) { - var x = scale1, dx = x.rangeBand() / 2; - scale0 = scale1 = function(d) { - return x(d) + dx; - }; - } else if (scale0.rangeBand) { - scale0 = scale1; - } else { - tickExit.call(tickTransform, scale1, scale0); - } - tickEnter.call(tickTransform, scale0, scale1); - tickUpdate.call(tickTransform, scale1, scale1); - }); - } - axis.scale = function(x) { - if (!arguments.length) return scale; - scale = x; - return axis; - }; - axis.orient = function(x) { - if (!arguments.length) return orient; - orient = x in d3_svg_axisOrients ? x + "" : d3_svg_axisDefaultOrient; - return axis; - }; - axis.ticks = function() { - if (!arguments.length) return tickArguments_; - tickArguments_ = arguments; - return axis; - }; - axis.tickValues = function(x) { - if (!arguments.length) return tickValues; - tickValues = x; - return axis; - }; - axis.tickFormat = function(x) { - if (!arguments.length) return tickFormat_; - tickFormat_ = x; - return axis; - }; - axis.tickSize = function(x) { - var n = arguments.length; - if (!n) return innerTickSize; - innerTickSize = +x; - outerTickSize = +arguments[n - 1]; - return axis; - }; - axis.innerTickSize = function(x) { - if (!arguments.length) return innerTickSize; - innerTickSize = +x; - return axis; - }; - axis.outerTickSize = function(x) { - if (!arguments.length) return outerTickSize; - outerTickSize = +x; - return axis; - }; - axis.tickPadding = function(x) { - if (!arguments.length) return tickPadding; - tickPadding = +x; - return axis; - }; - axis.tickSubdivide = function() { - return arguments.length && axis; - }; - return axis; - }; - var d3_svg_axisDefaultOrient = "bottom", d3_svg_axisOrients = { - top: 1, - right: 1, - bottom: 1, - left: 1 - }; - function d3_svg_axisX(selection, x0, x1) { - selection.attr("transform", function(d) { - var v0 = x0(d); - return "translate(" + (isFinite(v0) ? v0 : x1(d)) + ",0)"; - }); - } - function d3_svg_axisY(selection, y0, y1) { - selection.attr("transform", function(d) { - var v0 = y0(d); - return "translate(0," + (isFinite(v0) ? v0 : y1(d)) + ")"; - }); - } - d3.svg.brush = function() { - var event = d3_eventDispatch(brush, "brushstart", "brush", "brushend"), x = null, y = null, xExtent = [ 0, 0 ], yExtent = [ 0, 0 ], xExtentDomain, yExtentDomain, xClamp = true, yClamp = true, resizes = d3_svg_brushResizes[0]; - function brush(g) { - g.each(function() { - var g = d3.select(this).style("pointer-events", "all").style("-webkit-tap-highlight-color", "rgba(0,0,0,0)").on("mousedown.brush", brushstart).on("touchstart.brush", brushstart); - var background = g.selectAll(".background").data([ 0 ]); - background.enter().append("rect").attr("class", "background").style("visibility", "hidden").style("cursor", "crosshair"); - g.selectAll(".extent").data([ 0 ]).enter().append("rect").attr("class", "extent").style("cursor", "move"); - var resize = g.selectAll(".resize").data(resizes, d3_identity); - resize.exit().remove(); - resize.enter().append("g").attr("class", function(d) { - return "resize " + d; - }).style("cursor", function(d) { - return d3_svg_brushCursor[d]; - }).append("rect").attr("x", function(d) { - return /[ew]$/.test(d) ? -3 : null; - }).attr("y", function(d) { - return /^[ns]/.test(d) ? -3 : null; - }).attr("width", 6).attr("height", 6).style("visibility", "hidden"); - resize.style("display", brush.empty() ? "none" : null); - var gUpdate = d3.transition(g), backgroundUpdate = d3.transition(background), range; - if (x) { - range = d3_scaleRange(x); - backgroundUpdate.attr("x", range[0]).attr("width", range[1] - range[0]); - redrawX(gUpdate); - } - if (y) { - range = d3_scaleRange(y); - backgroundUpdate.attr("y", range[0]).attr("height", range[1] - range[0]); - redrawY(gUpdate); - } - redraw(gUpdate); - }); - } - brush.event = function(g) { - g.each(function() { - var event_ = event.of(this, arguments), extent1 = { - x: xExtent, - y: yExtent, - i: xExtentDomain, - j: yExtentDomain - }, extent0 = this.__chart__ || extent1; - this.__chart__ = extent1; - if (d3_transitionInheritId) { - d3.select(this).transition().each("start.brush", function() { - xExtentDomain = extent0.i; - yExtentDomain = extent0.j; - xExtent = extent0.x; - yExtent = extent0.y; - event_({ - type: "brushstart" - }); - }).tween("brush:brush", function() { - var xi = d3_interpolateArray(xExtent, extent1.x), yi = d3_interpolateArray(yExtent, extent1.y); - xExtentDomain = yExtentDomain = null; - return function(t) { - xExtent = extent1.x = xi(t); - yExtent = extent1.y = yi(t); - event_({ - type: "brush", - mode: "resize" - }); - }; - }).each("end.brush", function() { - xExtentDomain = extent1.i; - yExtentDomain = extent1.j; - event_({ - type: "brush", - mode: "resize" - }); - event_({ - type: "brushend" - }); - }); - } else { - event_({ - type: "brushstart" - }); - event_({ - type: "brush", - mode: "resize" - }); - event_({ - type: "brushend" - }); - } - }); - }; - function redraw(g) { - g.selectAll(".resize").attr("transform", function(d) { - return "translate(" + xExtent[+/e$/.test(d)] + "," + yExtent[+/^s/.test(d)] + ")"; - }); - } - function redrawX(g) { - g.select(".extent").attr("x", xExtent[0]); - g.selectAll(".extent,.n>rect,.s>rect").attr("width", xExtent[1] - xExtent[0]); - } - function redrawY(g) { - g.select(".extent").attr("y", yExtent[0]); - g.selectAll(".extent,.e>rect,.w>rect").attr("height", yExtent[1] - yExtent[0]); - } - function brushstart() { - var target = this, eventTarget = d3.select(d3.event.target), event_ = event.of(target, arguments), g = d3.select(target), resizing = eventTarget.datum(), resizingX = !/^(n|s)$/.test(resizing) && x, resizingY = !/^(e|w)$/.test(resizing) && y, dragging = eventTarget.classed("extent"), dragRestore = d3_event_dragSuppress(target), center, origin = d3.mouse(target), offset; - var w = d3.select(d3_window(target)).on("keydown.brush", keydown).on("keyup.brush", keyup); - if (d3.event.changedTouches) { - w.on("touchmove.brush", brushmove).on("touchend.brush", brushend); - } else { - w.on("mousemove.brush", brushmove).on("mouseup.brush", brushend); - } - g.interrupt().selectAll("*").interrupt(); - if (dragging) { - origin[0] = xExtent[0] - origin[0]; - origin[1] = yExtent[0] - origin[1]; - } else if (resizing) { - var ex = +/w$/.test(resizing), ey = +/^n/.test(resizing); - offset = [ xExtent[1 - ex] - origin[0], yExtent[1 - ey] - origin[1] ]; - origin[0] = xExtent[ex]; - origin[1] = yExtent[ey]; - } else if (d3.event.altKey) center = origin.slice(); - g.style("pointer-events", "none").selectAll(".resize").style("display", null); - d3.select("body").style("cursor", eventTarget.style("cursor")); - event_({ - type: "brushstart" - }); - brushmove(); - function keydown() { - if (d3.event.keyCode == 32) { - if (!dragging) { - center = null; - origin[0] -= xExtent[1]; - origin[1] -= yExtent[1]; - dragging = 2; - } - d3_eventPreventDefault(); - } - } - function keyup() { - if (d3.event.keyCode == 32 && dragging == 2) { - origin[0] += xExtent[1]; - origin[1] += yExtent[1]; - dragging = 0; - d3_eventPreventDefault(); - } - } - function brushmove() { - var point = d3.mouse(target), moved = false; - if (offset) { - point[0] += offset[0]; - point[1] += offset[1]; - } - if (!dragging) { - if (d3.event.altKey) { - if (!center) center = [ (xExtent[0] + xExtent[1]) / 2, (yExtent[0] + yExtent[1]) / 2 ]; - origin[0] = xExtent[+(point[0] < center[0])]; - origin[1] = yExtent[+(point[1] < center[1])]; - } else center = null; - } - if (resizingX && move1(point, x, 0)) { - redrawX(g); - moved = true; - } - if (resizingY && move1(point, y, 1)) { - redrawY(g); - moved = true; - } - if (moved) { - redraw(g); - event_({ - type: "brush", - mode: dragging ? "move" : "resize" - }); - } - } - function move1(point, scale, i) { - var range = d3_scaleRange(scale), r0 = range[0], r1 = range[1], position = origin[i], extent = i ? yExtent : xExtent, size = extent[1] - extent[0], min, max; - if (dragging) { - r0 -= position; - r1 -= size + position; - } - min = (i ? yClamp : xClamp) ? Math.max(r0, Math.min(r1, point[i])) : point[i]; - if (dragging) { - max = (min += position) + size; - } else { - if (center) position = Math.max(r0, Math.min(r1, 2 * center[i] - min)); - if (position < min) { - max = min; - min = position; - } else { - max = position; - } - } - if (extent[0] != min || extent[1] != max) { - if (i) yExtentDomain = null; else xExtentDomain = null; - extent[0] = min; - extent[1] = max; - return true; - } - } - function brushend() { - brushmove(); - g.style("pointer-events", "all").selectAll(".resize").style("display", brush.empty() ? "none" : null); - d3.select("body").style("cursor", null); - w.on("mousemove.brush", null).on("mouseup.brush", null).on("touchmove.brush", null).on("touchend.brush", null).on("keydown.brush", null).on("keyup.brush", null); - dragRestore(); - event_({ - type: "brushend" - }); - } - } - brush.x = function(z) { - if (!arguments.length) return x; - x = z; - resizes = d3_svg_brushResizes[!x << 1 | !y]; - return brush; - }; - brush.y = function(z) { - if (!arguments.length) return y; - y = z; - resizes = d3_svg_brushResizes[!x << 1 | !y]; - return brush; - }; - brush.clamp = function(z) { - if (!arguments.length) return x && y ? [ xClamp, yClamp ] : x ? xClamp : y ? yClamp : null; - if (x && y) xClamp = !!z[0], yClamp = !!z[1]; else if (x) xClamp = !!z; else if (y) yClamp = !!z; - return brush; - }; - brush.extent = function(z) { - var x0, x1, y0, y1, t; - if (!arguments.length) { - if (x) { - if (xExtentDomain) { - x0 = xExtentDomain[0], x1 = xExtentDomain[1]; - } else { - x0 = xExtent[0], x1 = xExtent[1]; - if (x.invert) x0 = x.invert(x0), x1 = x.invert(x1); - if (x1 < x0) t = x0, x0 = x1, x1 = t; - } - } - if (y) { - if (yExtentDomain) { - y0 = yExtentDomain[0], y1 = yExtentDomain[1]; - } else { - y0 = yExtent[0], y1 = yExtent[1]; - if (y.invert) y0 = y.invert(y0), y1 = y.invert(y1); - if (y1 < y0) t = y0, y0 = y1, y1 = t; - } - } - return x && y ? [ [ x0, y0 ], [ x1, y1 ] ] : x ? [ x0, x1 ] : y && [ y0, y1 ]; - } - if (x) { - x0 = z[0], x1 = z[1]; - if (y) x0 = x0[0], x1 = x1[0]; - xExtentDomain = [ x0, x1 ]; - if (x.invert) x0 = x(x0), x1 = x(x1); - if (x1 < x0) t = x0, x0 = x1, x1 = t; - if (x0 != xExtent[0] || x1 != xExtent[1]) xExtent = [ x0, x1 ]; - } - if (y) { - y0 = z[0], y1 = z[1]; - if (x) y0 = y0[1], y1 = y1[1]; - yExtentDomain = [ y0, y1 ]; - if (y.invert) y0 = y(y0), y1 = y(y1); - if (y1 < y0) t = y0, y0 = y1, y1 = t; - if (y0 != yExtent[0] || y1 != yExtent[1]) yExtent = [ y0, y1 ]; - } - return brush; - }; - brush.clear = function() { - if (!brush.empty()) { - xExtent = [ 0, 0 ], yExtent = [ 0, 0 ]; - xExtentDomain = yExtentDomain = null; - } - return brush; - }; - brush.empty = function() { - return !!x && xExtent[0] == xExtent[1] || !!y && yExtent[0] == yExtent[1]; - }; - return d3.rebind(brush, event, "on"); - }; - var d3_svg_brushCursor = { - n: "ns-resize", - e: "ew-resize", - s: "ns-resize", - w: "ew-resize", - nw: "nwse-resize", - ne: "nesw-resize", - se: "nwse-resize", - sw: "nesw-resize" - }; - var d3_svg_brushResizes = [ [ "n", "e", "s", "w", "nw", "ne", "se", "sw" ], [ "e", "w" ], [ "n", "s" ], [] ]; - var d3_time_format = d3_time.format = d3_locale_enUS.timeFormat; - var d3_time_formatUtc = d3_time_format.utc; - var d3_time_formatIso = d3_time_formatUtc("%Y-%m-%dT%H:%M:%S.%LZ"); - d3_time_format.iso = Date.prototype.toISOString && +new Date("2000-01-01T00:00:00.000Z") ? d3_time_formatIsoNative : d3_time_formatIso; - function d3_time_formatIsoNative(date) { - return date.toISOString(); - } - d3_time_formatIsoNative.parse = function(string) { - var date = new Date(string); - return isNaN(date) ? null : date; - }; - d3_time_formatIsoNative.toString = d3_time_formatIso.toString; - d3_time.second = d3_time_interval(function(date) { - return new d3_date(Math.floor(date / 1e3) * 1e3); - }, function(date, offset) { - date.setTime(date.getTime() + Math.floor(offset) * 1e3); - }, function(date) { - return date.getSeconds(); - }); - d3_time.seconds = d3_time.second.range; - d3_time.seconds.utc = d3_time.second.utc.range; - d3_time.minute = d3_time_interval(function(date) { - return new d3_date(Math.floor(date / 6e4) * 6e4); - }, function(date, offset) { - date.setTime(date.getTime() + Math.floor(offset) * 6e4); - }, function(date) { - return date.getMinutes(); - }); - d3_time.minutes = d3_time.minute.range; - d3_time.minutes.utc = d3_time.minute.utc.range; - d3_time.hour = d3_time_interval(function(date) { - var timezone = date.getTimezoneOffset() / 60; - return new d3_date((Math.floor(date / 36e5 - timezone) + timezone) * 36e5); - }, function(date, offset) { - date.setTime(date.getTime() + Math.floor(offset) * 36e5); - }, function(date) { - return date.getHours(); - }); - d3_time.hours = d3_time.hour.range; - d3_time.hours.utc = d3_time.hour.utc.range; - d3_time.month = d3_time_interval(function(date) { - date = d3_time.day(date); - date.setDate(1); - return date; - }, function(date, offset) { - date.setMonth(date.getMonth() + offset); - }, function(date) { - return date.getMonth(); - }); - d3_time.months = d3_time.month.range; - d3_time.months.utc = d3_time.month.utc.range; - function d3_time_scale(linear, methods, format) { - function scale(x) { - return linear(x); - } - scale.invert = function(x) { - return d3_time_scaleDate(linear.invert(x)); - }; - scale.domain = function(x) { - if (!arguments.length) return linear.domain().map(d3_time_scaleDate); - linear.domain(x); - return scale; - }; - function tickMethod(extent, count) { - var span = extent[1] - extent[0], target = span / count, i = d3.bisect(d3_time_scaleSteps, target); - return i == d3_time_scaleSteps.length ? [ methods.year, d3_scale_linearTickRange(extent.map(function(d) { - return d / 31536e6; - }), count)[2] ] : !i ? [ d3_time_scaleMilliseconds, d3_scale_linearTickRange(extent, count)[2] ] : methods[target / d3_time_scaleSteps[i - 1] < d3_time_scaleSteps[i] / target ? i - 1 : i]; - } - scale.nice = function(interval, skip) { - var domain = scale.domain(), extent = d3_scaleExtent(domain), method = interval == null ? tickMethod(extent, 10) : typeof interval === "number" && tickMethod(extent, interval); - if (method) interval = method[0], skip = method[1]; - function skipped(date) { - return !isNaN(date) && !interval.range(date, d3_time_scaleDate(+date + 1), skip).length; - } - return scale.domain(d3_scale_nice(domain, skip > 1 ? { - floor: function(date) { - while (skipped(date = interval.floor(date))) date = d3_time_scaleDate(date - 1); - return date; - }, - ceil: function(date) { - while (skipped(date = interval.ceil(date))) date = d3_time_scaleDate(+date + 1); - return date; - } - } : interval)); - }; - scale.ticks = function(interval, skip) { - var extent = d3_scaleExtent(scale.domain()), method = interval == null ? tickMethod(extent, 10) : typeof interval === "number" ? tickMethod(extent, interval) : !interval.range && [ { - range: interval - }, skip ]; - if (method) interval = method[0], skip = method[1]; - return interval.range(extent[0], d3_time_scaleDate(+extent[1] + 1), skip < 1 ? 1 : skip); - }; - scale.tickFormat = function() { - return format; - }; - scale.copy = function() { - return d3_time_scale(linear.copy(), methods, format); - }; - return d3_scale_linearRebind(scale, linear); - } - function d3_time_scaleDate(t) { - return new Date(t); - } - var d3_time_scaleSteps = [ 1e3, 5e3, 15e3, 3e4, 6e4, 3e5, 9e5, 18e5, 36e5, 108e5, 216e5, 432e5, 864e5, 1728e5, 6048e5, 2592e6, 7776e6, 31536e6 ]; - var d3_time_scaleLocalMethods = [ [ d3_time.second, 1 ], [ d3_time.second, 5 ], [ d3_time.second, 15 ], [ d3_time.second, 30 ], [ d3_time.minute, 1 ], [ d3_time.minute, 5 ], [ d3_time.minute, 15 ], [ d3_time.minute, 30 ], [ d3_time.hour, 1 ], [ d3_time.hour, 3 ], [ d3_time.hour, 6 ], [ d3_time.hour, 12 ], [ d3_time.day, 1 ], [ d3_time.day, 2 ], [ d3_time.week, 1 ], [ d3_time.month, 1 ], [ d3_time.month, 3 ], [ d3_time.year, 1 ] ]; - var d3_time_scaleLocalFormat = d3_time_format.multi([ [ ".%L", function(d) { - return d.getMilliseconds(); - } ], [ ":%S", function(d) { - return d.getSeconds(); - } ], [ "%I:%M", function(d) { - return d.getMinutes(); - } ], [ "%I %p", function(d) { - return d.getHours(); - } ], [ "%a %d", function(d) { - return d.getDay() && d.getDate() != 1; - } ], [ "%b %d", function(d) { - return d.getDate() != 1; - } ], [ "%B", function(d) { - return d.getMonth(); - } ], [ "%Y", d3_true ] ]); - var d3_time_scaleMilliseconds = { - range: function(start, stop, step) { - return d3.range(Math.ceil(start / step) * step, +stop, step).map(d3_time_scaleDate); - }, - floor: d3_identity, - ceil: d3_identity - }; - d3_time_scaleLocalMethods.year = d3_time.year; - d3_time.scale = function() { - return d3_time_scale(d3.scale.linear(), d3_time_scaleLocalMethods, d3_time_scaleLocalFormat); - }; - var d3_time_scaleUtcMethods = d3_time_scaleLocalMethods.map(function(m) { - return [ m[0].utc, m[1] ]; - }); - var d3_time_scaleUtcFormat = d3_time_formatUtc.multi([ [ ".%L", function(d) { - return d.getUTCMilliseconds(); - } ], [ ":%S", function(d) { - return d.getUTCSeconds(); - } ], [ "%I:%M", function(d) { - return d.getUTCMinutes(); - } ], [ "%I %p", function(d) { - return d.getUTCHours(); - } ], [ "%a %d", function(d) { - return d.getUTCDay() && d.getUTCDate() != 1; - } ], [ "%b %d", function(d) { - return d.getUTCDate() != 1; - } ], [ "%B", function(d) { - return d.getUTCMonth(); - } ], [ "%Y", d3_true ] ]); - d3_time_scaleUtcMethods.year = d3_time.year.utc; - d3_time.scale.utc = function() { - return d3_time_scale(d3.scale.linear(), d3_time_scaleUtcMethods, d3_time_scaleUtcFormat); - }; - d3.text = d3_xhrType(function(request) { - return request.responseText; - }); - d3.json = function(url, callback) { - return d3_xhr(url, "application/json", d3_json, callback); - }; - function d3_json(request) { - return JSON.parse(request.responseText); - } - d3.html = function(url, callback) { - return d3_xhr(url, "text/html", d3_html, callback); - }; - function d3_html(request) { - var range = d3_document.createRange(); - range.selectNode(d3_document.body); - return range.createContextualFragment(request.responseText); - } - d3.xml = d3_xhrType(function(request) { - return request.responseXML; - }); - if (typeof define === "function" && define.amd) define(d3); else if (typeof module === "object" && module.exports) module.exports = d3; - this.d3 = d3; -}(); -},{}],7:[function(require,module,exports){ -/*! - * jQuery JavaScript Library v3.1.1 - * https://jquery.com/ - * - * Includes Sizzle.js - * https://sizzlejs.com/ - * - * Copyright jQuery Foundation and other contributors - * Released under the MIT license - * https://jquery.org/license - * - * Date: 2016-09-22T22:30Z - */ -( function( global, factory ) { - - "use strict"; - - if ( typeof module === "object" && typeof module.exports === "object" ) { - - // For CommonJS and CommonJS-like environments where a proper `window` - // is present, execute the factory and get jQuery. - // For environments that do not have a `window` with a `document` - // (such as Node.js), expose a factory as module.exports. - // This accentuates the need for the creation of a real `window`. - // e.g. var jQuery = require("jquery")(window); - // See ticket #14549 for more info. - module.exports = global.document ? - factory( global, true ) : - function( w ) { - if ( !w.document ) { - throw new Error( "jQuery requires a window with a document" ); - } - return factory( w ); - }; - } else { - factory( global ); - } - -// Pass this if window is not defined yet -} )( typeof window !== "undefined" ? window : this, function( window, noGlobal ) { - -// Edge <= 12 - 13+, Firefox <=18 - 45+, IE 10 - 11, Safari 5.1 - 9+, iOS 6 - 9.1 -// throw exceptions when non-strict code (e.g., ASP.NET 4.5) accesses strict mode -// arguments.callee.caller (trac-13335). But as of jQuery 3.0 (2016), strict mode should be common -// enough that all such attempts are guarded in a try block. -"use strict"; - -var arr = []; - -var document = window.document; - -var getProto = Object.getPrototypeOf; - -var slice = arr.slice; - -var concat = arr.concat; - -var push = arr.push; - -var indexOf = arr.indexOf; - -var class2type = {}; - -var toString = class2type.toString; - -var hasOwn = class2type.hasOwnProperty; - -var fnToString = hasOwn.toString; - -var ObjectFunctionString = fnToString.call( Object ); - -var support = {}; - - - - function DOMEval( code, doc ) { - doc = doc || document; - - var script = doc.createElement( "script" ); - - script.text = code; - doc.head.appendChild( script ).parentNode.removeChild( script ); - } -/* global Symbol */ -// Defining this global in .eslintrc.json would create a danger of using the global -// unguarded in another place, it seems safer to define global only for this module - - - -var - version = "3.1.1", - - // Define a local copy of jQuery - jQuery = function( selector, context ) { - - // The jQuery object is actually just the init constructor 'enhanced' - // Need init if jQuery is called (just allow error to be thrown if not included) - return new jQuery.fn.init( selector, context ); - }, - - // Support: Android <=4.0 only - // Make sure we trim BOM and NBSP - rtrim = /^[\s\uFEFF\xA0]+|[\s\uFEFF\xA0]+$/g, - - // Matches dashed string for camelizing - rmsPrefix = /^-ms-/, - rdashAlpha = /-([a-z])/g, - - // Used by jQuery.camelCase as callback to replace() - fcamelCase = function( all, letter ) { - return letter.toUpperCase(); - }; - -jQuery.fn = jQuery.prototype = { - - // The current version of jQuery being used - jquery: version, - - constructor: jQuery, - - // The default length of a jQuery object is 0 - length: 0, - - toArray: function() { - return slice.call( this ); - }, - - // Get the Nth element in the matched element set OR - // Get the whole matched element set as a clean array - get: function( num ) { - - // Return all the elements in a clean array - if ( num == null ) { - return slice.call( this ); - } - - // Return just the one element from the set - return num < 0 ? this[ num + this.length ] : this[ num ]; - }, - - // Take an array of elements and push it onto the stack - // (returning the new matched element set) - pushStack: function( elems ) { - - // Build a new jQuery matched element set - var ret = jQuery.merge( this.constructor(), elems ); - - // Add the old object onto the stack (as a reference) - ret.prevObject = this; - - // Return the newly-formed element set - return ret; - }, - - // Execute a callback for every element in the matched set. - each: function( callback ) { - return jQuery.each( this, callback ); - }, - - map: function( callback ) { - return this.pushStack( jQuery.map( this, function( elem, i ) { - return callback.call( elem, i, elem ); - } ) ); - }, - - slice: function() { - return this.pushStack( slice.apply( this, arguments ) ); - }, - - first: function() { - return this.eq( 0 ); - }, - - last: function() { - return this.eq( -1 ); - }, - - eq: function( i ) { - var len = this.length, - j = +i + ( i < 0 ? len : 0 ); - return this.pushStack( j >= 0 && j < len ? [ this[ j ] ] : [] ); - }, - - end: function() { - return this.prevObject || this.constructor(); - }, - - // For internal use only. - // Behaves like an Array's method, not like a jQuery method. - push: push, - sort: arr.sort, - splice: arr.splice -}; - -jQuery.extend = jQuery.fn.extend = function() { - var options, name, src, copy, copyIsArray, clone, - target = arguments[ 0 ] || {}, - i = 1, - length = arguments.length, - deep = false; - - // Handle a deep copy situation - if ( typeof target === "boolean" ) { - deep = target; - - // Skip the boolean and the target - target = arguments[ i ] || {}; - i++; - } - - // Handle case when target is a string or something (possible in deep copy) - if ( typeof target !== "object" && !jQuery.isFunction( target ) ) { - target = {}; - } - - // Extend jQuery itself if only one argument is passed - if ( i === length ) { - target = this; - i--; - } - - for ( ; i < length; i++ ) { - - // Only deal with non-null/undefined values - if ( ( options = arguments[ i ] ) != null ) { - - // Extend the base object - for ( name in options ) { - src = target[ name ]; - copy = options[ name ]; - - // Prevent never-ending loop - if ( target === copy ) { - continue; - } - - // Recurse if we're merging plain objects or arrays - if ( deep && copy && ( jQuery.isPlainObject( copy ) || - ( copyIsArray = jQuery.isArray( copy ) ) ) ) { - - if ( copyIsArray ) { - copyIsArray = false; - clone = src && jQuery.isArray( src ) ? src : []; - - } else { - clone = src && jQuery.isPlainObject( src ) ? src : {}; - } - - // Never move original objects, clone them - target[ name ] = jQuery.extend( deep, clone, copy ); - - // Don't bring in undefined values - } else if ( copy !== undefined ) { - target[ name ] = copy; - } - } - } - } - - // Return the modified object - return target; -}; - -jQuery.extend( { - - // Unique for each copy of jQuery on the page - expando: "jQuery" + ( version + Math.random() ).replace( /\D/g, "" ), - - // Assume jQuery is ready without the ready module - isReady: true, - - error: function( msg ) { - throw new Error( msg ); - }, - - noop: function() {}, - - isFunction: function( obj ) { - return jQuery.type( obj ) === "function"; - }, - - isArray: Array.isArray, - - isWindow: function( obj ) { - return obj != null && obj === obj.window; - }, - - isNumeric: function( obj ) { - - // As of jQuery 3.0, isNumeric is limited to - // strings and numbers (primitives or objects) - // that can be coerced to finite numbers (gh-2662) - var type = jQuery.type( obj ); - return ( type === "number" || type === "string" ) && - - // parseFloat NaNs numeric-cast false positives ("") - // ...but misinterprets leading-number strings, particularly hex literals ("0x...") - // subtraction forces infinities to NaN - !isNaN( obj - parseFloat( obj ) ); - }, - - isPlainObject: function( obj ) { - var proto, Ctor; - - // Detect obvious negatives - // Use toString instead of jQuery.type to catch host objects - if ( !obj || toString.call( obj ) !== "[object Object]" ) { - return false; - } - - proto = getProto( obj ); - - // Objects with no prototype (e.g., `Object.create( null )`) are plain - if ( !proto ) { - return true; - } - - // Objects with prototype are plain iff they were constructed by a global Object function - Ctor = hasOwn.call( proto, "constructor" ) && proto.constructor; - return typeof Ctor === "function" && fnToString.call( Ctor ) === ObjectFunctionString; - }, - - isEmptyObject: function( obj ) { - - /* eslint-disable no-unused-vars */ - // See https://github.com/eslint/eslint/issues/6125 - var name; - - for ( name in obj ) { - return false; - } - return true; - }, - - type: function( obj ) { - if ( obj == null ) { - return obj + ""; - } - - // Support: Android <=2.3 only (functionish RegExp) - return typeof obj === "object" || typeof obj === "function" ? - class2type[ toString.call( obj ) ] || "object" : - typeof obj; - }, - - // Evaluates a script in a global context - globalEval: function( code ) { - DOMEval( code ); - }, - - // Convert dashed to camelCase; used by the css and data modules - // Support: IE <=9 - 11, Edge 12 - 13 - // Microsoft forgot to hump their vendor prefix (#9572) - camelCase: function( string ) { - return string.replace( rmsPrefix, "ms-" ).replace( rdashAlpha, fcamelCase ); - }, - - nodeName: function( elem, name ) { - return elem.nodeName && elem.nodeName.toLowerCase() === name.toLowerCase(); - }, - - each: function( obj, callback ) { - var length, i = 0; - - if ( isArrayLike( obj ) ) { - length = obj.length; - for ( ; i < length; i++ ) { - if ( callback.call( obj[ i ], i, obj[ i ] ) === false ) { - break; - } - } - } else { - for ( i in obj ) { - if ( callback.call( obj[ i ], i, obj[ i ] ) === false ) { - break; - } - } - } - - return obj; - }, - - // Support: Android <=4.0 only - trim: function( text ) { - return text == null ? - "" : - ( text + "" ).replace( rtrim, "" ); - }, - - // results is for internal usage only - makeArray: function( arr, results ) { - var ret = results || []; - - if ( arr != null ) { - if ( isArrayLike( Object( arr ) ) ) { - jQuery.merge( ret, - typeof arr === "string" ? - [ arr ] : arr - ); - } else { - push.call( ret, arr ); - } - } - - return ret; - }, - - inArray: function( elem, arr, i ) { - return arr == null ? -1 : indexOf.call( arr, elem, i ); - }, - - // Support: Android <=4.0 only, PhantomJS 1 only - // push.apply(_, arraylike) throws on ancient WebKit - merge: function( first, second ) { - var len = +second.length, - j = 0, - i = first.length; - - for ( ; j < len; j++ ) { - first[ i++ ] = second[ j ]; - } - - first.length = i; - - return first; - }, - - grep: function( elems, callback, invert ) { - var callbackInverse, - matches = [], - i = 0, - length = elems.length, - callbackExpect = !invert; - - // Go through the array, only saving the items - // that pass the validator function - for ( ; i < length; i++ ) { - callbackInverse = !callback( elems[ i ], i ); - if ( callbackInverse !== callbackExpect ) { - matches.push( elems[ i ] ); - } - } - - return matches; - }, - - // arg is for internal usage only - map: function( elems, callback, arg ) { - var length, value, - i = 0, - ret = []; - - // Go through the array, translating each of the items to their new values - if ( isArrayLike( elems ) ) { - length = elems.length; - for ( ; i < length; i++ ) { - value = callback( elems[ i ], i, arg ); - - if ( value != null ) { - ret.push( value ); - } - } - - // Go through every key on the object, - } else { - for ( i in elems ) { - value = callback( elems[ i ], i, arg ); - - if ( value != null ) { - ret.push( value ); - } - } - } - - // Flatten any nested arrays - return concat.apply( [], ret ); - }, - - // A global GUID counter for objects - guid: 1, - - // Bind a function to a context, optionally partially applying any - // arguments. - proxy: function( fn, context ) { - var tmp, args, proxy; - - if ( typeof context === "string" ) { - tmp = fn[ context ]; - context = fn; - fn = tmp; - } - - // Quick check to determine if target is callable, in the spec - // this throws a TypeError, but we will just return undefined. - if ( !jQuery.isFunction( fn ) ) { - return undefined; - } - - // Simulated bind - args = slice.call( arguments, 2 ); - proxy = function() { - return fn.apply( context || this, args.concat( slice.call( arguments ) ) ); - }; - - // Set the guid of unique handler to the same of original handler, so it can be removed - proxy.guid = fn.guid = fn.guid || jQuery.guid++; - - return proxy; - }, - - now: Date.now, - - // jQuery.support is not used in Core but other projects attach their - // properties to it so it needs to exist. - support: support -} ); - -if ( typeof Symbol === "function" ) { - jQuery.fn[ Symbol.iterator ] = arr[ Symbol.iterator ]; -} - -// Populate the class2type map -jQuery.each( "Boolean Number String Function Array Date RegExp Object Error Symbol".split( " " ), -function( i, name ) { - class2type[ "[object " + name + "]" ] = name.toLowerCase(); -} ); - -function isArrayLike( obj ) { - - // Support: real iOS 8.2 only (not reproducible in simulator) - // `in` check used to prevent JIT error (gh-2145) - // hasOwn isn't used here due to false negatives - // regarding Nodelist length in IE - var length = !!obj && "length" in obj && obj.length, - type = jQuery.type( obj ); - - if ( type === "function" || jQuery.isWindow( obj ) ) { - return false; - } - - return type === "array" || length === 0 || - typeof length === "number" && length > 0 && ( length - 1 ) in obj; -} -var Sizzle = -/*! - * Sizzle CSS Selector Engine v2.3.3 - * https://sizzlejs.com/ - * - * Copyright jQuery Foundation and other contributors - * Released under the MIT license - * http://jquery.org/license - * - * Date: 2016-08-08 - */ -(function( window ) { - -var i, - support, - Expr, - getText, - isXML, - tokenize, - compile, - select, - outermostContext, - sortInput, - hasDuplicate, - - // Local document vars - setDocument, - document, - docElem, - documentIsHTML, - rbuggyQSA, - rbuggyMatches, - matches, - contains, - - // Instance-specific data - expando = "sizzle" + 1 * new Date(), - preferredDoc = window.document, - dirruns = 0, - done = 0, - classCache = createCache(), - tokenCache = createCache(), - compilerCache = createCache(), - sortOrder = function( a, b ) { - if ( a === b ) { - hasDuplicate = true; - } - return 0; - }, - - // Instance methods - hasOwn = ({}).hasOwnProperty, - arr = [], - pop = arr.pop, - push_native = arr.push, - push = arr.push, - slice = arr.slice, - // Use a stripped-down indexOf as it's faster than native - // https://jsperf.com/thor-indexof-vs-for/5 - indexOf = function( list, elem ) { - var i = 0, - len = list.length; - for ( ; i < len; i++ ) { - if ( list[i] === elem ) { - return i; - } - } - return -1; - }, - - booleans = "checked|selected|async|autofocus|autoplay|controls|defer|disabled|hidden|ismap|loop|multiple|open|readonly|required|scoped", - - // Regular expressions - - // http://www.w3.org/TR/css3-selectors/#whitespace - whitespace = "[\\x20\\t\\r\\n\\f]", - - // http://www.w3.org/TR/CSS21/syndata.html#value-def-identifier - identifier = "(?:\\\\.|[\\w-]|[^\0-\\xa0])+", - - // Attribute selectors: http://www.w3.org/TR/selectors/#attribute-selectors - attributes = "\\[" + whitespace + "*(" + identifier + ")(?:" + whitespace + - // Operator (capture 2) - "*([*^$|!~]?=)" + whitespace + - // "Attribute values must be CSS identifiers [capture 5] or strings [capture 3 or capture 4]" - "*(?:'((?:\\\\.|[^\\\\'])*)'|\"((?:\\\\.|[^\\\\\"])*)\"|(" + identifier + "))|)" + whitespace + - "*\\]", - - pseudos = ":(" + identifier + ")(?:\\((" + - // To reduce the number of selectors needing tokenize in the preFilter, prefer arguments: - // 1. quoted (capture 3; capture 4 or capture 5) - "('((?:\\\\.|[^\\\\'])*)'|\"((?:\\\\.|[^\\\\\"])*)\")|" + - // 2. simple (capture 6) - "((?:\\\\.|[^\\\\()[\\]]|" + attributes + ")*)|" + - // 3. anything else (capture 2) - ".*" + - ")\\)|)", - - // Leading and non-escaped trailing whitespace, capturing some non-whitespace characters preceding the latter - rwhitespace = new RegExp( whitespace + "+", "g" ), - rtrim = new RegExp( "^" + whitespace + "+|((?:^|[^\\\\])(?:\\\\.)*)" + whitespace + "+$", "g" ), - - rcomma = new RegExp( "^" + whitespace + "*," + whitespace + "*" ), - rcombinators = new RegExp( "^" + whitespace + "*([>+~]|" + whitespace + ")" + whitespace + "*" ), - - rattributeQuotes = new RegExp( "=" + whitespace + "*([^\\]'\"]*?)" + whitespace + "*\\]", "g" ), - - rpseudo = new RegExp( pseudos ), - ridentifier = new RegExp( "^" + identifier + "$" ), - - matchExpr = { - "ID": new RegExp( "^#(" + identifier + ")" ), - "CLASS": new RegExp( "^\\.(" + identifier + ")" ), - "TAG": new RegExp( "^(" + identifier + "|[*])" ), - "ATTR": new RegExp( "^" + attributes ), - "PSEUDO": new RegExp( "^" + pseudos ), - "CHILD": new RegExp( "^:(only|first|last|nth|nth-last)-(child|of-type)(?:\\(" + whitespace + - "*(even|odd|(([+-]|)(\\d*)n|)" + whitespace + "*(?:([+-]|)" + whitespace + - "*(\\d+)|))" + whitespace + "*\\)|)", "i" ), - "bool": new RegExp( "^(?:" + booleans + ")$", "i" ), - // For use in libraries implementing .is() - // We use this for POS matching in `select` - "needsContext": new RegExp( "^" + whitespace + "*[>+~]|:(even|odd|eq|gt|lt|nth|first|last)(?:\\(" + - whitespace + "*((?:-\\d)?\\d*)" + whitespace + "*\\)|)(?=[^-]|$)", "i" ) - }, - - rinputs = /^(?:input|select|textarea|button)$/i, - rheader = /^h\d$/i, - - rnative = /^[^{]+\{\s*\[native \w/, - - // Easily-parseable/retrievable ID or TAG or CLASS selectors - rquickExpr = /^(?:#([\w-]+)|(\w+)|\.([\w-]+))$/, - - rsibling = /[+~]/, - - // CSS escapes - // http://www.w3.org/TR/CSS21/syndata.html#escaped-characters - runescape = new RegExp( "\\\\([\\da-f]{1,6}" + whitespace + "?|(" + whitespace + ")|.)", "ig" ), - funescape = function( _, escaped, escapedWhitespace ) { - var high = "0x" + escaped - 0x10000; - // NaN means non-codepoint - // Support: Firefox<24 - // Workaround erroneous numeric interpretation of +"0x" - return high !== high || escapedWhitespace ? - escaped : - high < 0 ? - // BMP codepoint - String.fromCharCode( high + 0x10000 ) : - // Supplemental Plane codepoint (surrogate pair) - String.fromCharCode( high >> 10 | 0xD800, high & 0x3FF | 0xDC00 ); - }, - - // CSS string/identifier serialization - // https://drafts.csswg.org/cssom/#common-serializing-idioms - rcssescape = /([\0-\x1f\x7f]|^-?\d)|^-$|[^\0-\x1f\x7f-\uFFFF\w-]/g, - fcssescape = function( ch, asCodePoint ) { - if ( asCodePoint ) { - - // U+0000 NULL becomes U+FFFD REPLACEMENT CHARACTER - if ( ch === "\0" ) { - return "\uFFFD"; - } - - // Control characters and (dependent upon position) numbers get escaped as code points - return ch.slice( 0, -1 ) + "\\" + ch.charCodeAt( ch.length - 1 ).toString( 16 ) + " "; - } - - // Other potentially-special ASCII characters get backslash-escaped - return "\\" + ch; - }, - - // Used for iframes - // See setDocument() - // Removing the function wrapper causes a "Permission Denied" - // error in IE - unloadHandler = function() { - setDocument(); - }, - - disabledAncestor = addCombinator( - function( elem ) { - return elem.disabled === true && ("form" in elem || "label" in elem); - }, - { dir: "parentNode", next: "legend" } - ); - -// Optimize for push.apply( _, NodeList ) -try { - push.apply( - (arr = slice.call( preferredDoc.childNodes )), - preferredDoc.childNodes - ); - // Support: Android<4.0 - // Detect silently failing push.apply - arr[ preferredDoc.childNodes.length ].nodeType; -} catch ( e ) { - push = { apply: arr.length ? - - // Leverage slice if possible - function( target, els ) { - push_native.apply( target, slice.call(els) ); - } : - - // Support: IE<9 - // Otherwise append directly - function( target, els ) { - var j = target.length, - i = 0; - // Can't trust NodeList.length - while ( (target[j++] = els[i++]) ) {} - target.length = j - 1; - } - }; -} - -function Sizzle( selector, context, results, seed ) { - var m, i, elem, nid, match, groups, newSelector, - newContext = context && context.ownerDocument, - - // nodeType defaults to 9, since context defaults to document - nodeType = context ? context.nodeType : 9; - - results = results || []; - - // Return early from calls with invalid selector or context - if ( typeof selector !== "string" || !selector || - nodeType !== 1 && nodeType !== 9 && nodeType !== 11 ) { - - return results; - } - - // Try to shortcut find operations (as opposed to filters) in HTML documents - if ( !seed ) { - - if ( ( context ? context.ownerDocument || context : preferredDoc ) !== document ) { - setDocument( context ); - } - context = context || document; - - if ( documentIsHTML ) { - - // If the selector is sufficiently simple, try using a "get*By*" DOM method - // (excepting DocumentFragment context, where the methods don't exist) - if ( nodeType !== 11 && (match = rquickExpr.exec( selector )) ) { - - // ID selector - if ( (m = match[1]) ) { - - // Document context - if ( nodeType === 9 ) { - if ( (elem = context.getElementById( m )) ) { - - // Support: IE, Opera, Webkit - // TODO: identify versions - // getElementById can match elements by name instead of ID - if ( elem.id === m ) { - results.push( elem ); - return results; - } - } else { - return results; - } - - // Element context - } else { - - // Support: IE, Opera, Webkit - // TODO: identify versions - // getElementById can match elements by name instead of ID - if ( newContext && (elem = newContext.getElementById( m )) && - contains( context, elem ) && - elem.id === m ) { - - results.push( elem ); - return results; - } - } - - // Type selector - } else if ( match[2] ) { - push.apply( results, context.getElementsByTagName( selector ) ); - return results; - - // Class selector - } else if ( (m = match[3]) && support.getElementsByClassName && - context.getElementsByClassName ) { - - push.apply( results, context.getElementsByClassName( m ) ); - return results; - } - } - - // Take advantage of querySelectorAll - if ( support.qsa && - !compilerCache[ selector + " " ] && - (!rbuggyQSA || !rbuggyQSA.test( selector )) ) { - - if ( nodeType !== 1 ) { - newContext = context; - newSelector = selector; - - // qSA looks outside Element context, which is not what we want - // Thanks to Andrew Dupont for this workaround technique - // Support: IE <=8 - // Exclude object elements - } else if ( context.nodeName.toLowerCase() !== "object" ) { - - // Capture the context ID, setting it first if necessary - if ( (nid = context.getAttribute( "id" )) ) { - nid = nid.replace( rcssescape, fcssescape ); - } else { - context.setAttribute( "id", (nid = expando) ); - } - - // Prefix every selector in the list - groups = tokenize( selector ); - i = groups.length; - while ( i-- ) { - groups[i] = "#" + nid + " " + toSelector( groups[i] ); - } - newSelector = groups.join( "," ); - - // Expand context for sibling selectors - newContext = rsibling.test( selector ) && testContext( context.parentNode ) || - context; - } - - if ( newSelector ) { - try { - push.apply( results, - newContext.querySelectorAll( newSelector ) - ); - return results; - } catch ( qsaError ) { - } finally { - if ( nid === expando ) { - context.removeAttribute( "id" ); - } - } - } - } - } - } - - // All others - return select( selector.replace( rtrim, "$1" ), context, results, seed ); -} - -/** - * Create key-value caches of limited size - * @returns {function(string, object)} Returns the Object data after storing it on itself with - * property name the (space-suffixed) string and (if the cache is larger than Expr.cacheLength) - * deleting the oldest entry - */ -function createCache() { - var keys = []; - - function cache( key, value ) { - // Use (key + " ") to avoid collision with native prototype properties (see Issue #157) - if ( keys.push( key + " " ) > Expr.cacheLength ) { - // Only keep the most recent entries - delete cache[ keys.shift() ]; - } - return (cache[ key + " " ] = value); - } - return cache; -} - -/** - * Mark a function for special use by Sizzle - * @param {Function} fn The function to mark - */ -function markFunction( fn ) { - fn[ expando ] = true; - return fn; -} - -/** - * Support testing using an element - * @param {Function} fn Passed the created element and returns a boolean result - */ -function assert( fn ) { - var el = document.createElement("fieldset"); - - try { - return !!fn( el ); - } catch (e) { - return false; - } finally { - // Remove from its parent by default - if ( el.parentNode ) { - el.parentNode.removeChild( el ); - } - // release memory in IE - el = null; - } -} - -/** - * Adds the same handler for all of the specified attrs - * @param {String} attrs Pipe-separated list of attributes - * @param {Function} handler The method that will be applied - */ -function addHandle( attrs, handler ) { - var arr = attrs.split("|"), - i = arr.length; - - while ( i-- ) { - Expr.attrHandle[ arr[i] ] = handler; - } -} - -/** - * Checks document order of two siblings - * @param {Element} a - * @param {Element} b - * @returns {Number} Returns less than 0 if a precedes b, greater than 0 if a follows b - */ -function siblingCheck( a, b ) { - var cur = b && a, - diff = cur && a.nodeType === 1 && b.nodeType === 1 && - a.sourceIndex - b.sourceIndex; - - // Use IE sourceIndex if available on both nodes - if ( diff ) { - return diff; - } - - // Check if b follows a - if ( cur ) { - while ( (cur = cur.nextSibling) ) { - if ( cur === b ) { - return -1; - } - } - } - - return a ? 1 : -1; -} - -/** - * Returns a function to use in pseudos for input types - * @param {String} type - */ -function createInputPseudo( type ) { - return function( elem ) { - var name = elem.nodeName.toLowerCase(); - return name === "input" && elem.type === type; - }; -} - -/** - * Returns a function to use in pseudos for buttons - * @param {String} type - */ -function createButtonPseudo( type ) { - return function( elem ) { - var name = elem.nodeName.toLowerCase(); - return (name === "input" || name === "button") && elem.type === type; - }; -} - -/** - * Returns a function to use in pseudos for :enabled/:disabled - * @param {Boolean} disabled true for :disabled; false for :enabled - */ -function createDisabledPseudo( disabled ) { - - // Known :disabled false positives: fieldset[disabled] > legend:nth-of-type(n+2) :can-disable - return function( elem ) { - - // Only certain elements can match :enabled or :disabled - // https://html.spec.whatwg.org/multipage/scripting.html#selector-enabled - // https://html.spec.whatwg.org/multipage/scripting.html#selector-disabled - if ( "form" in elem ) { - - // Check for inherited disabledness on relevant non-disabled elements: - // * listed form-associated elements in a disabled fieldset - // https://html.spec.whatwg.org/multipage/forms.html#category-listed - // https://html.spec.whatwg.org/multipage/forms.html#concept-fe-disabled - // * option elements in a disabled optgroup - // https://html.spec.whatwg.org/multipage/forms.html#concept-option-disabled - // All such elements have a "form" property. - if ( elem.parentNode && elem.disabled === false ) { - - // Option elements defer to a parent optgroup if present - if ( "label" in elem ) { - if ( "label" in elem.parentNode ) { - return elem.parentNode.disabled === disabled; - } else { - return elem.disabled === disabled; - } - } - - // Support: IE 6 - 11 - // Use the isDisabled shortcut property to check for disabled fieldset ancestors - return elem.isDisabled === disabled || - - // Where there is no isDisabled, check manually - /* jshint -W018 */ - elem.isDisabled !== !disabled && - disabledAncestor( elem ) === disabled; - } - - return elem.disabled === disabled; - - // Try to winnow out elements that can't be disabled before trusting the disabled property. - // Some victims get caught in our net (label, legend, menu, track), but it shouldn't - // even exist on them, let alone have a boolean value. - } else if ( "label" in elem ) { - return elem.disabled === disabled; - } - - // Remaining elements are neither :enabled nor :disabled - return false; - }; -} - -/** - * Returns a function to use in pseudos for positionals - * @param {Function} fn - */ -function createPositionalPseudo( fn ) { - return markFunction(function( argument ) { - argument = +argument; - return markFunction(function( seed, matches ) { - var j, - matchIndexes = fn( [], seed.length, argument ), - i = matchIndexes.length; - - // Match elements found at the specified indexes - while ( i-- ) { - if ( seed[ (j = matchIndexes[i]) ] ) { - seed[j] = !(matches[j] = seed[j]); - } - } - }); - }); -} - -/** - * Checks a node for validity as a Sizzle context - * @param {Element|Object=} context - * @returns {Element|Object|Boolean} The input node if acceptable, otherwise a falsy value - */ -function testContext( context ) { - return context && typeof context.getElementsByTagName !== "undefined" && context; -} - -// Expose support vars for convenience -support = Sizzle.support = {}; - -/** - * Detects XML nodes - * @param {Element|Object} elem An element or a document - * @returns {Boolean} True iff elem is a non-HTML XML node - */ -isXML = Sizzle.isXML = function( elem ) { - // documentElement is verified for cases where it doesn't yet exist - // (such as loading iframes in IE - #4833) - var documentElement = elem && (elem.ownerDocument || elem).documentElement; - return documentElement ? documentElement.nodeName !== "HTML" : false; -}; - -/** - * Sets document-related variables once based on the current document - * @param {Element|Object} [doc] An element or document object to use to set the document - * @returns {Object} Returns the current document - */ -setDocument = Sizzle.setDocument = function( node ) { - var hasCompare, subWindow, - doc = node ? node.ownerDocument || node : preferredDoc; - - // Return early if doc is invalid or already selected - if ( doc === document || doc.nodeType !== 9 || !doc.documentElement ) { - return document; - } - - // Update global variables - document = doc; - docElem = document.documentElement; - documentIsHTML = !isXML( document ); - - // Support: IE 9-11, Edge - // Accessing iframe documents after unload throws "permission denied" errors (jQuery #13936) - if ( preferredDoc !== document && - (subWindow = document.defaultView) && subWindow.top !== subWindow ) { - - // Support: IE 11, Edge - if ( subWindow.addEventListener ) { - subWindow.addEventListener( "unload", unloadHandler, false ); - - // Support: IE 9 - 10 only - } else if ( subWindow.attachEvent ) { - subWindow.attachEvent( "onunload", unloadHandler ); - } - } - - /* Attributes - ---------------------------------------------------------------------- */ - - // Support: IE<8 - // Verify that getAttribute really returns attributes and not properties - // (excepting IE8 booleans) - support.attributes = assert(function( el ) { - el.className = "i"; - return !el.getAttribute("className"); - }); - - /* getElement(s)By* - ---------------------------------------------------------------------- */ - - // Check if getElementsByTagName("*") returns only elements - support.getElementsByTagName = assert(function( el ) { - el.appendChild( document.createComment("") ); - return !el.getElementsByTagName("*").length; - }); - - // Support: IE<9 - support.getElementsByClassName = rnative.test( document.getElementsByClassName ); - - // Support: IE<10 - // Check if getElementById returns elements by name - // The broken getElementById methods don't pick up programmatically-set names, - // so use a roundabout getElementsByName test - support.getById = assert(function( el ) { - docElem.appendChild( el ).id = expando; - return !document.getElementsByName || !document.getElementsByName( expando ).length; - }); - - // ID filter and find - if ( support.getById ) { - Expr.filter["ID"] = function( id ) { - var attrId = id.replace( runescape, funescape ); - return function( elem ) { - return elem.getAttribute("id") === attrId; - }; - }; - Expr.find["ID"] = function( id, context ) { - if ( typeof context.getElementById !== "undefined" && documentIsHTML ) { - var elem = context.getElementById( id ); - return elem ? [ elem ] : []; - } - }; - } else { - Expr.filter["ID"] = function( id ) { - var attrId = id.replace( runescape, funescape ); - return function( elem ) { - var node = typeof elem.getAttributeNode !== "undefined" && - elem.getAttributeNode("id"); - return node && node.value === attrId; - }; - }; - - // Support: IE 6 - 7 only - // getElementById is not reliable as a find shortcut - Expr.find["ID"] = function( id, context ) { - if ( typeof context.getElementById !== "undefined" && documentIsHTML ) { - var node, i, elems, - elem = context.getElementById( id ); - - if ( elem ) { - - // Verify the id attribute - node = elem.getAttributeNode("id"); - if ( node && node.value === id ) { - return [ elem ]; - } - - // Fall back on getElementsByName - elems = context.getElementsByName( id ); - i = 0; - while ( (elem = elems[i++]) ) { - node = elem.getAttributeNode("id"); - if ( node && node.value === id ) { - return [ elem ]; - } - } - } - - return []; - } - }; - } - - // Tag - Expr.find["TAG"] = support.getElementsByTagName ? - function( tag, context ) { - if ( typeof context.getElementsByTagName !== "undefined" ) { - return context.getElementsByTagName( tag ); - - // DocumentFragment nodes don't have gEBTN - } else if ( support.qsa ) { - return context.querySelectorAll( tag ); - } - } : - - function( tag, context ) { - var elem, - tmp = [], - i = 0, - // By happy coincidence, a (broken) gEBTN appears on DocumentFragment nodes too - results = context.getElementsByTagName( tag ); - - // Filter out possible comments - if ( tag === "*" ) { - while ( (elem = results[i++]) ) { - if ( elem.nodeType === 1 ) { - tmp.push( elem ); - } - } - - return tmp; - } - return results; - }; - - // Class - Expr.find["CLASS"] = support.getElementsByClassName && function( className, context ) { - if ( typeof context.getElementsByClassName !== "undefined" && documentIsHTML ) { - return context.getElementsByClassName( className ); - } - }; - - /* QSA/matchesSelector - ---------------------------------------------------------------------- */ - - // QSA and matchesSelector support - - // matchesSelector(:active) reports false when true (IE9/Opera 11.5) - rbuggyMatches = []; - - // qSa(:focus) reports false when true (Chrome 21) - // We allow this because of a bug in IE8/9 that throws an error - // whenever `document.activeElement` is accessed on an iframe - // So, we allow :focus to pass through QSA all the time to avoid the IE error - // See https://bugs.jquery.com/ticket/13378 - rbuggyQSA = []; - - if ( (support.qsa = rnative.test( document.querySelectorAll )) ) { - // Build QSA regex - // Regex strategy adopted from Diego Perini - assert(function( el ) { - // Select is set to empty string on purpose - // This is to test IE's treatment of not explicitly - // setting a boolean content attribute, - // since its presence should be enough - // https://bugs.jquery.com/ticket/12359 - docElem.appendChild( el ).innerHTML = "" + - ""; - - // Support: IE8, Opera 11-12.16 - // Nothing should be selected when empty strings follow ^= or $= or *= - // The test attribute must be unknown in Opera but "safe" for WinRT - // https://msdn.microsoft.com/en-us/library/ie/hh465388.aspx#attribute_section - if ( el.querySelectorAll("[msallowcapture^='']").length ) { - rbuggyQSA.push( "[*^$]=" + whitespace + "*(?:''|\"\")" ); - } - - // Support: IE8 - // Boolean attributes and "value" are not treated correctly - if ( !el.querySelectorAll("[selected]").length ) { - rbuggyQSA.push( "\\[" + whitespace + "*(?:value|" + booleans + ")" ); - } - - // Support: Chrome<29, Android<4.4, Safari<7.0+, iOS<7.0+, PhantomJS<1.9.8+ - if ( !el.querySelectorAll( "[id~=" + expando + "-]" ).length ) { - rbuggyQSA.push("~="); - } - - // Webkit/Opera - :checked should return selected option elements - // http://www.w3.org/TR/2011/REC-css3-selectors-20110929/#checked - // IE8 throws error here and will not see later tests - if ( !el.querySelectorAll(":checked").length ) { - rbuggyQSA.push(":checked"); - } - - // Support: Safari 8+, iOS 8+ - // https://bugs.webkit.org/show_bug.cgi?id=136851 - // In-page `selector#id sibling-combinator selector` fails - if ( !el.querySelectorAll( "a#" + expando + "+*" ).length ) { - rbuggyQSA.push(".#.+[+~]"); - } - }); - - assert(function( el ) { - el.innerHTML = "" + - ""; - - // Support: Windows 8 Native Apps - // The type and name attributes are restricted during .innerHTML assignment - var input = document.createElement("input"); - input.setAttribute( "type", "hidden" ); - el.appendChild( input ).setAttribute( "name", "D" ); - - // Support: IE8 - // Enforce case-sensitivity of name attribute - if ( el.querySelectorAll("[name=d]").length ) { - rbuggyQSA.push( "name" + whitespace + "*[*^$|!~]?=" ); - } - - // FF 3.5 - :enabled/:disabled and hidden elements (hidden elements are still enabled) - // IE8 throws error here and will not see later tests - if ( el.querySelectorAll(":enabled").length !== 2 ) { - rbuggyQSA.push( ":enabled", ":disabled" ); - } - - // Support: IE9-11+ - // IE's :disabled selector does not pick up the children of disabled fieldsets - docElem.appendChild( el ).disabled = true; - if ( el.querySelectorAll(":disabled").length !== 2 ) { - rbuggyQSA.push( ":enabled", ":disabled" ); - } - - // Opera 10-11 does not throw on post-comma invalid pseudos - el.querySelectorAll("*,:x"); - rbuggyQSA.push(",.*:"); - }); - } - - if ( (support.matchesSelector = rnative.test( (matches = docElem.matches || - docElem.webkitMatchesSelector || - docElem.mozMatchesSelector || - docElem.oMatchesSelector || - docElem.msMatchesSelector) )) ) { - - assert(function( el ) { - // Check to see if it's possible to do matchesSelector - // on a disconnected node (IE 9) - support.disconnectedMatch = matches.call( el, "*" ); - - // This should fail with an exception - // Gecko does not error, returns false instead - matches.call( el, "[s!='']:x" ); - rbuggyMatches.push( "!=", pseudos ); - }); - } - - rbuggyQSA = rbuggyQSA.length && new RegExp( rbuggyQSA.join("|") ); - rbuggyMatches = rbuggyMatches.length && new RegExp( rbuggyMatches.join("|") ); - - /* Contains - ---------------------------------------------------------------------- */ - hasCompare = rnative.test( docElem.compareDocumentPosition ); - - // Element contains another - // Purposefully self-exclusive - // As in, an element does not contain itself - contains = hasCompare || rnative.test( docElem.contains ) ? - function( a, b ) { - var adown = a.nodeType === 9 ? a.documentElement : a, - bup = b && b.parentNode; - return a === bup || !!( bup && bup.nodeType === 1 && ( - adown.contains ? - adown.contains( bup ) : - a.compareDocumentPosition && a.compareDocumentPosition( bup ) & 16 - )); - } : - function( a, b ) { - if ( b ) { - while ( (b = b.parentNode) ) { - if ( b === a ) { - return true; - } - } - } - return false; - }; - - /* Sorting - ---------------------------------------------------------------------- */ - - // Document order sorting - sortOrder = hasCompare ? - function( a, b ) { - - // Flag for duplicate removal - if ( a === b ) { - hasDuplicate = true; - return 0; - } - - // Sort on method existence if only one input has compareDocumentPosition - var compare = !a.compareDocumentPosition - !b.compareDocumentPosition; - if ( compare ) { - return compare; - } - - // Calculate position if both inputs belong to the same document - compare = ( a.ownerDocument || a ) === ( b.ownerDocument || b ) ? - a.compareDocumentPosition( b ) : - - // Otherwise we know they are disconnected - 1; - - // Disconnected nodes - if ( compare & 1 || - (!support.sortDetached && b.compareDocumentPosition( a ) === compare) ) { - - // Choose the first element that is related to our preferred document - if ( a === document || a.ownerDocument === preferredDoc && contains(preferredDoc, a) ) { - return -1; - } - if ( b === document || b.ownerDocument === preferredDoc && contains(preferredDoc, b) ) { - return 1; - } - - // Maintain original order - return sortInput ? - ( indexOf( sortInput, a ) - indexOf( sortInput, b ) ) : - 0; - } - - return compare & 4 ? -1 : 1; - } : - function( a, b ) { - // Exit early if the nodes are identical - if ( a === b ) { - hasDuplicate = true; - return 0; - } - - var cur, - i = 0, - aup = a.parentNode, - bup = b.parentNode, - ap = [ a ], - bp = [ b ]; - - // Parentless nodes are either documents or disconnected - if ( !aup || !bup ) { - return a === document ? -1 : - b === document ? 1 : - aup ? -1 : - bup ? 1 : - sortInput ? - ( indexOf( sortInput, a ) - indexOf( sortInput, b ) ) : - 0; - - // If the nodes are siblings, we can do a quick check - } else if ( aup === bup ) { - return siblingCheck( a, b ); - } - - // Otherwise we need full lists of their ancestors for comparison - cur = a; - while ( (cur = cur.parentNode) ) { - ap.unshift( cur ); - } - cur = b; - while ( (cur = cur.parentNode) ) { - bp.unshift( cur ); - } - - // Walk down the tree looking for a discrepancy - while ( ap[i] === bp[i] ) { - i++; - } - - return i ? - // Do a sibling check if the nodes have a common ancestor - siblingCheck( ap[i], bp[i] ) : - - // Otherwise nodes in our document sort first - ap[i] === preferredDoc ? -1 : - bp[i] === preferredDoc ? 1 : - 0; - }; - - return document; -}; - -Sizzle.matches = function( expr, elements ) { - return Sizzle( expr, null, null, elements ); -}; - -Sizzle.matchesSelector = function( elem, expr ) { - // Set document vars if needed - if ( ( elem.ownerDocument || elem ) !== document ) { - setDocument( elem ); - } - - // Make sure that attribute selectors are quoted - expr = expr.replace( rattributeQuotes, "='$1']" ); - - if ( support.matchesSelector && documentIsHTML && - !compilerCache[ expr + " " ] && - ( !rbuggyMatches || !rbuggyMatches.test( expr ) ) && - ( !rbuggyQSA || !rbuggyQSA.test( expr ) ) ) { - - try { - var ret = matches.call( elem, expr ); - - // IE 9's matchesSelector returns false on disconnected nodes - if ( ret || support.disconnectedMatch || - // As well, disconnected nodes are said to be in a document - // fragment in IE 9 - elem.document && elem.document.nodeType !== 11 ) { - return ret; - } - } catch (e) {} - } - - return Sizzle( expr, document, null, [ elem ] ).length > 0; -}; - -Sizzle.contains = function( context, elem ) { - // Set document vars if needed - if ( ( context.ownerDocument || context ) !== document ) { - setDocument( context ); - } - return contains( context, elem ); -}; - -Sizzle.attr = function( elem, name ) { - // Set document vars if needed - if ( ( elem.ownerDocument || elem ) !== document ) { - setDocument( elem ); - } - - var fn = Expr.attrHandle[ name.toLowerCase() ], - // Don't get fooled by Object.prototype properties (jQuery #13807) - val = fn && hasOwn.call( Expr.attrHandle, name.toLowerCase() ) ? - fn( elem, name, !documentIsHTML ) : - undefined; - - return val !== undefined ? - val : - support.attributes || !documentIsHTML ? - elem.getAttribute( name ) : - (val = elem.getAttributeNode(name)) && val.specified ? - val.value : - null; -}; - -Sizzle.escape = function( sel ) { - return (sel + "").replace( rcssescape, fcssescape ); -}; - -Sizzle.error = function( msg ) { - throw new Error( "Syntax error, unrecognized expression: " + msg ); -}; - -/** - * Document sorting and removing duplicates - * @param {ArrayLike} results - */ -Sizzle.uniqueSort = function( results ) { - var elem, - duplicates = [], - j = 0, - i = 0; - - // Unless we *know* we can detect duplicates, assume their presence - hasDuplicate = !support.detectDuplicates; - sortInput = !support.sortStable && results.slice( 0 ); - results.sort( sortOrder ); - - if ( hasDuplicate ) { - while ( (elem = results[i++]) ) { - if ( elem === results[ i ] ) { - j = duplicates.push( i ); - } - } - while ( j-- ) { - results.splice( duplicates[ j ], 1 ); - } - } - - // Clear input after sorting to release objects - // See https://github.com/jquery/sizzle/pull/225 - sortInput = null; - - return results; -}; - -/** - * Utility function for retrieving the text value of an array of DOM nodes - * @param {Array|Element} elem - */ -getText = Sizzle.getText = function( elem ) { - var node, - ret = "", - i = 0, - nodeType = elem.nodeType; - - if ( !nodeType ) { - // If no nodeType, this is expected to be an array - while ( (node = elem[i++]) ) { - // Do not traverse comment nodes - ret += getText( node ); - } - } else if ( nodeType === 1 || nodeType === 9 || nodeType === 11 ) { - // Use textContent for elements - // innerText usage removed for consistency of new lines (jQuery #11153) - if ( typeof elem.textContent === "string" ) { - return elem.textContent; - } else { - // Traverse its children - for ( elem = elem.firstChild; elem; elem = elem.nextSibling ) { - ret += getText( elem ); - } - } - } else if ( nodeType === 3 || nodeType === 4 ) { - return elem.nodeValue; - } - // Do not include comment or processing instruction nodes - - return ret; -}; - -Expr = Sizzle.selectors = { - - // Can be adjusted by the user - cacheLength: 50, - - createPseudo: markFunction, - - match: matchExpr, - - attrHandle: {}, - - find: {}, - - relative: { - ">": { dir: "parentNode", first: true }, - " ": { dir: "parentNode" }, - "+": { dir: "previousSibling", first: true }, - "~": { dir: "previousSibling" } - }, - - preFilter: { - "ATTR": function( match ) { - match[1] = match[1].replace( runescape, funescape ); - - // Move the given value to match[3] whether quoted or unquoted - match[3] = ( match[3] || match[4] || match[5] || "" ).replace( runescape, funescape ); - - if ( match[2] === "~=" ) { - match[3] = " " + match[3] + " "; - } - - return match.slice( 0, 4 ); - }, - - "CHILD": function( match ) { - /* matches from matchExpr["CHILD"] - 1 type (only|nth|...) - 2 what (child|of-type) - 3 argument (even|odd|\d*|\d*n([+-]\d+)?|...) - 4 xn-component of xn+y argument ([+-]?\d*n|) - 5 sign of xn-component - 6 x of xn-component - 7 sign of y-component - 8 y of y-component - */ - match[1] = match[1].toLowerCase(); - - if ( match[1].slice( 0, 3 ) === "nth" ) { - // nth-* requires argument - if ( !match[3] ) { - Sizzle.error( match[0] ); - } - - // numeric x and y parameters for Expr.filter.CHILD - // remember that false/true cast respectively to 0/1 - match[4] = +( match[4] ? match[5] + (match[6] || 1) : 2 * ( match[3] === "even" || match[3] === "odd" ) ); - match[5] = +( ( match[7] + match[8] ) || match[3] === "odd" ); - - // other types prohibit arguments - } else if ( match[3] ) { - Sizzle.error( match[0] ); - } - - return match; - }, - - "PSEUDO": function( match ) { - var excess, - unquoted = !match[6] && match[2]; - - if ( matchExpr["CHILD"].test( match[0] ) ) { - return null; - } - - // Accept quoted arguments as-is - if ( match[3] ) { - match[2] = match[4] || match[5] || ""; - - // Strip excess characters from unquoted arguments - } else if ( unquoted && rpseudo.test( unquoted ) && - // Get excess from tokenize (recursively) - (excess = tokenize( unquoted, true )) && - // advance to the next closing parenthesis - (excess = unquoted.indexOf( ")", unquoted.length - excess ) - unquoted.length) ) { - - // excess is a negative index - match[0] = match[0].slice( 0, excess ); - match[2] = unquoted.slice( 0, excess ); - } - - // Return only captures needed by the pseudo filter method (type and argument) - return match.slice( 0, 3 ); - } - }, - - filter: { - - "TAG": function( nodeNameSelector ) { - var nodeName = nodeNameSelector.replace( runescape, funescape ).toLowerCase(); - return nodeNameSelector === "*" ? - function() { return true; } : - function( elem ) { - return elem.nodeName && elem.nodeName.toLowerCase() === nodeName; - }; - }, - - "CLASS": function( className ) { - var pattern = classCache[ className + " " ]; - - return pattern || - (pattern = new RegExp( "(^|" + whitespace + ")" + className + "(" + whitespace + "|$)" )) && - classCache( className, function( elem ) { - return pattern.test( typeof elem.className === "string" && elem.className || typeof elem.getAttribute !== "undefined" && elem.getAttribute("class") || "" ); - }); - }, - - "ATTR": function( name, operator, check ) { - return function( elem ) { - var result = Sizzle.attr( elem, name ); - - if ( result == null ) { - return operator === "!="; - } - if ( !operator ) { - return true; - } - - result += ""; - - return operator === "=" ? result === check : - operator === "!=" ? result !== check : - operator === "^=" ? check && result.indexOf( check ) === 0 : - operator === "*=" ? check && result.indexOf( check ) > -1 : - operator === "$=" ? check && result.slice( -check.length ) === check : - operator === "~=" ? ( " " + result.replace( rwhitespace, " " ) + " " ).indexOf( check ) > -1 : - operator === "|=" ? result === check || result.slice( 0, check.length + 1 ) === check + "-" : - false; - }; - }, - - "CHILD": function( type, what, argument, first, last ) { - var simple = type.slice( 0, 3 ) !== "nth", - forward = type.slice( -4 ) !== "last", - ofType = what === "of-type"; - - return first === 1 && last === 0 ? - - // Shortcut for :nth-*(n) - function( elem ) { - return !!elem.parentNode; - } : - - function( elem, context, xml ) { - var cache, uniqueCache, outerCache, node, nodeIndex, start, - dir = simple !== forward ? "nextSibling" : "previousSibling", - parent = elem.parentNode, - name = ofType && elem.nodeName.toLowerCase(), - useCache = !xml && !ofType, - diff = false; - - if ( parent ) { - - // :(first|last|only)-(child|of-type) - if ( simple ) { - while ( dir ) { - node = elem; - while ( (node = node[ dir ]) ) { - if ( ofType ? - node.nodeName.toLowerCase() === name : - node.nodeType === 1 ) { - - return false; - } - } - // Reverse direction for :only-* (if we haven't yet done so) - start = dir = type === "only" && !start && "nextSibling"; - } - return true; - } - - start = [ forward ? parent.firstChild : parent.lastChild ]; - - // non-xml :nth-child(...) stores cache data on `parent` - if ( forward && useCache ) { - - // Seek `elem` from a previously-cached index - - // ...in a gzip-friendly way - node = parent; - outerCache = node[ expando ] || (node[ expando ] = {}); - - // Support: IE <9 only - // Defend against cloned attroperties (jQuery gh-1709) - uniqueCache = outerCache[ node.uniqueID ] || - (outerCache[ node.uniqueID ] = {}); - - cache = uniqueCache[ type ] || []; - nodeIndex = cache[ 0 ] === dirruns && cache[ 1 ]; - diff = nodeIndex && cache[ 2 ]; - node = nodeIndex && parent.childNodes[ nodeIndex ]; - - while ( (node = ++nodeIndex && node && node[ dir ] || - - // Fallback to seeking `elem` from the start - (diff = nodeIndex = 0) || start.pop()) ) { - - // When found, cache indexes on `parent` and break - if ( node.nodeType === 1 && ++diff && node === elem ) { - uniqueCache[ type ] = [ dirruns, nodeIndex, diff ]; - break; - } - } - - } else { - // Use previously-cached element index if available - if ( useCache ) { - // ...in a gzip-friendly way - node = elem; - outerCache = node[ expando ] || (node[ expando ] = {}); - - // Support: IE <9 only - // Defend against cloned attroperties (jQuery gh-1709) - uniqueCache = outerCache[ node.uniqueID ] || - (outerCache[ node.uniqueID ] = {}); - - cache = uniqueCache[ type ] || []; - nodeIndex = cache[ 0 ] === dirruns && cache[ 1 ]; - diff = nodeIndex; - } - - // xml :nth-child(...) - // or :nth-last-child(...) or :nth(-last)?-of-type(...) - if ( diff === false ) { - // Use the same loop as above to seek `elem` from the start - while ( (node = ++nodeIndex && node && node[ dir ] || - (diff = nodeIndex = 0) || start.pop()) ) { - - if ( ( ofType ? - node.nodeName.toLowerCase() === name : - node.nodeType === 1 ) && - ++diff ) { - - // Cache the index of each encountered element - if ( useCache ) { - outerCache = node[ expando ] || (node[ expando ] = {}); - - // Support: IE <9 only - // Defend against cloned attroperties (jQuery gh-1709) - uniqueCache = outerCache[ node.uniqueID ] || - (outerCache[ node.uniqueID ] = {}); - - uniqueCache[ type ] = [ dirruns, diff ]; - } - - if ( node === elem ) { - break; - } - } - } - } - } - - // Incorporate the offset, then check against cycle size - diff -= last; - return diff === first || ( diff % first === 0 && diff / first >= 0 ); - } - }; - }, - - "PSEUDO": function( pseudo, argument ) { - // pseudo-class names are case-insensitive - // http://www.w3.org/TR/selectors/#pseudo-classes - // Prioritize by case sensitivity in case custom pseudos are added with uppercase letters - // Remember that setFilters inherits from pseudos - var args, - fn = Expr.pseudos[ pseudo ] || Expr.setFilters[ pseudo.toLowerCase() ] || - Sizzle.error( "unsupported pseudo: " + pseudo ); - - // The user may use createPseudo to indicate that - // arguments are needed to create the filter function - // just as Sizzle does - if ( fn[ expando ] ) { - return fn( argument ); - } - - // But maintain support for old signatures - if ( fn.length > 1 ) { - args = [ pseudo, pseudo, "", argument ]; - return Expr.setFilters.hasOwnProperty( pseudo.toLowerCase() ) ? - markFunction(function( seed, matches ) { - var idx, - matched = fn( seed, argument ), - i = matched.length; - while ( i-- ) { - idx = indexOf( seed, matched[i] ); - seed[ idx ] = !( matches[ idx ] = matched[i] ); - } - }) : - function( elem ) { - return fn( elem, 0, args ); - }; - } - - return fn; - } - }, - - pseudos: { - // Potentially complex pseudos - "not": markFunction(function( selector ) { - // Trim the selector passed to compile - // to avoid treating leading and trailing - // spaces as combinators - var input = [], - results = [], - matcher = compile( selector.replace( rtrim, "$1" ) ); - - return matcher[ expando ] ? - markFunction(function( seed, matches, context, xml ) { - var elem, - unmatched = matcher( seed, null, xml, [] ), - i = seed.length; - - // Match elements unmatched by `matcher` - while ( i-- ) { - if ( (elem = unmatched[i]) ) { - seed[i] = !(matches[i] = elem); - } - } - }) : - function( elem, context, xml ) { - input[0] = elem; - matcher( input, null, xml, results ); - // Don't keep the element (issue #299) - input[0] = null; - return !results.pop(); - }; - }), - - "has": markFunction(function( selector ) { - return function( elem ) { - return Sizzle( selector, elem ).length > 0; - }; - }), - - "contains": markFunction(function( text ) { - text = text.replace( runescape, funescape ); - return function( elem ) { - return ( elem.textContent || elem.innerText || getText( elem ) ).indexOf( text ) > -1; - }; - }), - - // "Whether an element is represented by a :lang() selector - // is based solely on the element's language value - // being equal to the identifier C, - // or beginning with the identifier C immediately followed by "-". - // The matching of C against the element's language value is performed case-insensitively. - // The identifier C does not have to be a valid language name." - // http://www.w3.org/TR/selectors/#lang-pseudo - "lang": markFunction( function( lang ) { - // lang value must be a valid identifier - if ( !ridentifier.test(lang || "") ) { - Sizzle.error( "unsupported lang: " + lang ); - } - lang = lang.replace( runescape, funescape ).toLowerCase(); - return function( elem ) { - var elemLang; - do { - if ( (elemLang = documentIsHTML ? - elem.lang : - elem.getAttribute("xml:lang") || elem.getAttribute("lang")) ) { - - elemLang = elemLang.toLowerCase(); - return elemLang === lang || elemLang.indexOf( lang + "-" ) === 0; - } - } while ( (elem = elem.parentNode) && elem.nodeType === 1 ); - return false; - }; - }), - - // Miscellaneous - "target": function( elem ) { - var hash = window.location && window.location.hash; - return hash && hash.slice( 1 ) === elem.id; - }, - - "root": function( elem ) { - return elem === docElem; - }, - - "focus": function( elem ) { - return elem === document.activeElement && (!document.hasFocus || document.hasFocus()) && !!(elem.type || elem.href || ~elem.tabIndex); - }, - - // Boolean properties - "enabled": createDisabledPseudo( false ), - "disabled": createDisabledPseudo( true ), - - "checked": function( elem ) { - // In CSS3, :checked should return both checked and selected elements - // http://www.w3.org/TR/2011/REC-css3-selectors-20110929/#checked - var nodeName = elem.nodeName.toLowerCase(); - return (nodeName === "input" && !!elem.checked) || (nodeName === "option" && !!elem.selected); - }, - - "selected": function( elem ) { - // Accessing this property makes selected-by-default - // options in Safari work properly - if ( elem.parentNode ) { - elem.parentNode.selectedIndex; - } - - return elem.selected === true; - }, - - // Contents - "empty": function( elem ) { - // http://www.w3.org/TR/selectors/#empty-pseudo - // :empty is negated by element (1) or content nodes (text: 3; cdata: 4; entity ref: 5), - // but not by others (comment: 8; processing instruction: 7; etc.) - // nodeType < 6 works because attributes (2) do not appear as children - for ( elem = elem.firstChild; elem; elem = elem.nextSibling ) { - if ( elem.nodeType < 6 ) { - return false; - } - } - return true; - }, - - "parent": function( elem ) { - return !Expr.pseudos["empty"]( elem ); - }, - - // Element/input types - "header": function( elem ) { - return rheader.test( elem.nodeName ); - }, - - "input": function( elem ) { - return rinputs.test( elem.nodeName ); - }, - - "button": function( elem ) { - var name = elem.nodeName.toLowerCase(); - return name === "input" && elem.type === "button" || name === "button"; - }, - - "text": function( elem ) { - var attr; - return elem.nodeName.toLowerCase() === "input" && - elem.type === "text" && - - // Support: IE<8 - // New HTML5 attribute values (e.g., "search") appear with elem.type === "text" - ( (attr = elem.getAttribute("type")) == null || attr.toLowerCase() === "text" ); - }, - - // Position-in-collection - "first": createPositionalPseudo(function() { - return [ 0 ]; - }), - - "last": createPositionalPseudo(function( matchIndexes, length ) { - return [ length - 1 ]; - }), - - "eq": createPositionalPseudo(function( matchIndexes, length, argument ) { - return [ argument < 0 ? argument + length : argument ]; - }), - - "even": createPositionalPseudo(function( matchIndexes, length ) { - var i = 0; - for ( ; i < length; i += 2 ) { - matchIndexes.push( i ); - } - return matchIndexes; - }), - - "odd": createPositionalPseudo(function( matchIndexes, length ) { - var i = 1; - for ( ; i < length; i += 2 ) { - matchIndexes.push( i ); - } - return matchIndexes; - }), - - "lt": createPositionalPseudo(function( matchIndexes, length, argument ) { - var i = argument < 0 ? argument + length : argument; - for ( ; --i >= 0; ) { - matchIndexes.push( i ); - } - return matchIndexes; - }), - - "gt": createPositionalPseudo(function( matchIndexes, length, argument ) { - var i = argument < 0 ? argument + length : argument; - for ( ; ++i < length; ) { - matchIndexes.push( i ); - } - return matchIndexes; - }) - } -}; - -Expr.pseudos["nth"] = Expr.pseudos["eq"]; - -// Add button/input type pseudos -for ( i in { radio: true, checkbox: true, file: true, password: true, image: true } ) { - Expr.pseudos[ i ] = createInputPseudo( i ); -} -for ( i in { submit: true, reset: true } ) { - Expr.pseudos[ i ] = createButtonPseudo( i ); -} - -// Easy API for creating new setFilters -function setFilters() {} -setFilters.prototype = Expr.filters = Expr.pseudos; -Expr.setFilters = new setFilters(); - -tokenize = Sizzle.tokenize = function( selector, parseOnly ) { - var matched, match, tokens, type, - soFar, groups, preFilters, - cached = tokenCache[ selector + " " ]; - - if ( cached ) { - return parseOnly ? 0 : cached.slice( 0 ); - } - - soFar = selector; - groups = []; - preFilters = Expr.preFilter; - - while ( soFar ) { - - // Comma and first run - if ( !matched || (match = rcomma.exec( soFar )) ) { - if ( match ) { - // Don't consume trailing commas as valid - soFar = soFar.slice( match[0].length ) || soFar; - } - groups.push( (tokens = []) ); - } - - matched = false; - - // Combinators - if ( (match = rcombinators.exec( soFar )) ) { - matched = match.shift(); - tokens.push({ - value: matched, - // Cast descendant combinators to space - type: match[0].replace( rtrim, " " ) - }); - soFar = soFar.slice( matched.length ); - } - - // Filters - for ( type in Expr.filter ) { - if ( (match = matchExpr[ type ].exec( soFar )) && (!preFilters[ type ] || - (match = preFilters[ type ]( match ))) ) { - matched = match.shift(); - tokens.push({ - value: matched, - type: type, - matches: match - }); - soFar = soFar.slice( matched.length ); - } - } - - if ( !matched ) { - break; - } - } - - // Return the length of the invalid excess - // if we're just parsing - // Otherwise, throw an error or return tokens - return parseOnly ? - soFar.length : - soFar ? - Sizzle.error( selector ) : - // Cache the tokens - tokenCache( selector, groups ).slice( 0 ); -}; - -function toSelector( tokens ) { - var i = 0, - len = tokens.length, - selector = ""; - for ( ; i < len; i++ ) { - selector += tokens[i].value; - } - return selector; -} - -function addCombinator( matcher, combinator, base ) { - var dir = combinator.dir, - skip = combinator.next, - key = skip || dir, - checkNonElements = base && key === "parentNode", - doneName = done++; - - return combinator.first ? - // Check against closest ancestor/preceding element - function( elem, context, xml ) { - while ( (elem = elem[ dir ]) ) { - if ( elem.nodeType === 1 || checkNonElements ) { - return matcher( elem, context, xml ); - } - } - return false; - } : - - // Check against all ancestor/preceding elements - function( elem, context, xml ) { - var oldCache, uniqueCache, outerCache, - newCache = [ dirruns, doneName ]; - - // We can't set arbitrary data on XML nodes, so they don't benefit from combinator caching - if ( xml ) { - while ( (elem = elem[ dir ]) ) { - if ( elem.nodeType === 1 || checkNonElements ) { - if ( matcher( elem, context, xml ) ) { - return true; - } - } - } - } else { - while ( (elem = elem[ dir ]) ) { - if ( elem.nodeType === 1 || checkNonElements ) { - outerCache = elem[ expando ] || (elem[ expando ] = {}); - - // Support: IE <9 only - // Defend against cloned attroperties (jQuery gh-1709) - uniqueCache = outerCache[ elem.uniqueID ] || (outerCache[ elem.uniqueID ] = {}); - - if ( skip && skip === elem.nodeName.toLowerCase() ) { - elem = elem[ dir ] || elem; - } else if ( (oldCache = uniqueCache[ key ]) && - oldCache[ 0 ] === dirruns && oldCache[ 1 ] === doneName ) { - - // Assign to newCache so results back-propagate to previous elements - return (newCache[ 2 ] = oldCache[ 2 ]); - } else { - // Reuse newcache so results back-propagate to previous elements - uniqueCache[ key ] = newCache; - - // A match means we're done; a fail means we have to keep checking - if ( (newCache[ 2 ] = matcher( elem, context, xml )) ) { - return true; - } - } - } - } - } - return false; - }; -} - -function elementMatcher( matchers ) { - return matchers.length > 1 ? - function( elem, context, xml ) { - var i = matchers.length; - while ( i-- ) { - if ( !matchers[i]( elem, context, xml ) ) { - return false; - } - } - return true; - } : - matchers[0]; -} - -function multipleContexts( selector, contexts, results ) { - var i = 0, - len = contexts.length; - for ( ; i < len; i++ ) { - Sizzle( selector, contexts[i], results ); - } - return results; -} - -function condense( unmatched, map, filter, context, xml ) { - var elem, - newUnmatched = [], - i = 0, - len = unmatched.length, - mapped = map != null; - - for ( ; i < len; i++ ) { - if ( (elem = unmatched[i]) ) { - if ( !filter || filter( elem, context, xml ) ) { - newUnmatched.push( elem ); - if ( mapped ) { - map.push( i ); - } - } - } - } - - return newUnmatched; -} - -function setMatcher( preFilter, selector, matcher, postFilter, postFinder, postSelector ) { - if ( postFilter && !postFilter[ expando ] ) { - postFilter = setMatcher( postFilter ); - } - if ( postFinder && !postFinder[ expando ] ) { - postFinder = setMatcher( postFinder, postSelector ); - } - return markFunction(function( seed, results, context, xml ) { - var temp, i, elem, - preMap = [], - postMap = [], - preexisting = results.length, - - // Get initial elements from seed or context - elems = seed || multipleContexts( selector || "*", context.nodeType ? [ context ] : context, [] ), - - // Prefilter to get matcher input, preserving a map for seed-results synchronization - matcherIn = preFilter && ( seed || !selector ) ? - condense( elems, preMap, preFilter, context, xml ) : - elems, - - matcherOut = matcher ? - // If we have a postFinder, or filtered seed, or non-seed postFilter or preexisting results, - postFinder || ( seed ? preFilter : preexisting || postFilter ) ? - - // ...intermediate processing is necessary - [] : - - // ...otherwise use results directly - results : - matcherIn; - - // Find primary matches - if ( matcher ) { - matcher( matcherIn, matcherOut, context, xml ); - } - - // Apply postFilter - if ( postFilter ) { - temp = condense( matcherOut, postMap ); - postFilter( temp, [], context, xml ); - - // Un-match failing elements by moving them back to matcherIn - i = temp.length; - while ( i-- ) { - if ( (elem = temp[i]) ) { - matcherOut[ postMap[i] ] = !(matcherIn[ postMap[i] ] = elem); - } - } - } - - if ( seed ) { - if ( postFinder || preFilter ) { - if ( postFinder ) { - // Get the final matcherOut by condensing this intermediate into postFinder contexts - temp = []; - i = matcherOut.length; - while ( i-- ) { - if ( (elem = matcherOut[i]) ) { - // Restore matcherIn since elem is not yet a final match - temp.push( (matcherIn[i] = elem) ); - } - } - postFinder( null, (matcherOut = []), temp, xml ); - } - - // Move matched elements from seed to results to keep them synchronized - i = matcherOut.length; - while ( i-- ) { - if ( (elem = matcherOut[i]) && - (temp = postFinder ? indexOf( seed, elem ) : preMap[i]) > -1 ) { - - seed[temp] = !(results[temp] = elem); - } - } - } - - // Add elements to results, through postFinder if defined - } else { - matcherOut = condense( - matcherOut === results ? - matcherOut.splice( preexisting, matcherOut.length ) : - matcherOut - ); - if ( postFinder ) { - postFinder( null, results, matcherOut, xml ); - } else { - push.apply( results, matcherOut ); - } - } - }); -} - -function matcherFromTokens( tokens ) { - var checkContext, matcher, j, - len = tokens.length, - leadingRelative = Expr.relative[ tokens[0].type ], - implicitRelative = leadingRelative || Expr.relative[" "], - i = leadingRelative ? 1 : 0, - - // The foundational matcher ensures that elements are reachable from top-level context(s) - matchContext = addCombinator( function( elem ) { - return elem === checkContext; - }, implicitRelative, true ), - matchAnyContext = addCombinator( function( elem ) { - return indexOf( checkContext, elem ) > -1; - }, implicitRelative, true ), - matchers = [ function( elem, context, xml ) { - var ret = ( !leadingRelative && ( xml || context !== outermostContext ) ) || ( - (checkContext = context).nodeType ? - matchContext( elem, context, xml ) : - matchAnyContext( elem, context, xml ) ); - // Avoid hanging onto element (issue #299) - checkContext = null; - return ret; - } ]; - - for ( ; i < len; i++ ) { - if ( (matcher = Expr.relative[ tokens[i].type ]) ) { - matchers = [ addCombinator(elementMatcher( matchers ), matcher) ]; - } else { - matcher = Expr.filter[ tokens[i].type ].apply( null, tokens[i].matches ); - - // Return special upon seeing a positional matcher - if ( matcher[ expando ] ) { - // Find the next relative operator (if any) for proper handling - j = ++i; - for ( ; j < len; j++ ) { - if ( Expr.relative[ tokens[j].type ] ) { - break; - } - } - return setMatcher( - i > 1 && elementMatcher( matchers ), - i > 1 && toSelector( - // If the preceding token was a descendant combinator, insert an implicit any-element `*` - tokens.slice( 0, i - 1 ).concat({ value: tokens[ i - 2 ].type === " " ? "*" : "" }) - ).replace( rtrim, "$1" ), - matcher, - i < j && matcherFromTokens( tokens.slice( i, j ) ), - j < len && matcherFromTokens( (tokens = tokens.slice( j )) ), - j < len && toSelector( tokens ) - ); - } - matchers.push( matcher ); - } - } - - return elementMatcher( matchers ); -} - -function matcherFromGroupMatchers( elementMatchers, setMatchers ) { - var bySet = setMatchers.length > 0, - byElement = elementMatchers.length > 0, - superMatcher = function( seed, context, xml, results, outermost ) { - var elem, j, matcher, - matchedCount = 0, - i = "0", - unmatched = seed && [], - setMatched = [], - contextBackup = outermostContext, - // We must always have either seed elements or outermost context - elems = seed || byElement && Expr.find["TAG"]( "*", outermost ), - // Use integer dirruns iff this is the outermost matcher - dirrunsUnique = (dirruns += contextBackup == null ? 1 : Math.random() || 0.1), - len = elems.length; - - if ( outermost ) { - outermostContext = context === document || context || outermost; - } - - // Add elements passing elementMatchers directly to results - // Support: IE<9, Safari - // Tolerate NodeList properties (IE: "length"; Safari: ) matching elements by id - for ( ; i !== len && (elem = elems[i]) != null; i++ ) { - if ( byElement && elem ) { - j = 0; - if ( !context && elem.ownerDocument !== document ) { - setDocument( elem ); - xml = !documentIsHTML; - } - while ( (matcher = elementMatchers[j++]) ) { - if ( matcher( elem, context || document, xml) ) { - results.push( elem ); - break; - } - } - if ( outermost ) { - dirruns = dirrunsUnique; - } - } - - // Track unmatched elements for set filters - if ( bySet ) { - // They will have gone through all possible matchers - if ( (elem = !matcher && elem) ) { - matchedCount--; - } - - // Lengthen the array for every element, matched or not - if ( seed ) { - unmatched.push( elem ); - } - } - } - - // `i` is now the count of elements visited above, and adding it to `matchedCount` - // makes the latter nonnegative. - matchedCount += i; - - // Apply set filters to unmatched elements - // NOTE: This can be skipped if there are no unmatched elements (i.e., `matchedCount` - // equals `i`), unless we didn't visit _any_ elements in the above loop because we have - // no element matchers and no seed. - // Incrementing an initially-string "0" `i` allows `i` to remain a string only in that - // case, which will result in a "00" `matchedCount` that differs from `i` but is also - // numerically zero. - if ( bySet && i !== matchedCount ) { - j = 0; - while ( (matcher = setMatchers[j++]) ) { - matcher( unmatched, setMatched, context, xml ); - } - - if ( seed ) { - // Reintegrate element matches to eliminate the need for sorting - if ( matchedCount > 0 ) { - while ( i-- ) { - if ( !(unmatched[i] || setMatched[i]) ) { - setMatched[i] = pop.call( results ); - } - } - } - - // Discard index placeholder values to get only actual matches - setMatched = condense( setMatched ); - } - - // Add matches to results - push.apply( results, setMatched ); - - // Seedless set matches succeeding multiple successful matchers stipulate sorting - if ( outermost && !seed && setMatched.length > 0 && - ( matchedCount + setMatchers.length ) > 1 ) { - - Sizzle.uniqueSort( results ); - } - } - - // Override manipulation of globals by nested matchers - if ( outermost ) { - dirruns = dirrunsUnique; - outermostContext = contextBackup; - } - - return unmatched; - }; - - return bySet ? - markFunction( superMatcher ) : - superMatcher; -} - -compile = Sizzle.compile = function( selector, match /* Internal Use Only */ ) { - var i, - setMatchers = [], - elementMatchers = [], - cached = compilerCache[ selector + " " ]; - - if ( !cached ) { - // Generate a function of recursive functions that can be used to check each element - if ( !match ) { - match = tokenize( selector ); - } - i = match.length; - while ( i-- ) { - cached = matcherFromTokens( match[i] ); - if ( cached[ expando ] ) { - setMatchers.push( cached ); - } else { - elementMatchers.push( cached ); - } - } - - // Cache the compiled function - cached = compilerCache( selector, matcherFromGroupMatchers( elementMatchers, setMatchers ) ); - - // Save selector and tokenization - cached.selector = selector; - } - return cached; -}; - -/** - * A low-level selection function that works with Sizzle's compiled - * selector functions - * @param {String|Function} selector A selector or a pre-compiled - * selector function built with Sizzle.compile - * @param {Element} context - * @param {Array} [results] - * @param {Array} [seed] A set of elements to match against - */ -select = Sizzle.select = function( selector, context, results, seed ) { - var i, tokens, token, type, find, - compiled = typeof selector === "function" && selector, - match = !seed && tokenize( (selector = compiled.selector || selector) ); - - results = results || []; - - // Try to minimize operations if there is only one selector in the list and no seed - // (the latter of which guarantees us context) - if ( match.length === 1 ) { - - // Reduce context if the leading compound selector is an ID - tokens = match[0] = match[0].slice( 0 ); - if ( tokens.length > 2 && (token = tokens[0]).type === "ID" && - context.nodeType === 9 && documentIsHTML && Expr.relative[ tokens[1].type ] ) { - - context = ( Expr.find["ID"]( token.matches[0].replace(runescape, funescape), context ) || [] )[0]; - if ( !context ) { - return results; - - // Precompiled matchers will still verify ancestry, so step up a level - } else if ( compiled ) { - context = context.parentNode; - } - - selector = selector.slice( tokens.shift().value.length ); - } - - // Fetch a seed set for right-to-left matching - i = matchExpr["needsContext"].test( selector ) ? 0 : tokens.length; - while ( i-- ) { - token = tokens[i]; - - // Abort if we hit a combinator - if ( Expr.relative[ (type = token.type) ] ) { - break; - } - if ( (find = Expr.find[ type ]) ) { - // Search, expanding context for leading sibling combinators - if ( (seed = find( - token.matches[0].replace( runescape, funescape ), - rsibling.test( tokens[0].type ) && testContext( context.parentNode ) || context - )) ) { - - // If seed is empty or no tokens remain, we can return early - tokens.splice( i, 1 ); - selector = seed.length && toSelector( tokens ); - if ( !selector ) { - push.apply( results, seed ); - return results; - } - - break; - } - } - } - } - - // Compile and execute a filtering function if one is not provided - // Provide `match` to avoid retokenization if we modified the selector above - ( compiled || compile( selector, match ) )( - seed, - context, - !documentIsHTML, - results, - !context || rsibling.test( selector ) && testContext( context.parentNode ) || context - ); - return results; -}; - -// One-time assignments - -// Sort stability -support.sortStable = expando.split("").sort( sortOrder ).join("") === expando; - -// Support: Chrome 14-35+ -// Always assume duplicates if they aren't passed to the comparison function -support.detectDuplicates = !!hasDuplicate; - -// Initialize against the default document -setDocument(); - -// Support: Webkit<537.32 - Safari 6.0.3/Chrome 25 (fixed in Chrome 27) -// Detached nodes confoundingly follow *each other* -support.sortDetached = assert(function( el ) { - // Should return 1, but returns 4 (following) - return el.compareDocumentPosition( document.createElement("fieldset") ) & 1; -}); - -// Support: IE<8 -// Prevent attribute/property "interpolation" -// https://msdn.microsoft.com/en-us/library/ms536429%28VS.85%29.aspx -if ( !assert(function( el ) { - el.innerHTML = ""; - return el.firstChild.getAttribute("href") === "#" ; -}) ) { - addHandle( "type|href|height|width", function( elem, name, isXML ) { - if ( !isXML ) { - return elem.getAttribute( name, name.toLowerCase() === "type" ? 1 : 2 ); - } - }); -} - -// Support: IE<9 -// Use defaultValue in place of getAttribute("value") -if ( !support.attributes || !assert(function( el ) { - el.innerHTML = ""; - el.firstChild.setAttribute( "value", "" ); - return el.firstChild.getAttribute( "value" ) === ""; -}) ) { - addHandle( "value", function( elem, name, isXML ) { - if ( !isXML && elem.nodeName.toLowerCase() === "input" ) { - return elem.defaultValue; - } - }); -} - -// Support: IE<9 -// Use getAttributeNode to fetch booleans when getAttribute lies -if ( !assert(function( el ) { - return el.getAttribute("disabled") == null; -}) ) { - addHandle( booleans, function( elem, name, isXML ) { - var val; - if ( !isXML ) { - return elem[ name ] === true ? name.toLowerCase() : - (val = elem.getAttributeNode( name )) && val.specified ? - val.value : - null; - } - }); -} - -return Sizzle; - -})( window ); - - - -jQuery.find = Sizzle; -jQuery.expr = Sizzle.selectors; - -// Deprecated -jQuery.expr[ ":" ] = jQuery.expr.pseudos; -jQuery.uniqueSort = jQuery.unique = Sizzle.uniqueSort; -jQuery.text = Sizzle.getText; -jQuery.isXMLDoc = Sizzle.isXML; -jQuery.contains = Sizzle.contains; -jQuery.escapeSelector = Sizzle.escape; - - - - -var dir = function( elem, dir, until ) { - var matched = [], - truncate = until !== undefined; - - while ( ( elem = elem[ dir ] ) && elem.nodeType !== 9 ) { - if ( elem.nodeType === 1 ) { - if ( truncate && jQuery( elem ).is( until ) ) { - break; - } - matched.push( elem ); - } - } - return matched; -}; - - -var siblings = function( n, elem ) { - var matched = []; - - for ( ; n; n = n.nextSibling ) { - if ( n.nodeType === 1 && n !== elem ) { - matched.push( n ); - } - } - - return matched; -}; - - -var rneedsContext = jQuery.expr.match.needsContext; - -var rsingleTag = ( /^<([a-z][^\/\0>:\x20\t\r\n\f]*)[\x20\t\r\n\f]*\/?>(?:<\/\1>|)$/i ); - - - -var risSimple = /^.[^:#\[\.,]*$/; - -// Implement the identical functionality for filter and not -function winnow( elements, qualifier, not ) { - if ( jQuery.isFunction( qualifier ) ) { - return jQuery.grep( elements, function( elem, i ) { - return !!qualifier.call( elem, i, elem ) !== not; - } ); - } - - // Single element - if ( qualifier.nodeType ) { - return jQuery.grep( elements, function( elem ) { - return ( elem === qualifier ) !== not; - } ); - } - - // Arraylike of elements (jQuery, arguments, Array) - if ( typeof qualifier !== "string" ) { - return jQuery.grep( elements, function( elem ) { - return ( indexOf.call( qualifier, elem ) > -1 ) !== not; - } ); - } - - // Simple selector that can be filtered directly, removing non-Elements - if ( risSimple.test( qualifier ) ) { - return jQuery.filter( qualifier, elements, not ); - } - - // Complex selector, compare the two sets, removing non-Elements - qualifier = jQuery.filter( qualifier, elements ); - return jQuery.grep( elements, function( elem ) { - return ( indexOf.call( qualifier, elem ) > -1 ) !== not && elem.nodeType === 1; - } ); -} - -jQuery.filter = function( expr, elems, not ) { - var elem = elems[ 0 ]; - - if ( not ) { - expr = ":not(" + expr + ")"; - } - - if ( elems.length === 1 && elem.nodeType === 1 ) { - return jQuery.find.matchesSelector( elem, expr ) ? [ elem ] : []; - } - - return jQuery.find.matches( expr, jQuery.grep( elems, function( elem ) { - return elem.nodeType === 1; - } ) ); -}; - -jQuery.fn.extend( { - find: function( selector ) { - var i, ret, - len = this.length, - self = this; - - if ( typeof selector !== "string" ) { - return this.pushStack( jQuery( selector ).filter( function() { - for ( i = 0; i < len; i++ ) { - if ( jQuery.contains( self[ i ], this ) ) { - return true; - } - } - } ) ); - } - - ret = this.pushStack( [] ); - - for ( i = 0; i < len; i++ ) { - jQuery.find( selector, self[ i ], ret ); - } - - return len > 1 ? jQuery.uniqueSort( ret ) : ret; - }, - filter: function( selector ) { - return this.pushStack( winnow( this, selector || [], false ) ); - }, - not: function( selector ) { - return this.pushStack( winnow( this, selector || [], true ) ); - }, - is: function( selector ) { - return !!winnow( - this, - - // If this is a positional/relative selector, check membership in the returned set - // so $("p:first").is("p:last") won't return true for a doc with two "p". - typeof selector === "string" && rneedsContext.test( selector ) ? - jQuery( selector ) : - selector || [], - false - ).length; - } -} ); - - -// Initialize a jQuery object - - -// A central reference to the root jQuery(document) -var rootjQuery, - - // A simple way to check for HTML strings - // Prioritize #id over to avoid XSS via location.hash (#9521) - // Strict HTML recognition (#11290: must start with <) - // Shortcut simple #id case for speed - rquickExpr = /^(?:\s*(<[\w\W]+>)[^>]*|#([\w-]+))$/, - - init = jQuery.fn.init = function( selector, context, root ) { - var match, elem; - - // HANDLE: $(""), $(null), $(undefined), $(false) - if ( !selector ) { - return this; - } - - // Method init() accepts an alternate rootjQuery - // so migrate can support jQuery.sub (gh-2101) - root = root || rootjQuery; - - // Handle HTML strings - if ( typeof selector === "string" ) { - if ( selector[ 0 ] === "<" && - selector[ selector.length - 1 ] === ">" && - selector.length >= 3 ) { - - // Assume that strings that start and end with <> are HTML and skip the regex check - match = [ null, selector, null ]; - - } else { - match = rquickExpr.exec( selector ); - } - - // Match html or make sure no context is specified for #id - if ( match && ( match[ 1 ] || !context ) ) { - - // HANDLE: $(html) -> $(array) - if ( match[ 1 ] ) { - context = context instanceof jQuery ? context[ 0 ] : context; - - // Option to run scripts is true for back-compat - // Intentionally let the error be thrown if parseHTML is not present - jQuery.merge( this, jQuery.parseHTML( - match[ 1 ], - context && context.nodeType ? context.ownerDocument || context : document, - true - ) ); - - // HANDLE: $(html, props) - if ( rsingleTag.test( match[ 1 ] ) && jQuery.isPlainObject( context ) ) { - for ( match in context ) { - - // Properties of context are called as methods if possible - if ( jQuery.isFunction( this[ match ] ) ) { - this[ match ]( context[ match ] ); - - // ...and otherwise set as attributes - } else { - this.attr( match, context[ match ] ); - } - } - } - - return this; - - // HANDLE: $(#id) - } else { - elem = document.getElementById( match[ 2 ] ); - - if ( elem ) { - - // Inject the element directly into the jQuery object - this[ 0 ] = elem; - this.length = 1; - } - return this; - } - - // HANDLE: $(expr, $(...)) - } else if ( !context || context.jquery ) { - return ( context || root ).find( selector ); - - // HANDLE: $(expr, context) - // (which is just equivalent to: $(context).find(expr) - } else { - return this.constructor( context ).find( selector ); - } - - // HANDLE: $(DOMElement) - } else if ( selector.nodeType ) { - this[ 0 ] = selector; - this.length = 1; - return this; - - // HANDLE: $(function) - // Shortcut for document ready - } else if ( jQuery.isFunction( selector ) ) { - return root.ready !== undefined ? - root.ready( selector ) : - - // Execute immediately if ready is not present - selector( jQuery ); - } - - return jQuery.makeArray( selector, this ); - }; - -// Give the init function the jQuery prototype for later instantiation -init.prototype = jQuery.fn; - -// Initialize central reference -rootjQuery = jQuery( document ); - - -var rparentsprev = /^(?:parents|prev(?:Until|All))/, - - // Methods guaranteed to produce a unique set when starting from a unique set - guaranteedUnique = { - children: true, - contents: true, - next: true, - prev: true - }; - -jQuery.fn.extend( { - has: function( target ) { - var targets = jQuery( target, this ), - l = targets.length; - - return this.filter( function() { - var i = 0; - for ( ; i < l; i++ ) { - if ( jQuery.contains( this, targets[ i ] ) ) { - return true; - } - } - } ); - }, - - closest: function( selectors, context ) { - var cur, - i = 0, - l = this.length, - matched = [], - targets = typeof selectors !== "string" && jQuery( selectors ); - - // Positional selectors never match, since there's no _selection_ context - if ( !rneedsContext.test( selectors ) ) { - for ( ; i < l; i++ ) { - for ( cur = this[ i ]; cur && cur !== context; cur = cur.parentNode ) { - - // Always skip document fragments - if ( cur.nodeType < 11 && ( targets ? - targets.index( cur ) > -1 : - - // Don't pass non-elements to Sizzle - cur.nodeType === 1 && - jQuery.find.matchesSelector( cur, selectors ) ) ) { - - matched.push( cur ); - break; - } - } - } - } - - return this.pushStack( matched.length > 1 ? jQuery.uniqueSort( matched ) : matched ); - }, - - // Determine the position of an element within the set - index: function( elem ) { - - // No argument, return index in parent - if ( !elem ) { - return ( this[ 0 ] && this[ 0 ].parentNode ) ? this.first().prevAll().length : -1; - } - - // Index in selector - if ( typeof elem === "string" ) { - return indexOf.call( jQuery( elem ), this[ 0 ] ); - } - - // Locate the position of the desired element - return indexOf.call( this, - - // If it receives a jQuery object, the first element is used - elem.jquery ? elem[ 0 ] : elem - ); - }, - - add: function( selector, context ) { - return this.pushStack( - jQuery.uniqueSort( - jQuery.merge( this.get(), jQuery( selector, context ) ) - ) - ); - }, - - addBack: function( selector ) { - return this.add( selector == null ? - this.prevObject : this.prevObject.filter( selector ) - ); - } -} ); - -function sibling( cur, dir ) { - while ( ( cur = cur[ dir ] ) && cur.nodeType !== 1 ) {} - return cur; -} - -jQuery.each( { - parent: function( elem ) { - var parent = elem.parentNode; - return parent && parent.nodeType !== 11 ? parent : null; - }, - parents: function( elem ) { - return dir( elem, "parentNode" ); - }, - parentsUntil: function( elem, i, until ) { - return dir( elem, "parentNode", until ); - }, - next: function( elem ) { - return sibling( elem, "nextSibling" ); - }, - prev: function( elem ) { - return sibling( elem, "previousSibling" ); - }, - nextAll: function( elem ) { - return dir( elem, "nextSibling" ); - }, - prevAll: function( elem ) { - return dir( elem, "previousSibling" ); - }, - nextUntil: function( elem, i, until ) { - return dir( elem, "nextSibling", until ); - }, - prevUntil: function( elem, i, until ) { - return dir( elem, "previousSibling", until ); - }, - siblings: function( elem ) { - return siblings( ( elem.parentNode || {} ).firstChild, elem ); - }, - children: function( elem ) { - return siblings( elem.firstChild ); - }, - contents: function( elem ) { - return elem.contentDocument || jQuery.merge( [], elem.childNodes ); - } -}, function( name, fn ) { - jQuery.fn[ name ] = function( until, selector ) { - var matched = jQuery.map( this, fn, until ); - - if ( name.slice( -5 ) !== "Until" ) { - selector = until; - } - - if ( selector && typeof selector === "string" ) { - matched = jQuery.filter( selector, matched ); - } - - if ( this.length > 1 ) { - - // Remove duplicates - if ( !guaranteedUnique[ name ] ) { - jQuery.uniqueSort( matched ); - } - - // Reverse order for parents* and prev-derivatives - if ( rparentsprev.test( name ) ) { - matched.reverse(); - } - } - - return this.pushStack( matched ); - }; -} ); -var rnothtmlwhite = ( /[^\x20\t\r\n\f]+/g ); - - - -// Convert String-formatted options into Object-formatted ones -function createOptions( options ) { - var object = {}; - jQuery.each( options.match( rnothtmlwhite ) || [], function( _, flag ) { - object[ flag ] = true; - } ); - return object; -} - -/* - * Create a callback list using the following parameters: - * - * options: an optional list of space-separated options that will change how - * the callback list behaves or a more traditional option object - * - * By default a callback list will act like an event callback list and can be - * "fired" multiple times. - * - * Possible options: - * - * once: will ensure the callback list can only be fired once (like a Deferred) - * - * memory: will keep track of previous values and will call any callback added - * after the list has been fired right away with the latest "memorized" - * values (like a Deferred) - * - * unique: will ensure a callback can only be added once (no duplicate in the list) - * - * stopOnFalse: interrupt callings when a callback returns false - * - */ -jQuery.Callbacks = function( options ) { - - // Convert options from String-formatted to Object-formatted if needed - // (we check in cache first) - options = typeof options === "string" ? - createOptions( options ) : - jQuery.extend( {}, options ); - - var // Flag to know if list is currently firing - firing, - - // Last fire value for non-forgettable lists - memory, - - // Flag to know if list was already fired - fired, - - // Flag to prevent firing - locked, - - // Actual callback list - list = [], - - // Queue of execution data for repeatable lists - queue = [], - - // Index of currently firing callback (modified by add/remove as needed) - firingIndex = -1, - - // Fire callbacks - fire = function() { - - // Enforce single-firing - locked = options.once; - - // Execute callbacks for all pending executions, - // respecting firingIndex overrides and runtime changes - fired = firing = true; - for ( ; queue.length; firingIndex = -1 ) { - memory = queue.shift(); - while ( ++firingIndex < list.length ) { - - // Run callback and check for early termination - if ( list[ firingIndex ].apply( memory[ 0 ], memory[ 1 ] ) === false && - options.stopOnFalse ) { - - // Jump to end and forget the data so .add doesn't re-fire - firingIndex = list.length; - memory = false; - } - } - } - - // Forget the data if we're done with it - if ( !options.memory ) { - memory = false; - } - - firing = false; - - // Clean up if we're done firing for good - if ( locked ) { - - // Keep an empty list if we have data for future add calls - if ( memory ) { - list = []; - - // Otherwise, this object is spent - } else { - list = ""; - } - } - }, - - // Actual Callbacks object - self = { - - // Add a callback or a collection of callbacks to the list - add: function() { - if ( list ) { - - // If we have memory from a past run, we should fire after adding - if ( memory && !firing ) { - firingIndex = list.length - 1; - queue.push( memory ); - } - - ( function add( args ) { - jQuery.each( args, function( _, arg ) { - if ( jQuery.isFunction( arg ) ) { - if ( !options.unique || !self.has( arg ) ) { - list.push( arg ); - } - } else if ( arg && arg.length && jQuery.type( arg ) !== "string" ) { - - // Inspect recursively - add( arg ); - } - } ); - } )( arguments ); - - if ( memory && !firing ) { - fire(); - } - } - return this; - }, - - // Remove a callback from the list - remove: function() { - jQuery.each( arguments, function( _, arg ) { - var index; - while ( ( index = jQuery.inArray( arg, list, index ) ) > -1 ) { - list.splice( index, 1 ); - - // Handle firing indexes - if ( index <= firingIndex ) { - firingIndex--; - } - } - } ); - return this; - }, - - // Check if a given callback is in the list. - // If no argument is given, return whether or not list has callbacks attached. - has: function( fn ) { - return fn ? - jQuery.inArray( fn, list ) > -1 : - list.length > 0; - }, - - // Remove all callbacks from the list - empty: function() { - if ( list ) { - list = []; - } - return this; - }, - - // Disable .fire and .add - // Abort any current/pending executions - // Clear all callbacks and values - disable: function() { - locked = queue = []; - list = memory = ""; - return this; - }, - disabled: function() { - return !list; - }, - - // Disable .fire - // Also disable .add unless we have memory (since it would have no effect) - // Abort any pending executions - lock: function() { - locked = queue = []; - if ( !memory && !firing ) { - list = memory = ""; - } - return this; - }, - locked: function() { - return !!locked; - }, - - // Call all callbacks with the given context and arguments - fireWith: function( context, args ) { - if ( !locked ) { - args = args || []; - args = [ context, args.slice ? args.slice() : args ]; - queue.push( args ); - if ( !firing ) { - fire(); - } - } - return this; - }, - - // Call all the callbacks with the given arguments - fire: function() { - self.fireWith( this, arguments ); - return this; - }, - - // To know if the callbacks have already been called at least once - fired: function() { - return !!fired; - } - }; - - return self; -}; - - -function Identity( v ) { - return v; -} -function Thrower( ex ) { - throw ex; -} - -function adoptValue( value, resolve, reject ) { - var method; - - try { - - // Check for promise aspect first to privilege synchronous behavior - if ( value && jQuery.isFunction( ( method = value.promise ) ) ) { - method.call( value ).done( resolve ).fail( reject ); - - // Other thenables - } else if ( value && jQuery.isFunction( ( method = value.then ) ) ) { - method.call( value, resolve, reject ); - - // Other non-thenables - } else { - - // Support: Android 4.0 only - // Strict mode functions invoked without .call/.apply get global-object context - resolve.call( undefined, value ); - } - - // For Promises/A+, convert exceptions into rejections - // Since jQuery.when doesn't unwrap thenables, we can skip the extra checks appearing in - // Deferred#then to conditionally suppress rejection. - } catch ( value ) { - - // Support: Android 4.0 only - // Strict mode functions invoked without .call/.apply get global-object context - reject.call( undefined, value ); - } -} - -jQuery.extend( { - - Deferred: function( func ) { - var tuples = [ - - // action, add listener, callbacks, - // ... .then handlers, argument index, [final state] - [ "notify", "progress", jQuery.Callbacks( "memory" ), - jQuery.Callbacks( "memory" ), 2 ], - [ "resolve", "done", jQuery.Callbacks( "once memory" ), - jQuery.Callbacks( "once memory" ), 0, "resolved" ], - [ "reject", "fail", jQuery.Callbacks( "once memory" ), - jQuery.Callbacks( "once memory" ), 1, "rejected" ] - ], - state = "pending", - promise = { - state: function() { - return state; - }, - always: function() { - deferred.done( arguments ).fail( arguments ); - return this; - }, - "catch": function( fn ) { - return promise.then( null, fn ); - }, - - // Keep pipe for back-compat - pipe: function( /* fnDone, fnFail, fnProgress */ ) { - var fns = arguments; - - return jQuery.Deferred( function( newDefer ) { - jQuery.each( tuples, function( i, tuple ) { - - // Map tuples (progress, done, fail) to arguments (done, fail, progress) - var fn = jQuery.isFunction( fns[ tuple[ 4 ] ] ) && fns[ tuple[ 4 ] ]; - - // deferred.progress(function() { bind to newDefer or newDefer.notify }) - // deferred.done(function() { bind to newDefer or newDefer.resolve }) - // deferred.fail(function() { bind to newDefer or newDefer.reject }) - deferred[ tuple[ 1 ] ]( function() { - var returned = fn && fn.apply( this, arguments ); - if ( returned && jQuery.isFunction( returned.promise ) ) { - returned.promise() - .progress( newDefer.notify ) - .done( newDefer.resolve ) - .fail( newDefer.reject ); - } else { - newDefer[ tuple[ 0 ] + "With" ]( - this, - fn ? [ returned ] : arguments - ); - } - } ); - } ); - fns = null; - } ).promise(); - }, - then: function( onFulfilled, onRejected, onProgress ) { - var maxDepth = 0; - function resolve( depth, deferred, handler, special ) { - return function() { - var that = this, - args = arguments, - mightThrow = function() { - var returned, then; - - // Support: Promises/A+ section 2.3.3.3.3 - // https://promisesaplus.com/#point-59 - // Ignore double-resolution attempts - if ( depth < maxDepth ) { - return; - } - - returned = handler.apply( that, args ); - - // Support: Promises/A+ section 2.3.1 - // https://promisesaplus.com/#point-48 - if ( returned === deferred.promise() ) { - throw new TypeError( "Thenable self-resolution" ); - } - - // Support: Promises/A+ sections 2.3.3.1, 3.5 - // https://promisesaplus.com/#point-54 - // https://promisesaplus.com/#point-75 - // Retrieve `then` only once - then = returned && - - // Support: Promises/A+ section 2.3.4 - // https://promisesaplus.com/#point-64 - // Only check objects and functions for thenability - ( typeof returned === "object" || - typeof returned === "function" ) && - returned.then; - - // Handle a returned thenable - if ( jQuery.isFunction( then ) ) { - - // Special processors (notify) just wait for resolution - if ( special ) { - then.call( - returned, - resolve( maxDepth, deferred, Identity, special ), - resolve( maxDepth, deferred, Thrower, special ) - ); - - // Normal processors (resolve) also hook into progress - } else { - - // ...and disregard older resolution values - maxDepth++; - - then.call( - returned, - resolve( maxDepth, deferred, Identity, special ), - resolve( maxDepth, deferred, Thrower, special ), - resolve( maxDepth, deferred, Identity, - deferred.notifyWith ) - ); - } - - // Handle all other returned values - } else { - - // Only substitute handlers pass on context - // and multiple values (non-spec behavior) - if ( handler !== Identity ) { - that = undefined; - args = [ returned ]; - } - - // Process the value(s) - // Default process is resolve - ( special || deferred.resolveWith )( that, args ); - } - }, - - // Only normal processors (resolve) catch and reject exceptions - process = special ? - mightThrow : - function() { - try { - mightThrow(); - } catch ( e ) { - - if ( jQuery.Deferred.exceptionHook ) { - jQuery.Deferred.exceptionHook( e, - process.stackTrace ); - } - - // Support: Promises/A+ section 2.3.3.3.4.1 - // https://promisesaplus.com/#point-61 - // Ignore post-resolution exceptions - if ( depth + 1 >= maxDepth ) { - - // Only substitute handlers pass on context - // and multiple values (non-spec behavior) - if ( handler !== Thrower ) { - that = undefined; - args = [ e ]; - } - - deferred.rejectWith( that, args ); - } - } - }; - - // Support: Promises/A+ section 2.3.3.3.1 - // https://promisesaplus.com/#point-57 - // Re-resolve promises immediately to dodge false rejection from - // subsequent errors - if ( depth ) { - process(); - } else { - - // Call an optional hook to record the stack, in case of exception - // since it's otherwise lost when execution goes async - if ( jQuery.Deferred.getStackHook ) { - process.stackTrace = jQuery.Deferred.getStackHook(); - } - window.setTimeout( process ); - } - }; - } - - return jQuery.Deferred( function( newDefer ) { - - // progress_handlers.add( ... ) - tuples[ 0 ][ 3 ].add( - resolve( - 0, - newDefer, - jQuery.isFunction( onProgress ) ? - onProgress : - Identity, - newDefer.notifyWith - ) - ); - - // fulfilled_handlers.add( ... ) - tuples[ 1 ][ 3 ].add( - resolve( - 0, - newDefer, - jQuery.isFunction( onFulfilled ) ? - onFulfilled : - Identity - ) - ); - - // rejected_handlers.add( ... ) - tuples[ 2 ][ 3 ].add( - resolve( - 0, - newDefer, - jQuery.isFunction( onRejected ) ? - onRejected : - Thrower - ) - ); - } ).promise(); - }, - - // Get a promise for this deferred - // If obj is provided, the promise aspect is added to the object - promise: function( obj ) { - return obj != null ? jQuery.extend( obj, promise ) : promise; - } - }, - deferred = {}; - - // Add list-specific methods - jQuery.each( tuples, function( i, tuple ) { - var list = tuple[ 2 ], - stateString = tuple[ 5 ]; - - // promise.progress = list.add - // promise.done = list.add - // promise.fail = list.add - promise[ tuple[ 1 ] ] = list.add; - - // Handle state - if ( stateString ) { - list.add( - function() { - - // state = "resolved" (i.e., fulfilled) - // state = "rejected" - state = stateString; - }, - - // rejected_callbacks.disable - // fulfilled_callbacks.disable - tuples[ 3 - i ][ 2 ].disable, - - // progress_callbacks.lock - tuples[ 0 ][ 2 ].lock - ); - } - - // progress_handlers.fire - // fulfilled_handlers.fire - // rejected_handlers.fire - list.add( tuple[ 3 ].fire ); - - // deferred.notify = function() { deferred.notifyWith(...) } - // deferred.resolve = function() { deferred.resolveWith(...) } - // deferred.reject = function() { deferred.rejectWith(...) } - deferred[ tuple[ 0 ] ] = function() { - deferred[ tuple[ 0 ] + "With" ]( this === deferred ? undefined : this, arguments ); - return this; - }; - - // deferred.notifyWith = list.fireWith - // deferred.resolveWith = list.fireWith - // deferred.rejectWith = list.fireWith - deferred[ tuple[ 0 ] + "With" ] = list.fireWith; - } ); - - // Make the deferred a promise - promise.promise( deferred ); - - // Call given func if any - if ( func ) { - func.call( deferred, deferred ); - } - - // All done! - return deferred; - }, - - // Deferred helper - when: function( singleValue ) { - var - - // count of uncompleted subordinates - remaining = arguments.length, - - // count of unprocessed arguments - i = remaining, - - // subordinate fulfillment data - resolveContexts = Array( i ), - resolveValues = slice.call( arguments ), - - // the master Deferred - master = jQuery.Deferred(), - - // subordinate callback factory - updateFunc = function( i ) { - return function( value ) { - resolveContexts[ i ] = this; - resolveValues[ i ] = arguments.length > 1 ? slice.call( arguments ) : value; - if ( !( --remaining ) ) { - master.resolveWith( resolveContexts, resolveValues ); - } - }; - }; - - // Single- and empty arguments are adopted like Promise.resolve - if ( remaining <= 1 ) { - adoptValue( singleValue, master.done( updateFunc( i ) ).resolve, master.reject ); - - // Use .then() to unwrap secondary thenables (cf. gh-3000) - if ( master.state() === "pending" || - jQuery.isFunction( resolveValues[ i ] && resolveValues[ i ].then ) ) { - - return master.then(); - } - } - - // Multiple arguments are aggregated like Promise.all array elements - while ( i-- ) { - adoptValue( resolveValues[ i ], updateFunc( i ), master.reject ); - } - - return master.promise(); - } -} ); - - -// These usually indicate a programmer mistake during development, -// warn about them ASAP rather than swallowing them by default. -var rerrorNames = /^(Eval|Internal|Range|Reference|Syntax|Type|URI)Error$/; - -jQuery.Deferred.exceptionHook = function( error, stack ) { - - // Support: IE 8 - 9 only - // Console exists when dev tools are open, which can happen at any time - if ( window.console && window.console.warn && error && rerrorNames.test( error.name ) ) { - window.console.warn( "jQuery.Deferred exception: " + error.message, error.stack, stack ); - } -}; - - - - -jQuery.readyException = function( error ) { - window.setTimeout( function() { - throw error; - } ); -}; - - - - -// The deferred used on DOM ready -var readyList = jQuery.Deferred(); - -jQuery.fn.ready = function( fn ) { - - readyList - .then( fn ) - - // Wrap jQuery.readyException in a function so that the lookup - // happens at the time of error handling instead of callback - // registration. - .catch( function( error ) { - jQuery.readyException( error ); - } ); - - return this; -}; - -jQuery.extend( { - - // Is the DOM ready to be used? Set to true once it occurs. - isReady: false, - - // A counter to track how many items to wait for before - // the ready event fires. See #6781 - readyWait: 1, - - // Hold (or release) the ready event - holdReady: function( hold ) { - if ( hold ) { - jQuery.readyWait++; - } else { - jQuery.ready( true ); - } - }, - - // Handle when the DOM is ready - ready: function( wait ) { - - // Abort if there are pending holds or we're already ready - if ( wait === true ? --jQuery.readyWait : jQuery.isReady ) { - return; - } - - // Remember that the DOM is ready - jQuery.isReady = true; - - // If a normal DOM Ready event fired, decrement, and wait if need be - if ( wait !== true && --jQuery.readyWait > 0 ) { - return; - } - - // If there are functions bound, to execute - readyList.resolveWith( document, [ jQuery ] ); - } -} ); - -jQuery.ready.then = readyList.then; - -// The ready event handler and self cleanup method -function completed() { - document.removeEventListener( "DOMContentLoaded", completed ); - window.removeEventListener( "load", completed ); - jQuery.ready(); -} - -// Catch cases where $(document).ready() is called -// after the browser event has already occurred. -// Support: IE <=9 - 10 only -// Older IE sometimes signals "interactive" too soon -if ( document.readyState === "complete" || - ( document.readyState !== "loading" && !document.documentElement.doScroll ) ) { - - // Handle it asynchronously to allow scripts the opportunity to delay ready - window.setTimeout( jQuery.ready ); - -} else { - - // Use the handy event callback - document.addEventListener( "DOMContentLoaded", completed ); - - // A fallback to window.onload, that will always work - window.addEventListener( "load", completed ); -} - - - - -// Multifunctional method to get and set values of a collection -// The value/s can optionally be executed if it's a function -var access = function( elems, fn, key, value, chainable, emptyGet, raw ) { - var i = 0, - len = elems.length, - bulk = key == null; - - // Sets many values - if ( jQuery.type( key ) === "object" ) { - chainable = true; - for ( i in key ) { - access( elems, fn, i, key[ i ], true, emptyGet, raw ); - } - - // Sets one value - } else if ( value !== undefined ) { - chainable = true; - - if ( !jQuery.isFunction( value ) ) { - raw = true; - } - - if ( bulk ) { - - // Bulk operations run against the entire set - if ( raw ) { - fn.call( elems, value ); - fn = null; - - // ...except when executing function values - } else { - bulk = fn; - fn = function( elem, key, value ) { - return bulk.call( jQuery( elem ), value ); - }; - } - } - - if ( fn ) { - for ( ; i < len; i++ ) { - fn( - elems[ i ], key, raw ? - value : - value.call( elems[ i ], i, fn( elems[ i ], key ) ) - ); - } - } - } - - if ( chainable ) { - return elems; - } - - // Gets - if ( bulk ) { - return fn.call( elems ); - } - - return len ? fn( elems[ 0 ], key ) : emptyGet; -}; -var acceptData = function( owner ) { - - // Accepts only: - // - Node - // - Node.ELEMENT_NODE - // - Node.DOCUMENT_NODE - // - Object - // - Any - return owner.nodeType === 1 || owner.nodeType === 9 || !( +owner.nodeType ); -}; - - - - -function Data() { - this.expando = jQuery.expando + Data.uid++; -} - -Data.uid = 1; - -Data.prototype = { - - cache: function( owner ) { - - // Check if the owner object already has a cache - var value = owner[ this.expando ]; - - // If not, create one - if ( !value ) { - value = {}; - - // We can accept data for non-element nodes in modern browsers, - // but we should not, see #8335. - // Always return an empty object. - if ( acceptData( owner ) ) { - - // If it is a node unlikely to be stringify-ed or looped over - // use plain assignment - if ( owner.nodeType ) { - owner[ this.expando ] = value; - - // Otherwise secure it in a non-enumerable property - // configurable must be true to allow the property to be - // deleted when data is removed - } else { - Object.defineProperty( owner, this.expando, { - value: value, - configurable: true - } ); - } - } - } - - return value; - }, - set: function( owner, data, value ) { - var prop, - cache = this.cache( owner ); - - // Handle: [ owner, key, value ] args - // Always use camelCase key (gh-2257) - if ( typeof data === "string" ) { - cache[ jQuery.camelCase( data ) ] = value; - - // Handle: [ owner, { properties } ] args - } else { - - // Copy the properties one-by-one to the cache object - for ( prop in data ) { - cache[ jQuery.camelCase( prop ) ] = data[ prop ]; - } - } - return cache; - }, - get: function( owner, key ) { - return key === undefined ? - this.cache( owner ) : - - // Always use camelCase key (gh-2257) - owner[ this.expando ] && owner[ this.expando ][ jQuery.camelCase( key ) ]; - }, - access: function( owner, key, value ) { - - // In cases where either: - // - // 1. No key was specified - // 2. A string key was specified, but no value provided - // - // Take the "read" path and allow the get method to determine - // which value to return, respectively either: - // - // 1. The entire cache object - // 2. The data stored at the key - // - if ( key === undefined || - ( ( key && typeof key === "string" ) && value === undefined ) ) { - - return this.get( owner, key ); - } - - // When the key is not a string, or both a key and value - // are specified, set or extend (existing objects) with either: - // - // 1. An object of properties - // 2. A key and value - // - this.set( owner, key, value ); - - // Since the "set" path can have two possible entry points - // return the expected data based on which path was taken[*] - return value !== undefined ? value : key; - }, - remove: function( owner, key ) { - var i, - cache = owner[ this.expando ]; - - if ( cache === undefined ) { - return; - } - - if ( key !== undefined ) { - - // Support array or space separated string of keys - if ( jQuery.isArray( key ) ) { - - // If key is an array of keys... - // We always set camelCase keys, so remove that. - key = key.map( jQuery.camelCase ); - } else { - key = jQuery.camelCase( key ); - - // If a key with the spaces exists, use it. - // Otherwise, create an array by matching non-whitespace - key = key in cache ? - [ key ] : - ( key.match( rnothtmlwhite ) || [] ); - } - - i = key.length; - - while ( i-- ) { - delete cache[ key[ i ] ]; - } - } - - // Remove the expando if there's no more data - if ( key === undefined || jQuery.isEmptyObject( cache ) ) { - - // Support: Chrome <=35 - 45 - // Webkit & Blink performance suffers when deleting properties - // from DOM nodes, so set to undefined instead - // https://bugs.chromium.org/p/chromium/issues/detail?id=378607 (bug restricted) - if ( owner.nodeType ) { - owner[ this.expando ] = undefined; - } else { - delete owner[ this.expando ]; - } - } - }, - hasData: function( owner ) { - var cache = owner[ this.expando ]; - return cache !== undefined && !jQuery.isEmptyObject( cache ); - } -}; -var dataPriv = new Data(); - -var dataUser = new Data(); - - - -// Implementation Summary -// -// 1. Enforce API surface and semantic compatibility with 1.9.x branch -// 2. Improve the module's maintainability by reducing the storage -// paths to a single mechanism. -// 3. Use the same single mechanism to support "private" and "user" data. -// 4. _Never_ expose "private" data to user code (TODO: Drop _data, _removeData) -// 5. Avoid exposing implementation details on user objects (eg. expando properties) -// 6. Provide a clear path for implementation upgrade to WeakMap in 2014 - -var rbrace = /^(?:\{[\w\W]*\}|\[[\w\W]*\])$/, - rmultiDash = /[A-Z]/g; - -function getData( data ) { - if ( data === "true" ) { - return true; - } - - if ( data === "false" ) { - return false; - } - - if ( data === "null" ) { - return null; - } - - // Only convert to a number if it doesn't change the string - if ( data === +data + "" ) { - return +data; - } - - if ( rbrace.test( data ) ) { - return JSON.parse( data ); - } - - return data; -} - -function dataAttr( elem, key, data ) { - var name; - - // If nothing was found internally, try to fetch any - // data from the HTML5 data-* attribute - if ( data === undefined && elem.nodeType === 1 ) { - name = "data-" + key.replace( rmultiDash, "-$&" ).toLowerCase(); - data = elem.getAttribute( name ); - - if ( typeof data === "string" ) { - try { - data = getData( data ); - } catch ( e ) {} - - // Make sure we set the data so it isn't changed later - dataUser.set( elem, key, data ); - } else { - data = undefined; - } - } - return data; -} - -jQuery.extend( { - hasData: function( elem ) { - return dataUser.hasData( elem ) || dataPriv.hasData( elem ); - }, - - data: function( elem, name, data ) { - return dataUser.access( elem, name, data ); - }, - - removeData: function( elem, name ) { - dataUser.remove( elem, name ); - }, - - // TODO: Now that all calls to _data and _removeData have been replaced - // with direct calls to dataPriv methods, these can be deprecated. - _data: function( elem, name, data ) { - return dataPriv.access( elem, name, data ); - }, - - _removeData: function( elem, name ) { - dataPriv.remove( elem, name ); - } -} ); - -jQuery.fn.extend( { - data: function( key, value ) { - var i, name, data, - elem = this[ 0 ], - attrs = elem && elem.attributes; - - // Gets all values - if ( key === undefined ) { - if ( this.length ) { - data = dataUser.get( elem ); - - if ( elem.nodeType === 1 && !dataPriv.get( elem, "hasDataAttrs" ) ) { - i = attrs.length; - while ( i-- ) { - - // Support: IE 11 only - // The attrs elements can be null (#14894) - if ( attrs[ i ] ) { - name = attrs[ i ].name; - if ( name.indexOf( "data-" ) === 0 ) { - name = jQuery.camelCase( name.slice( 5 ) ); - dataAttr( elem, name, data[ name ] ); - } - } - } - dataPriv.set( elem, "hasDataAttrs", true ); - } - } - - return data; - } - - // Sets multiple values - if ( typeof key === "object" ) { - return this.each( function() { - dataUser.set( this, key ); - } ); - } - - return access( this, function( value ) { - var data; - - // The calling jQuery object (element matches) is not empty - // (and therefore has an element appears at this[ 0 ]) and the - // `value` parameter was not undefined. An empty jQuery object - // will result in `undefined` for elem = this[ 0 ] which will - // throw an exception if an attempt to read a data cache is made. - if ( elem && value === undefined ) { - - // Attempt to get data from the cache - // The key will always be camelCased in Data - data = dataUser.get( elem, key ); - if ( data !== undefined ) { - return data; - } - - // Attempt to "discover" the data in - // HTML5 custom data-* attrs - data = dataAttr( elem, key ); - if ( data !== undefined ) { - return data; - } - - // We tried really hard, but the data doesn't exist. - return; - } - - // Set the data... - this.each( function() { - - // We always store the camelCased key - dataUser.set( this, key, value ); - } ); - }, null, value, arguments.length > 1, null, true ); - }, - - removeData: function( key ) { - return this.each( function() { - dataUser.remove( this, key ); - } ); - } -} ); - - -jQuery.extend( { - queue: function( elem, type, data ) { - var queue; - - if ( elem ) { - type = ( type || "fx" ) + "queue"; - queue = dataPriv.get( elem, type ); - - // Speed up dequeue by getting out quickly if this is just a lookup - if ( data ) { - if ( !queue || jQuery.isArray( data ) ) { - queue = dataPriv.access( elem, type, jQuery.makeArray( data ) ); - } else { - queue.push( data ); - } - } - return queue || []; - } - }, - - dequeue: function( elem, type ) { - type = type || "fx"; - - var queue = jQuery.queue( elem, type ), - startLength = queue.length, - fn = queue.shift(), - hooks = jQuery._queueHooks( elem, type ), - next = function() { - jQuery.dequeue( elem, type ); - }; - - // If the fx queue is dequeued, always remove the progress sentinel - if ( fn === "inprogress" ) { - fn = queue.shift(); - startLength--; - } - - if ( fn ) { - - // Add a progress sentinel to prevent the fx queue from being - // automatically dequeued - if ( type === "fx" ) { - queue.unshift( "inprogress" ); - } - - // Clear up the last queue stop function - delete hooks.stop; - fn.call( elem, next, hooks ); - } - - if ( !startLength && hooks ) { - hooks.empty.fire(); - } - }, - - // Not public - generate a queueHooks object, or return the current one - _queueHooks: function( elem, type ) { - var key = type + "queueHooks"; - return dataPriv.get( elem, key ) || dataPriv.access( elem, key, { - empty: jQuery.Callbacks( "once memory" ).add( function() { - dataPriv.remove( elem, [ type + "queue", key ] ); - } ) - } ); - } -} ); - -jQuery.fn.extend( { - queue: function( type, data ) { - var setter = 2; - - if ( typeof type !== "string" ) { - data = type; - type = "fx"; - setter--; - } - - if ( arguments.length < setter ) { - return jQuery.queue( this[ 0 ], type ); - } - - return data === undefined ? - this : - this.each( function() { - var queue = jQuery.queue( this, type, data ); - - // Ensure a hooks for this queue - jQuery._queueHooks( this, type ); - - if ( type === "fx" && queue[ 0 ] !== "inprogress" ) { - jQuery.dequeue( this, type ); - } - } ); - }, - dequeue: function( type ) { - return this.each( function() { - jQuery.dequeue( this, type ); - } ); - }, - clearQueue: function( type ) { - return this.queue( type || "fx", [] ); - }, - - // Get a promise resolved when queues of a certain type - // are emptied (fx is the type by default) - promise: function( type, obj ) { - var tmp, - count = 1, - defer = jQuery.Deferred(), - elements = this, - i = this.length, - resolve = function() { - if ( !( --count ) ) { - defer.resolveWith( elements, [ elements ] ); - } - }; - - if ( typeof type !== "string" ) { - obj = type; - type = undefined; - } - type = type || "fx"; - - while ( i-- ) { - tmp = dataPriv.get( elements[ i ], type + "queueHooks" ); - if ( tmp && tmp.empty ) { - count++; - tmp.empty.add( resolve ); - } - } - resolve(); - return defer.promise( obj ); - } -} ); -var pnum = ( /[+-]?(?:\d*\.|)\d+(?:[eE][+-]?\d+|)/ ).source; - -var rcssNum = new RegExp( "^(?:([+-])=|)(" + pnum + ")([a-z%]*)$", "i" ); - - -var cssExpand = [ "Top", "Right", "Bottom", "Left" ]; - -var isHiddenWithinTree = function( elem, el ) { - - // isHiddenWithinTree might be called from jQuery#filter function; - // in that case, element will be second argument - elem = el || elem; - - // Inline style trumps all - return elem.style.display === "none" || - elem.style.display === "" && - - // Otherwise, check computed style - // Support: Firefox <=43 - 45 - // Disconnected elements can have computed display: none, so first confirm that elem is - // in the document. - jQuery.contains( elem.ownerDocument, elem ) && - - jQuery.css( elem, "display" ) === "none"; - }; - -var swap = function( elem, options, callback, args ) { - var ret, name, - old = {}; - - // Remember the old values, and insert the new ones - for ( name in options ) { - old[ name ] = elem.style[ name ]; - elem.style[ name ] = options[ name ]; - } - - ret = callback.apply( elem, args || [] ); - - // Revert the old values - for ( name in options ) { - elem.style[ name ] = old[ name ]; - } - - return ret; -}; - - - - -function adjustCSS( elem, prop, valueParts, tween ) { - var adjusted, - scale = 1, - maxIterations = 20, - currentValue = tween ? - function() { - return tween.cur(); - } : - function() { - return jQuery.css( elem, prop, "" ); - }, - initial = currentValue(), - unit = valueParts && valueParts[ 3 ] || ( jQuery.cssNumber[ prop ] ? "" : "px" ), - - // Starting value computation is required for potential unit mismatches - initialInUnit = ( jQuery.cssNumber[ prop ] || unit !== "px" && +initial ) && - rcssNum.exec( jQuery.css( elem, prop ) ); - - if ( initialInUnit && initialInUnit[ 3 ] !== unit ) { - - // Trust units reported by jQuery.css - unit = unit || initialInUnit[ 3 ]; - - // Make sure we update the tween properties later on - valueParts = valueParts || []; - - // Iteratively approximate from a nonzero starting point - initialInUnit = +initial || 1; - - do { - - // If previous iteration zeroed out, double until we get *something*. - // Use string for doubling so we don't accidentally see scale as unchanged below - scale = scale || ".5"; - - // Adjust and apply - initialInUnit = initialInUnit / scale; - jQuery.style( elem, prop, initialInUnit + unit ); - - // Update scale, tolerating zero or NaN from tween.cur() - // Break the loop if scale is unchanged or perfect, or if we've just had enough. - } while ( - scale !== ( scale = currentValue() / initial ) && scale !== 1 && --maxIterations - ); - } - - if ( valueParts ) { - initialInUnit = +initialInUnit || +initial || 0; - - // Apply relative offset (+=/-=) if specified - adjusted = valueParts[ 1 ] ? - initialInUnit + ( valueParts[ 1 ] + 1 ) * valueParts[ 2 ] : - +valueParts[ 2 ]; - if ( tween ) { - tween.unit = unit; - tween.start = initialInUnit; - tween.end = adjusted; - } - } - return adjusted; -} - - -var defaultDisplayMap = {}; - -function getDefaultDisplay( elem ) { - var temp, - doc = elem.ownerDocument, - nodeName = elem.nodeName, - display = defaultDisplayMap[ nodeName ]; - - if ( display ) { - return display; - } - - temp = doc.body.appendChild( doc.createElement( nodeName ) ); - display = jQuery.css( temp, "display" ); - - temp.parentNode.removeChild( temp ); - - if ( display === "none" ) { - display = "block"; - } - defaultDisplayMap[ nodeName ] = display; - - return display; -} - -function showHide( elements, show ) { - var display, elem, - values = [], - index = 0, - length = elements.length; - - // Determine new display value for elements that need to change - for ( ; index < length; index++ ) { - elem = elements[ index ]; - if ( !elem.style ) { - continue; - } - - display = elem.style.display; - if ( show ) { - - // Since we force visibility upon cascade-hidden elements, an immediate (and slow) - // check is required in this first loop unless we have a nonempty display value (either - // inline or about-to-be-restored) - if ( display === "none" ) { - values[ index ] = dataPriv.get( elem, "display" ) || null; - if ( !values[ index ] ) { - elem.style.display = ""; - } - } - if ( elem.style.display === "" && isHiddenWithinTree( elem ) ) { - values[ index ] = getDefaultDisplay( elem ); - } - } else { - if ( display !== "none" ) { - values[ index ] = "none"; - - // Remember what we're overwriting - dataPriv.set( elem, "display", display ); - } - } - } - - // Set the display of the elements in a second loop to avoid constant reflow - for ( index = 0; index < length; index++ ) { - if ( values[ index ] != null ) { - elements[ index ].style.display = values[ index ]; - } - } - - return elements; -} - -jQuery.fn.extend( { - show: function() { - return showHide( this, true ); - }, - hide: function() { - return showHide( this ); - }, - toggle: function( state ) { - if ( typeof state === "boolean" ) { - return state ? this.show() : this.hide(); - } - - return this.each( function() { - if ( isHiddenWithinTree( this ) ) { - jQuery( this ).show(); - } else { - jQuery( this ).hide(); - } - } ); - } -} ); -var rcheckableType = ( /^(?:checkbox|radio)$/i ); - -var rtagName = ( /<([a-z][^\/\0>\x20\t\r\n\f]+)/i ); - -var rscriptType = ( /^$|\/(?:java|ecma)script/i ); - - - -// We have to close these tags to support XHTML (#13200) -var wrapMap = { - - // Support: IE <=9 only - option: [ 1, "" ], - - // XHTML parsers do not magically insert elements in the - // same way that tag soup parsers do. So we cannot shorten - // this by omitting or other required elements. - thead: [ 1, "", "
" ], - col: [ 2, "", "
" ], - tr: [ 2, "", "
" ], - td: [ 3, "", "
" ], - - _default: [ 0, "", "" ] -}; - -// Support: IE <=9 only -wrapMap.optgroup = wrapMap.option; - -wrapMap.tbody = wrapMap.tfoot = wrapMap.colgroup = wrapMap.caption = wrapMap.thead; -wrapMap.th = wrapMap.td; - - -function getAll( context, tag ) { - - // Support: IE <=9 - 11 only - // Use typeof to avoid zero-argument method invocation on host objects (#15151) - var ret; - - if ( typeof context.getElementsByTagName !== "undefined" ) { - ret = context.getElementsByTagName( tag || "*" ); - - } else if ( typeof context.querySelectorAll !== "undefined" ) { - ret = context.querySelectorAll( tag || "*" ); - - } else { - ret = []; - } - - if ( tag === undefined || tag && jQuery.nodeName( context, tag ) ) { - return jQuery.merge( [ context ], ret ); - } - - return ret; -} - - -// Mark scripts as having already been evaluated -function setGlobalEval( elems, refElements ) { - var i = 0, - l = elems.length; - - for ( ; i < l; i++ ) { - dataPriv.set( - elems[ i ], - "globalEval", - !refElements || dataPriv.get( refElements[ i ], "globalEval" ) - ); - } -} - - -var rhtml = /<|&#?\w+;/; - -function buildFragment( elems, context, scripts, selection, ignored ) { - var elem, tmp, tag, wrap, contains, j, - fragment = context.createDocumentFragment(), - nodes = [], - i = 0, - l = elems.length; - - for ( ; i < l; i++ ) { - elem = elems[ i ]; - - if ( elem || elem === 0 ) { - - // Add nodes directly - if ( jQuery.type( elem ) === "object" ) { - - // Support: Android <=4.0 only, PhantomJS 1 only - // push.apply(_, arraylike) throws on ancient WebKit - jQuery.merge( nodes, elem.nodeType ? [ elem ] : elem ); - - // Convert non-html into a text node - } else if ( !rhtml.test( elem ) ) { - nodes.push( context.createTextNode( elem ) ); - - // Convert html into DOM nodes - } else { - tmp = tmp || fragment.appendChild( context.createElement( "div" ) ); - - // Deserialize a standard representation - tag = ( rtagName.exec( elem ) || [ "", "" ] )[ 1 ].toLowerCase(); - wrap = wrapMap[ tag ] || wrapMap._default; - tmp.innerHTML = wrap[ 1 ] + jQuery.htmlPrefilter( elem ) + wrap[ 2 ]; - - // Descend through wrappers to the right content - j = wrap[ 0 ]; - while ( j-- ) { - tmp = tmp.lastChild; - } - - // Support: Android <=4.0 only, PhantomJS 1 only - // push.apply(_, arraylike) throws on ancient WebKit - jQuery.merge( nodes, tmp.childNodes ); - - // Remember the top-level container - tmp = fragment.firstChild; - - // Ensure the created nodes are orphaned (#12392) - tmp.textContent = ""; - } - } - } - - // Remove wrapper from fragment - fragment.textContent = ""; - - i = 0; - while ( ( elem = nodes[ i++ ] ) ) { - - // Skip elements already in the context collection (trac-4087) - if ( selection && jQuery.inArray( elem, selection ) > -1 ) { - if ( ignored ) { - ignored.push( elem ); - } - continue; - } - - contains = jQuery.contains( elem.ownerDocument, elem ); - - // Append to fragment - tmp = getAll( fragment.appendChild( elem ), "script" ); - - // Preserve script evaluation history - if ( contains ) { - setGlobalEval( tmp ); - } - - // Capture executables - if ( scripts ) { - j = 0; - while ( ( elem = tmp[ j++ ] ) ) { - if ( rscriptType.test( elem.type || "" ) ) { - scripts.push( elem ); - } - } - } - } - - return fragment; -} - - -( function() { - var fragment = document.createDocumentFragment(), - div = fragment.appendChild( document.createElement( "div" ) ), - input = document.createElement( "input" ); - - // Support: Android 4.0 - 4.3 only - // Check state lost if the name is set (#11217) - // Support: Windows Web Apps (WWA) - // `name` and `type` must use .setAttribute for WWA (#14901) - input.setAttribute( "type", "radio" ); - input.setAttribute( "checked", "checked" ); - input.setAttribute( "name", "t" ); - - div.appendChild( input ); - - // Support: Android <=4.1 only - // Older WebKit doesn't clone checked state correctly in fragments - support.checkClone = div.cloneNode( true ).cloneNode( true ).lastChild.checked; - - // Support: IE <=11 only - // Make sure textarea (and checkbox) defaultValue is properly cloned - div.innerHTML = ""; - support.noCloneChecked = !!div.cloneNode( true ).lastChild.defaultValue; -} )(); -var documentElement = document.documentElement; - - - -var - rkeyEvent = /^key/, - rmouseEvent = /^(?:mouse|pointer|contextmenu|drag|drop)|click/, - rtypenamespace = /^([^.]*)(?:\.(.+)|)/; - -function returnTrue() { - return true; -} - -function returnFalse() { - return false; -} - -// Support: IE <=9 only -// See #13393 for more info -function safeActiveElement() { - try { - return document.activeElement; - } catch ( err ) { } -} - -function on( elem, types, selector, data, fn, one ) { - var origFn, type; - - // Types can be a map of types/handlers - if ( typeof types === "object" ) { - - // ( types-Object, selector, data ) - if ( typeof selector !== "string" ) { - - // ( types-Object, data ) - data = data || selector; - selector = undefined; - } - for ( type in types ) { - on( elem, type, selector, data, types[ type ], one ); - } - return elem; - } - - if ( data == null && fn == null ) { - - // ( types, fn ) - fn = selector; - data = selector = undefined; - } else if ( fn == null ) { - if ( typeof selector === "string" ) { - - // ( types, selector, fn ) - fn = data; - data = undefined; - } else { - - // ( types, data, fn ) - fn = data; - data = selector; - selector = undefined; - } - } - if ( fn === false ) { - fn = returnFalse; - } else if ( !fn ) { - return elem; - } - - if ( one === 1 ) { - origFn = fn; - fn = function( event ) { - - // Can use an empty set, since event contains the info - jQuery().off( event ); - return origFn.apply( this, arguments ); - }; - - // Use same guid so caller can remove using origFn - fn.guid = origFn.guid || ( origFn.guid = jQuery.guid++ ); - } - return elem.each( function() { - jQuery.event.add( this, types, fn, data, selector ); - } ); -} - -/* - * Helper functions for managing events -- not part of the public interface. - * Props to Dean Edwards' addEvent library for many of the ideas. - */ -jQuery.event = { - - global: {}, - - add: function( elem, types, handler, data, selector ) { - - var handleObjIn, eventHandle, tmp, - events, t, handleObj, - special, handlers, type, namespaces, origType, - elemData = dataPriv.get( elem ); - - // Don't attach events to noData or text/comment nodes (but allow plain objects) - if ( !elemData ) { - return; - } - - // Caller can pass in an object of custom data in lieu of the handler - if ( handler.handler ) { - handleObjIn = handler; - handler = handleObjIn.handler; - selector = handleObjIn.selector; - } - - // Ensure that invalid selectors throw exceptions at attach time - // Evaluate against documentElement in case elem is a non-element node (e.g., document) - if ( selector ) { - jQuery.find.matchesSelector( documentElement, selector ); - } - - // Make sure that the handler has a unique ID, used to find/remove it later - if ( !handler.guid ) { - handler.guid = jQuery.guid++; - } - - // Init the element's event structure and main handler, if this is the first - if ( !( events = elemData.events ) ) { - events = elemData.events = {}; - } - if ( !( eventHandle = elemData.handle ) ) { - eventHandle = elemData.handle = function( e ) { - - // Discard the second event of a jQuery.event.trigger() and - // when an event is called after a page has unloaded - return typeof jQuery !== "undefined" && jQuery.event.triggered !== e.type ? - jQuery.event.dispatch.apply( elem, arguments ) : undefined; - }; - } - - // Handle multiple events separated by a space - types = ( types || "" ).match( rnothtmlwhite ) || [ "" ]; - t = types.length; - while ( t-- ) { - tmp = rtypenamespace.exec( types[ t ] ) || []; - type = origType = tmp[ 1 ]; - namespaces = ( tmp[ 2 ] || "" ).split( "." ).sort(); - - // There *must* be a type, no attaching namespace-only handlers - if ( !type ) { - continue; - } - - // If event changes its type, use the special event handlers for the changed type - special = jQuery.event.special[ type ] || {}; - - // If selector defined, determine special event api type, otherwise given type - type = ( selector ? special.delegateType : special.bindType ) || type; - - // Update special based on newly reset type - special = jQuery.event.special[ type ] || {}; - - // handleObj is passed to all event handlers - handleObj = jQuery.extend( { - type: type, - origType: origType, - data: data, - handler: handler, - guid: handler.guid, - selector: selector, - needsContext: selector && jQuery.expr.match.needsContext.test( selector ), - namespace: namespaces.join( "." ) - }, handleObjIn ); - - // Init the event handler queue if we're the first - if ( !( handlers = events[ type ] ) ) { - handlers = events[ type ] = []; - handlers.delegateCount = 0; - - // Only use addEventListener if the special events handler returns false - if ( !special.setup || - special.setup.call( elem, data, namespaces, eventHandle ) === false ) { - - if ( elem.addEventListener ) { - elem.addEventListener( type, eventHandle ); - } - } - } - - if ( special.add ) { - special.add.call( elem, handleObj ); - - if ( !handleObj.handler.guid ) { - handleObj.handler.guid = handler.guid; - } - } - - // Add to the element's handler list, delegates in front - if ( selector ) { - handlers.splice( handlers.delegateCount++, 0, handleObj ); - } else { - handlers.push( handleObj ); - } - - // Keep track of which events have ever been used, for event optimization - jQuery.event.global[ type ] = true; - } - - }, - - // Detach an event or set of events from an element - remove: function( elem, types, handler, selector, mappedTypes ) { - - var j, origCount, tmp, - events, t, handleObj, - special, handlers, type, namespaces, origType, - elemData = dataPriv.hasData( elem ) && dataPriv.get( elem ); - - if ( !elemData || !( events = elemData.events ) ) { - return; - } - - // Once for each type.namespace in types; type may be omitted - types = ( types || "" ).match( rnothtmlwhite ) || [ "" ]; - t = types.length; - while ( t-- ) { - tmp = rtypenamespace.exec( types[ t ] ) || []; - type = origType = tmp[ 1 ]; - namespaces = ( tmp[ 2 ] || "" ).split( "." ).sort(); - - // Unbind all events (on this namespace, if provided) for the element - if ( !type ) { - for ( type in events ) { - jQuery.event.remove( elem, type + types[ t ], handler, selector, true ); - } - continue; - } - - special = jQuery.event.special[ type ] || {}; - type = ( selector ? special.delegateType : special.bindType ) || type; - handlers = events[ type ] || []; - tmp = tmp[ 2 ] && - new RegExp( "(^|\\.)" + namespaces.join( "\\.(?:.*\\.|)" ) + "(\\.|$)" ); - - // Remove matching events - origCount = j = handlers.length; - while ( j-- ) { - handleObj = handlers[ j ]; - - if ( ( mappedTypes || origType === handleObj.origType ) && - ( !handler || handler.guid === handleObj.guid ) && - ( !tmp || tmp.test( handleObj.namespace ) ) && - ( !selector || selector === handleObj.selector || - selector === "**" && handleObj.selector ) ) { - handlers.splice( j, 1 ); - - if ( handleObj.selector ) { - handlers.delegateCount--; - } - if ( special.remove ) { - special.remove.call( elem, handleObj ); - } - } - } - - // Remove generic event handler if we removed something and no more handlers exist - // (avoids potential for endless recursion during removal of special event handlers) - if ( origCount && !handlers.length ) { - if ( !special.teardown || - special.teardown.call( elem, namespaces, elemData.handle ) === false ) { - - jQuery.removeEvent( elem, type, elemData.handle ); - } - - delete events[ type ]; - } - } - - // Remove data and the expando if it's no longer used - if ( jQuery.isEmptyObject( events ) ) { - dataPriv.remove( elem, "handle events" ); - } - }, - - dispatch: function( nativeEvent ) { - - // Make a writable jQuery.Event from the native event object - var event = jQuery.event.fix( nativeEvent ); - - var i, j, ret, matched, handleObj, handlerQueue, - args = new Array( arguments.length ), - handlers = ( dataPriv.get( this, "events" ) || {} )[ event.type ] || [], - special = jQuery.event.special[ event.type ] || {}; - - // Use the fix-ed jQuery.Event rather than the (read-only) native event - args[ 0 ] = event; - - for ( i = 1; i < arguments.length; i++ ) { - args[ i ] = arguments[ i ]; - } - - event.delegateTarget = this; - - // Call the preDispatch hook for the mapped type, and let it bail if desired - if ( special.preDispatch && special.preDispatch.call( this, event ) === false ) { - return; - } - - // Determine handlers - handlerQueue = jQuery.event.handlers.call( this, event, handlers ); - - // Run delegates first; they may want to stop propagation beneath us - i = 0; - while ( ( matched = handlerQueue[ i++ ] ) && !event.isPropagationStopped() ) { - event.currentTarget = matched.elem; - - j = 0; - while ( ( handleObj = matched.handlers[ j++ ] ) && - !event.isImmediatePropagationStopped() ) { - - // Triggered event must either 1) have no namespace, or 2) have namespace(s) - // a subset or equal to those in the bound event (both can have no namespace). - if ( !event.rnamespace || event.rnamespace.test( handleObj.namespace ) ) { - - event.handleObj = handleObj; - event.data = handleObj.data; - - ret = ( ( jQuery.event.special[ handleObj.origType ] || {} ).handle || - handleObj.handler ).apply( matched.elem, args ); - - if ( ret !== undefined ) { - if ( ( event.result = ret ) === false ) { - event.preventDefault(); - event.stopPropagation(); - } - } - } - } - } - - // Call the postDispatch hook for the mapped type - if ( special.postDispatch ) { - special.postDispatch.call( this, event ); - } - - return event.result; - }, - - handlers: function( event, handlers ) { - var i, handleObj, sel, matchedHandlers, matchedSelectors, - handlerQueue = [], - delegateCount = handlers.delegateCount, - cur = event.target; - - // Find delegate handlers - if ( delegateCount && - - // Support: IE <=9 - // Black-hole SVG instance trees (trac-13180) - cur.nodeType && - - // Support: Firefox <=42 - // Suppress spec-violating clicks indicating a non-primary pointer button (trac-3861) - // https://www.w3.org/TR/DOM-Level-3-Events/#event-type-click - // Support: IE 11 only - // ...but not arrow key "clicks" of radio inputs, which can have `button` -1 (gh-2343) - !( event.type === "click" && event.button >= 1 ) ) { - - for ( ; cur !== this; cur = cur.parentNode || this ) { - - // Don't check non-elements (#13208) - // Don't process clicks on disabled elements (#6911, #8165, #11382, #11764) - if ( cur.nodeType === 1 && !( event.type === "click" && cur.disabled === true ) ) { - matchedHandlers = []; - matchedSelectors = {}; - for ( i = 0; i < delegateCount; i++ ) { - handleObj = handlers[ i ]; - - // Don't conflict with Object.prototype properties (#13203) - sel = handleObj.selector + " "; - - if ( matchedSelectors[ sel ] === undefined ) { - matchedSelectors[ sel ] = handleObj.needsContext ? - jQuery( sel, this ).index( cur ) > -1 : - jQuery.find( sel, this, null, [ cur ] ).length; - } - if ( matchedSelectors[ sel ] ) { - matchedHandlers.push( handleObj ); - } - } - if ( matchedHandlers.length ) { - handlerQueue.push( { elem: cur, handlers: matchedHandlers } ); - } - } - } - } - - // Add the remaining (directly-bound) handlers - cur = this; - if ( delegateCount < handlers.length ) { - handlerQueue.push( { elem: cur, handlers: handlers.slice( delegateCount ) } ); - } - - return handlerQueue; - }, - - addProp: function( name, hook ) { - Object.defineProperty( jQuery.Event.prototype, name, { - enumerable: true, - configurable: true, - - get: jQuery.isFunction( hook ) ? - function() { - if ( this.originalEvent ) { - return hook( this.originalEvent ); - } - } : - function() { - if ( this.originalEvent ) { - return this.originalEvent[ name ]; - } - }, - - set: function( value ) { - Object.defineProperty( this, name, { - enumerable: true, - configurable: true, - writable: true, - value: value - } ); - } - } ); - }, - - fix: function( originalEvent ) { - return originalEvent[ jQuery.expando ] ? - originalEvent : - new jQuery.Event( originalEvent ); - }, - - special: { - load: { - - // Prevent triggered image.load events from bubbling to window.load - noBubble: true - }, - focus: { - - // Fire native event if possible so blur/focus sequence is correct - trigger: function() { - if ( this !== safeActiveElement() && this.focus ) { - this.focus(); - return false; - } - }, - delegateType: "focusin" - }, - blur: { - trigger: function() { - if ( this === safeActiveElement() && this.blur ) { - this.blur(); - return false; - } - }, - delegateType: "focusout" - }, - click: { - - // For checkbox, fire native event so checked state will be right - trigger: function() { - if ( this.type === "checkbox" && this.click && jQuery.nodeName( this, "input" ) ) { - this.click(); - return false; - } - }, - - // For cross-browser consistency, don't fire native .click() on links - _default: function( event ) { - return jQuery.nodeName( event.target, "a" ); - } - }, - - beforeunload: { - postDispatch: function( event ) { - - // Support: Firefox 20+ - // Firefox doesn't alert if the returnValue field is not set. - if ( event.result !== undefined && event.originalEvent ) { - event.originalEvent.returnValue = event.result; - } - } - } - } -}; - -jQuery.removeEvent = function( elem, type, handle ) { - - // This "if" is needed for plain objects - if ( elem.removeEventListener ) { - elem.removeEventListener( type, handle ); - } -}; - -jQuery.Event = function( src, props ) { - - // Allow instantiation without the 'new' keyword - if ( !( this instanceof jQuery.Event ) ) { - return new jQuery.Event( src, props ); - } - - // Event object - if ( src && src.type ) { - this.originalEvent = src; - this.type = src.type; - - // Events bubbling up the document may have been marked as prevented - // by a handler lower down the tree; reflect the correct value. - this.isDefaultPrevented = src.defaultPrevented || - src.defaultPrevented === undefined && - - // Support: Android <=2.3 only - src.returnValue === false ? - returnTrue : - returnFalse; - - // Create target properties - // Support: Safari <=6 - 7 only - // Target should not be a text node (#504, #13143) - this.target = ( src.target && src.target.nodeType === 3 ) ? - src.target.parentNode : - src.target; - - this.currentTarget = src.currentTarget; - this.relatedTarget = src.relatedTarget; - - // Event type - } else { - this.type = src; - } - - // Put explicitly provided properties onto the event object - if ( props ) { - jQuery.extend( this, props ); - } - - // Create a timestamp if incoming event doesn't have one - this.timeStamp = src && src.timeStamp || jQuery.now(); - - // Mark it as fixed - this[ jQuery.expando ] = true; -}; - -// jQuery.Event is based on DOM3 Events as specified by the ECMAScript Language Binding -// https://www.w3.org/TR/2003/WD-DOM-Level-3-Events-20030331/ecma-script-binding.html -jQuery.Event.prototype = { - constructor: jQuery.Event, - isDefaultPrevented: returnFalse, - isPropagationStopped: returnFalse, - isImmediatePropagationStopped: returnFalse, - isSimulated: false, - - preventDefault: function() { - var e = this.originalEvent; - - this.isDefaultPrevented = returnTrue; - - if ( e && !this.isSimulated ) { - e.preventDefault(); - } - }, - stopPropagation: function() { - var e = this.originalEvent; - - this.isPropagationStopped = returnTrue; - - if ( e && !this.isSimulated ) { - e.stopPropagation(); - } - }, - stopImmediatePropagation: function() { - var e = this.originalEvent; - - this.isImmediatePropagationStopped = returnTrue; - - if ( e && !this.isSimulated ) { - e.stopImmediatePropagation(); - } - - this.stopPropagation(); - } -}; - -// Includes all common event props including KeyEvent and MouseEvent specific props -jQuery.each( { - altKey: true, - bubbles: true, - cancelable: true, - changedTouches: true, - ctrlKey: true, - detail: true, - eventPhase: true, - metaKey: true, - pageX: true, - pageY: true, - shiftKey: true, - view: true, - "char": true, - charCode: true, - key: true, - keyCode: true, - button: true, - buttons: true, - clientX: true, - clientY: true, - offsetX: true, - offsetY: true, - pointerId: true, - pointerType: true, - screenX: true, - screenY: true, - targetTouches: true, - toElement: true, - touches: true, - - which: function( event ) { - var button = event.button; - - // Add which for key events - if ( event.which == null && rkeyEvent.test( event.type ) ) { - return event.charCode != null ? event.charCode : event.keyCode; - } - - // Add which for click: 1 === left; 2 === middle; 3 === right - if ( !event.which && button !== undefined && rmouseEvent.test( event.type ) ) { - if ( button & 1 ) { - return 1; - } - - if ( button & 2 ) { - return 3; - } - - if ( button & 4 ) { - return 2; - } - - return 0; - } - - return event.which; - } -}, jQuery.event.addProp ); - -// Create mouseenter/leave events using mouseover/out and event-time checks -// so that event delegation works in jQuery. -// Do the same for pointerenter/pointerleave and pointerover/pointerout -// -// Support: Safari 7 only -// Safari sends mouseenter too often; see: -// https://bugs.chromium.org/p/chromium/issues/detail?id=470258 -// for the description of the bug (it existed in older Chrome versions as well). -jQuery.each( { - mouseenter: "mouseover", - mouseleave: "mouseout", - pointerenter: "pointerover", - pointerleave: "pointerout" -}, function( orig, fix ) { - jQuery.event.special[ orig ] = { - delegateType: fix, - bindType: fix, - - handle: function( event ) { - var ret, - target = this, - related = event.relatedTarget, - handleObj = event.handleObj; - - // For mouseenter/leave call the handler if related is outside the target. - // NB: No relatedTarget if the mouse left/entered the browser window - if ( !related || ( related !== target && !jQuery.contains( target, related ) ) ) { - event.type = handleObj.origType; - ret = handleObj.handler.apply( this, arguments ); - event.type = fix; - } - return ret; - } - }; -} ); - -jQuery.fn.extend( { - - on: function( types, selector, data, fn ) { - return on( this, types, selector, data, fn ); - }, - one: function( types, selector, data, fn ) { - return on( this, types, selector, data, fn, 1 ); - }, - off: function( types, selector, fn ) { - var handleObj, type; - if ( types && types.preventDefault && types.handleObj ) { - - // ( event ) dispatched jQuery.Event - handleObj = types.handleObj; - jQuery( types.delegateTarget ).off( - handleObj.namespace ? - handleObj.origType + "." + handleObj.namespace : - handleObj.origType, - handleObj.selector, - handleObj.handler - ); - return this; - } - if ( typeof types === "object" ) { - - // ( types-object [, selector] ) - for ( type in types ) { - this.off( type, selector, types[ type ] ); - } - return this; - } - if ( selector === false || typeof selector === "function" ) { - - // ( types [, fn] ) - fn = selector; - selector = undefined; - } - if ( fn === false ) { - fn = returnFalse; - } - return this.each( function() { - jQuery.event.remove( this, types, fn, selector ); - } ); - } -} ); - - -var - - /* eslint-disable max-len */ - - // See https://github.com/eslint/eslint/issues/3229 - rxhtmlTag = /<(?!area|br|col|embed|hr|img|input|link|meta|param)(([a-z][^\/\0>\x20\t\r\n\f]*)[^>]*)\/>/gi, - - /* eslint-enable */ - - // Support: IE <=10 - 11, Edge 12 - 13 - // In IE/Edge using regex groups here causes severe slowdowns. - // See https://connect.microsoft.com/IE/feedback/details/1736512/ - rnoInnerhtml = /\s*$/g; - -function manipulationTarget( elem, content ) { - if ( jQuery.nodeName( elem, "table" ) && - jQuery.nodeName( content.nodeType !== 11 ? content : content.firstChild, "tr" ) ) { - - return elem.getElementsByTagName( "tbody" )[ 0 ] || elem; - } - - return elem; -} - -// Replace/restore the type attribute of script elements for safe DOM manipulation -function disableScript( elem ) { - elem.type = ( elem.getAttribute( "type" ) !== null ) + "/" + elem.type; - return elem; -} -function restoreScript( elem ) { - var match = rscriptTypeMasked.exec( elem.type ); - - if ( match ) { - elem.type = match[ 1 ]; - } else { - elem.removeAttribute( "type" ); - } - - return elem; -} - -function cloneCopyEvent( src, dest ) { - var i, l, type, pdataOld, pdataCur, udataOld, udataCur, events; - - if ( dest.nodeType !== 1 ) { - return; - } - - // 1. Copy private data: events, handlers, etc. - if ( dataPriv.hasData( src ) ) { - pdataOld = dataPriv.access( src ); - pdataCur = dataPriv.set( dest, pdataOld ); - events = pdataOld.events; - - if ( events ) { - delete pdataCur.handle; - pdataCur.events = {}; - - for ( type in events ) { - for ( i = 0, l = events[ type ].length; i < l; i++ ) { - jQuery.event.add( dest, type, events[ type ][ i ] ); - } - } - } - } - - // 2. Copy user data - if ( dataUser.hasData( src ) ) { - udataOld = dataUser.access( src ); - udataCur = jQuery.extend( {}, udataOld ); - - dataUser.set( dest, udataCur ); - } -} - -// Fix IE bugs, see support tests -function fixInput( src, dest ) { - var nodeName = dest.nodeName.toLowerCase(); - - // Fails to persist the checked state of a cloned checkbox or radio button. - if ( nodeName === "input" && rcheckableType.test( src.type ) ) { - dest.checked = src.checked; - - // Fails to return the selected option to the default selected state when cloning options - } else if ( nodeName === "input" || nodeName === "textarea" ) { - dest.defaultValue = src.defaultValue; - } -} - -function domManip( collection, args, callback, ignored ) { - - // Flatten any nested arrays - args = concat.apply( [], args ); - - var fragment, first, scripts, hasScripts, node, doc, - i = 0, - l = collection.length, - iNoClone = l - 1, - value = args[ 0 ], - isFunction = jQuery.isFunction( value ); - - // We can't cloneNode fragments that contain checked, in WebKit - if ( isFunction || - ( l > 1 && typeof value === "string" && - !support.checkClone && rchecked.test( value ) ) ) { - return collection.each( function( index ) { - var self = collection.eq( index ); - if ( isFunction ) { - args[ 0 ] = value.call( this, index, self.html() ); - } - domManip( self, args, callback, ignored ); - } ); - } - - if ( l ) { - fragment = buildFragment( args, collection[ 0 ].ownerDocument, false, collection, ignored ); - first = fragment.firstChild; - - if ( fragment.childNodes.length === 1 ) { - fragment = first; - } - - // Require either new content or an interest in ignored elements to invoke the callback - if ( first || ignored ) { - scripts = jQuery.map( getAll( fragment, "script" ), disableScript ); - hasScripts = scripts.length; - - // Use the original fragment for the last item - // instead of the first because it can end up - // being emptied incorrectly in certain situations (#8070). - for ( ; i < l; i++ ) { - node = fragment; - - if ( i !== iNoClone ) { - node = jQuery.clone( node, true, true ); - - // Keep references to cloned scripts for later restoration - if ( hasScripts ) { - - // Support: Android <=4.0 only, PhantomJS 1 only - // push.apply(_, arraylike) throws on ancient WebKit - jQuery.merge( scripts, getAll( node, "script" ) ); - } - } - - callback.call( collection[ i ], node, i ); - } - - if ( hasScripts ) { - doc = scripts[ scripts.length - 1 ].ownerDocument; - - // Reenable scripts - jQuery.map( scripts, restoreScript ); - - // Evaluate executable scripts on first document insertion - for ( i = 0; i < hasScripts; i++ ) { - node = scripts[ i ]; - if ( rscriptType.test( node.type || "" ) && - !dataPriv.access( node, "globalEval" ) && - jQuery.contains( doc, node ) ) { - - if ( node.src ) { - - // Optional AJAX dependency, but won't run scripts if not present - if ( jQuery._evalUrl ) { - jQuery._evalUrl( node.src ); - } - } else { - DOMEval( node.textContent.replace( rcleanScript, "" ), doc ); - } - } - } - } - } - } - - return collection; -} - -function remove( elem, selector, keepData ) { - var node, - nodes = selector ? jQuery.filter( selector, elem ) : elem, - i = 0; - - for ( ; ( node = nodes[ i ] ) != null; i++ ) { - if ( !keepData && node.nodeType === 1 ) { - jQuery.cleanData( getAll( node ) ); - } - - if ( node.parentNode ) { - if ( keepData && jQuery.contains( node.ownerDocument, node ) ) { - setGlobalEval( getAll( node, "script" ) ); - } - node.parentNode.removeChild( node ); - } - } - - return elem; -} - -jQuery.extend( { - htmlPrefilter: function( html ) { - return html.replace( rxhtmlTag, "<$1>" ); - }, - - clone: function( elem, dataAndEvents, deepDataAndEvents ) { - var i, l, srcElements, destElements, - clone = elem.cloneNode( true ), - inPage = jQuery.contains( elem.ownerDocument, elem ); - - // Fix IE cloning issues - if ( !support.noCloneChecked && ( elem.nodeType === 1 || elem.nodeType === 11 ) && - !jQuery.isXMLDoc( elem ) ) { - - // We eschew Sizzle here for performance reasons: https://jsperf.com/getall-vs-sizzle/2 - destElements = getAll( clone ); - srcElements = getAll( elem ); - - for ( i = 0, l = srcElements.length; i < l; i++ ) { - fixInput( srcElements[ i ], destElements[ i ] ); - } - } - - // Copy the events from the original to the clone - if ( dataAndEvents ) { - if ( deepDataAndEvents ) { - srcElements = srcElements || getAll( elem ); - destElements = destElements || getAll( clone ); - - for ( i = 0, l = srcElements.length; i < l; i++ ) { - cloneCopyEvent( srcElements[ i ], destElements[ i ] ); - } - } else { - cloneCopyEvent( elem, clone ); - } - } - - // Preserve script evaluation history - destElements = getAll( clone, "script" ); - if ( destElements.length > 0 ) { - setGlobalEval( destElements, !inPage && getAll( elem, "script" ) ); - } - - // Return the cloned set - return clone; - }, - - cleanData: function( elems ) { - var data, elem, type, - special = jQuery.event.special, - i = 0; - - for ( ; ( elem = elems[ i ] ) !== undefined; i++ ) { - if ( acceptData( elem ) ) { - if ( ( data = elem[ dataPriv.expando ] ) ) { - if ( data.events ) { - for ( type in data.events ) { - if ( special[ type ] ) { - jQuery.event.remove( elem, type ); - - // This is a shortcut to avoid jQuery.event.remove's overhead - } else { - jQuery.removeEvent( elem, type, data.handle ); - } - } - } - - // Support: Chrome <=35 - 45+ - // Assign undefined instead of using delete, see Data#remove - elem[ dataPriv.expando ] = undefined; - } - if ( elem[ dataUser.expando ] ) { - - // Support: Chrome <=35 - 45+ - // Assign undefined instead of using delete, see Data#remove - elem[ dataUser.expando ] = undefined; - } - } - } - } -} ); - -jQuery.fn.extend( { - detach: function( selector ) { - return remove( this, selector, true ); - }, - - remove: function( selector ) { - return remove( this, selector ); - }, - - text: function( value ) { - return access( this, function( value ) { - return value === undefined ? - jQuery.text( this ) : - this.empty().each( function() { - if ( this.nodeType === 1 || this.nodeType === 11 || this.nodeType === 9 ) { - this.textContent = value; - } - } ); - }, null, value, arguments.length ); - }, - - append: function() { - return domManip( this, arguments, function( elem ) { - if ( this.nodeType === 1 || this.nodeType === 11 || this.nodeType === 9 ) { - var target = manipulationTarget( this, elem ); - target.appendChild( elem ); - } - } ); - }, - - prepend: function() { - return domManip( this, arguments, function( elem ) { - if ( this.nodeType === 1 || this.nodeType === 11 || this.nodeType === 9 ) { - var target = manipulationTarget( this, elem ); - target.insertBefore( elem, target.firstChild ); - } - } ); - }, - - before: function() { - return domManip( this, arguments, function( elem ) { - if ( this.parentNode ) { - this.parentNode.insertBefore( elem, this ); - } - } ); - }, - - after: function() { - return domManip( this, arguments, function( elem ) { - if ( this.parentNode ) { - this.parentNode.insertBefore( elem, this.nextSibling ); - } - } ); - }, - - empty: function() { - var elem, - i = 0; - - for ( ; ( elem = this[ i ] ) != null; i++ ) { - if ( elem.nodeType === 1 ) { - - // Prevent memory leaks - jQuery.cleanData( getAll( elem, false ) ); - - // Remove any remaining nodes - elem.textContent = ""; - } - } - - return this; - }, - - clone: function( dataAndEvents, deepDataAndEvents ) { - dataAndEvents = dataAndEvents == null ? false : dataAndEvents; - deepDataAndEvents = deepDataAndEvents == null ? dataAndEvents : deepDataAndEvents; - - return this.map( function() { - return jQuery.clone( this, dataAndEvents, deepDataAndEvents ); - } ); - }, - - html: function( value ) { - return access( this, function( value ) { - var elem = this[ 0 ] || {}, - i = 0, - l = this.length; - - if ( value === undefined && elem.nodeType === 1 ) { - return elem.innerHTML; - } - - // See if we can take a shortcut and just use innerHTML - if ( typeof value === "string" && !rnoInnerhtml.test( value ) && - !wrapMap[ ( rtagName.exec( value ) || [ "", "" ] )[ 1 ].toLowerCase() ] ) { - - value = jQuery.htmlPrefilter( value ); - - try { - for ( ; i < l; i++ ) { - elem = this[ i ] || {}; - - // Remove element nodes and prevent memory leaks - if ( elem.nodeType === 1 ) { - jQuery.cleanData( getAll( elem, false ) ); - elem.innerHTML = value; - } - } - - elem = 0; - - // If using innerHTML throws an exception, use the fallback method - } catch ( e ) {} - } - - if ( elem ) { - this.empty().append( value ); - } - }, null, value, arguments.length ); - }, - - replaceWith: function() { - var ignored = []; - - // Make the changes, replacing each non-ignored context element with the new content - return domManip( this, arguments, function( elem ) { - var parent = this.parentNode; - - if ( jQuery.inArray( this, ignored ) < 0 ) { - jQuery.cleanData( getAll( this ) ); - if ( parent ) { - parent.replaceChild( elem, this ); - } - } - - // Force callback invocation - }, ignored ); - } -} ); - -jQuery.each( { - appendTo: "append", - prependTo: "prepend", - insertBefore: "before", - insertAfter: "after", - replaceAll: "replaceWith" -}, function( name, original ) { - jQuery.fn[ name ] = function( selector ) { - var elems, - ret = [], - insert = jQuery( selector ), - last = insert.length - 1, - i = 0; - - for ( ; i <= last; i++ ) { - elems = i === last ? this : this.clone( true ); - jQuery( insert[ i ] )[ original ]( elems ); - - // Support: Android <=4.0 only, PhantomJS 1 only - // .get() because push.apply(_, arraylike) throws on ancient WebKit - push.apply( ret, elems.get() ); - } - - return this.pushStack( ret ); - }; -} ); -var rmargin = ( /^margin/ ); - -var rnumnonpx = new RegExp( "^(" + pnum + ")(?!px)[a-z%]+$", "i" ); - -var getStyles = function( elem ) { - - // Support: IE <=11 only, Firefox <=30 (#15098, #14150) - // IE throws on elements created in popups - // FF meanwhile throws on frame elements through "defaultView.getComputedStyle" - var view = elem.ownerDocument.defaultView; - - if ( !view || !view.opener ) { - view = window; - } - - return view.getComputedStyle( elem ); - }; - - - -( function() { - - // Executing both pixelPosition & boxSizingReliable tests require only one layout - // so they're executed at the same time to save the second computation. - function computeStyleTests() { - - // This is a singleton, we need to execute it only once - if ( !div ) { - return; - } - - div.style.cssText = - "box-sizing:border-box;" + - "position:relative;display:block;" + - "margin:auto;border:1px;padding:1px;" + - "top:1%;width:50%"; - div.innerHTML = ""; - documentElement.appendChild( container ); - - var divStyle = window.getComputedStyle( div ); - pixelPositionVal = divStyle.top !== "1%"; - - // Support: Android 4.0 - 4.3 only, Firefox <=3 - 44 - reliableMarginLeftVal = divStyle.marginLeft === "2px"; - boxSizingReliableVal = divStyle.width === "4px"; - - // Support: Android 4.0 - 4.3 only - // Some styles come back with percentage values, even though they shouldn't - div.style.marginRight = "50%"; - pixelMarginRightVal = divStyle.marginRight === "4px"; - - documentElement.removeChild( container ); - - // Nullify the div so it wouldn't be stored in the memory and - // it will also be a sign that checks already performed - div = null; - } - - var pixelPositionVal, boxSizingReliableVal, pixelMarginRightVal, reliableMarginLeftVal, - container = document.createElement( "div" ), - div = document.createElement( "div" ); - - // Finish early in limited (non-browser) environments - if ( !div.style ) { - return; - } - - // Support: IE <=9 - 11 only - // Style of cloned element affects source element cloned (#8908) - div.style.backgroundClip = "content-box"; - div.cloneNode( true ).style.backgroundClip = ""; - support.clearCloneStyle = div.style.backgroundClip === "content-box"; - - container.style.cssText = "border:0;width:8px;height:0;top:0;left:-9999px;" + - "padding:0;margin-top:1px;position:absolute"; - container.appendChild( div ); - - jQuery.extend( support, { - pixelPosition: function() { - computeStyleTests(); - return pixelPositionVal; - }, - boxSizingReliable: function() { - computeStyleTests(); - return boxSizingReliableVal; - }, - pixelMarginRight: function() { - computeStyleTests(); - return pixelMarginRightVal; - }, - reliableMarginLeft: function() { - computeStyleTests(); - return reliableMarginLeftVal; - } - } ); -} )(); - - -function curCSS( elem, name, computed ) { - var width, minWidth, maxWidth, ret, - style = elem.style; - - computed = computed || getStyles( elem ); - - // Support: IE <=9 only - // getPropertyValue is only needed for .css('filter') (#12537) - if ( computed ) { - ret = computed.getPropertyValue( name ) || computed[ name ]; - - if ( ret === "" && !jQuery.contains( elem.ownerDocument, elem ) ) { - ret = jQuery.style( elem, name ); - } - - // A tribute to the "awesome hack by Dean Edwards" - // Android Browser returns percentage for some values, - // but width seems to be reliably pixels. - // This is against the CSSOM draft spec: - // https://drafts.csswg.org/cssom/#resolved-values - if ( !support.pixelMarginRight() && rnumnonpx.test( ret ) && rmargin.test( name ) ) { - - // Remember the original values - width = style.width; - minWidth = style.minWidth; - maxWidth = style.maxWidth; - - // Put in the new values to get a computed value out - style.minWidth = style.maxWidth = style.width = ret; - ret = computed.width; - - // Revert the changed values - style.width = width; - style.minWidth = minWidth; - style.maxWidth = maxWidth; - } - } - - return ret !== undefined ? - - // Support: IE <=9 - 11 only - // IE returns zIndex value as an integer. - ret + "" : - ret; -} - - -function addGetHookIf( conditionFn, hookFn ) { - - // Define the hook, we'll check on the first run if it's really needed. - return { - get: function() { - if ( conditionFn() ) { - - // Hook not needed (or it's not possible to use it due - // to missing dependency), remove it. - delete this.get; - return; - } - - // Hook needed; redefine it so that the support test is not executed again. - return ( this.get = hookFn ).apply( this, arguments ); - } - }; -} - - -var - - // Swappable if display is none or starts with table - // except "table", "table-cell", or "table-caption" - // See here for display values: https://developer.mozilla.org/en-US/docs/CSS/display - rdisplayswap = /^(none|table(?!-c[ea]).+)/, - cssShow = { position: "absolute", visibility: "hidden", display: "block" }, - cssNormalTransform = { - letterSpacing: "0", - fontWeight: "400" - }, - - cssPrefixes = [ "Webkit", "Moz", "ms" ], - emptyStyle = document.createElement( "div" ).style; - -// Return a css property mapped to a potentially vendor prefixed property -function vendorPropName( name ) { - - // Shortcut for names that are not vendor prefixed - if ( name in emptyStyle ) { - return name; - } - - // Check for vendor prefixed names - var capName = name[ 0 ].toUpperCase() + name.slice( 1 ), - i = cssPrefixes.length; - - while ( i-- ) { - name = cssPrefixes[ i ] + capName; - if ( name in emptyStyle ) { - return name; - } - } -} - -function setPositiveNumber( elem, value, subtract ) { - - // Any relative (+/-) values have already been - // normalized at this point - var matches = rcssNum.exec( value ); - return matches ? - - // Guard against undefined "subtract", e.g., when used as in cssHooks - Math.max( 0, matches[ 2 ] - ( subtract || 0 ) ) + ( matches[ 3 ] || "px" ) : - value; -} - -function augmentWidthOrHeight( elem, name, extra, isBorderBox, styles ) { - var i, - val = 0; - - // If we already have the right measurement, avoid augmentation - if ( extra === ( isBorderBox ? "border" : "content" ) ) { - i = 4; - - // Otherwise initialize for horizontal or vertical properties - } else { - i = name === "width" ? 1 : 0; - } - - for ( ; i < 4; i += 2 ) { - - // Both box models exclude margin, so add it if we want it - if ( extra === "margin" ) { - val += jQuery.css( elem, extra + cssExpand[ i ], true, styles ); - } - - if ( isBorderBox ) { - - // border-box includes padding, so remove it if we want content - if ( extra === "content" ) { - val -= jQuery.css( elem, "padding" + cssExpand[ i ], true, styles ); - } - - // At this point, extra isn't border nor margin, so remove border - if ( extra !== "margin" ) { - val -= jQuery.css( elem, "border" + cssExpand[ i ] + "Width", true, styles ); - } - } else { - - // At this point, extra isn't content, so add padding - val += jQuery.css( elem, "padding" + cssExpand[ i ], true, styles ); - - // At this point, extra isn't content nor padding, so add border - if ( extra !== "padding" ) { - val += jQuery.css( elem, "border" + cssExpand[ i ] + "Width", true, styles ); - } - } - } - - return val; -} - -function getWidthOrHeight( elem, name, extra ) { - - // Start with offset property, which is equivalent to the border-box value - var val, - valueIsBorderBox = true, - styles = getStyles( elem ), - isBorderBox = jQuery.css( elem, "boxSizing", false, styles ) === "border-box"; - - // Support: IE <=11 only - // Running getBoundingClientRect on a disconnected node - // in IE throws an error. - if ( elem.getClientRects().length ) { - val = elem.getBoundingClientRect()[ name ]; - } - - // Some non-html elements return undefined for offsetWidth, so check for null/undefined - // svg - https://bugzilla.mozilla.org/show_bug.cgi?id=649285 - // MathML - https://bugzilla.mozilla.org/show_bug.cgi?id=491668 - if ( val <= 0 || val == null ) { - - // Fall back to computed then uncomputed css if necessary - val = curCSS( elem, name, styles ); - if ( val < 0 || val == null ) { - val = elem.style[ name ]; - } - - // Computed unit is not pixels. Stop here and return. - if ( rnumnonpx.test( val ) ) { - return val; - } - - // Check for style in case a browser which returns unreliable values - // for getComputedStyle silently falls back to the reliable elem.style - valueIsBorderBox = isBorderBox && - ( support.boxSizingReliable() || val === elem.style[ name ] ); - - // Normalize "", auto, and prepare for extra - val = parseFloat( val ) || 0; - } - - // Use the active box-sizing model to add/subtract irrelevant styles - return ( val + - augmentWidthOrHeight( - elem, - name, - extra || ( isBorderBox ? "border" : "content" ), - valueIsBorderBox, - styles - ) - ) + "px"; -} - -jQuery.extend( { - - // Add in style property hooks for overriding the default - // behavior of getting and setting a style property - cssHooks: { - opacity: { - get: function( elem, computed ) { - if ( computed ) { - - // We should always get a number back from opacity - var ret = curCSS( elem, "opacity" ); - return ret === "" ? "1" : ret; - } - } - } - }, - - // Don't automatically add "px" to these possibly-unitless properties - cssNumber: { - "animationIterationCount": true, - "columnCount": true, - "fillOpacity": true, - "flexGrow": true, - "flexShrink": true, - "fontWeight": true, - "lineHeight": true, - "opacity": true, - "order": true, - "orphans": true, - "widows": true, - "zIndex": true, - "zoom": true - }, - - // Add in properties whose names you wish to fix before - // setting or getting the value - cssProps: { - "float": "cssFloat" - }, - - // Get and set the style property on a DOM Node - style: function( elem, name, value, extra ) { - - // Don't set styles on text and comment nodes - if ( !elem || elem.nodeType === 3 || elem.nodeType === 8 || !elem.style ) { - return; - } - - // Make sure that we're working with the right name - var ret, type, hooks, - origName = jQuery.camelCase( name ), - style = elem.style; - - name = jQuery.cssProps[ origName ] || - ( jQuery.cssProps[ origName ] = vendorPropName( origName ) || origName ); - - // Gets hook for the prefixed version, then unprefixed version - hooks = jQuery.cssHooks[ name ] || jQuery.cssHooks[ origName ]; - - // Check if we're setting a value - if ( value !== undefined ) { - type = typeof value; - - // Convert "+=" or "-=" to relative numbers (#7345) - if ( type === "string" && ( ret = rcssNum.exec( value ) ) && ret[ 1 ] ) { - value = adjustCSS( elem, name, ret ); - - // Fixes bug #9237 - type = "number"; - } - - // Make sure that null and NaN values aren't set (#7116) - if ( value == null || value !== value ) { - return; - } - - // If a number was passed in, add the unit (except for certain CSS properties) - if ( type === "number" ) { - value += ret && ret[ 3 ] || ( jQuery.cssNumber[ origName ] ? "" : "px" ); - } - - // background-* props affect original clone's values - if ( !support.clearCloneStyle && value === "" && name.indexOf( "background" ) === 0 ) { - style[ name ] = "inherit"; - } - - // If a hook was provided, use that value, otherwise just set the specified value - if ( !hooks || !( "set" in hooks ) || - ( value = hooks.set( elem, value, extra ) ) !== undefined ) { - - style[ name ] = value; - } - - } else { - - // If a hook was provided get the non-computed value from there - if ( hooks && "get" in hooks && - ( ret = hooks.get( elem, false, extra ) ) !== undefined ) { - - return ret; - } - - // Otherwise just get the value from the style object - return style[ name ]; - } - }, - - css: function( elem, name, extra, styles ) { - var val, num, hooks, - origName = jQuery.camelCase( name ); - - // Make sure that we're working with the right name - name = jQuery.cssProps[ origName ] || - ( jQuery.cssProps[ origName ] = vendorPropName( origName ) || origName ); - - // Try prefixed name followed by the unprefixed name - hooks = jQuery.cssHooks[ name ] || jQuery.cssHooks[ origName ]; - - // If a hook was provided get the computed value from there - if ( hooks && "get" in hooks ) { - val = hooks.get( elem, true, extra ); - } - - // Otherwise, if a way to get the computed value exists, use that - if ( val === undefined ) { - val = curCSS( elem, name, styles ); - } - - // Convert "normal" to computed value - if ( val === "normal" && name in cssNormalTransform ) { - val = cssNormalTransform[ name ]; - } - - // Make numeric if forced or a qualifier was provided and val looks numeric - if ( extra === "" || extra ) { - num = parseFloat( val ); - return extra === true || isFinite( num ) ? num || 0 : val; - } - return val; - } -} ); - -jQuery.each( [ "height", "width" ], function( i, name ) { - jQuery.cssHooks[ name ] = { - get: function( elem, computed, extra ) { - if ( computed ) { - - // Certain elements can have dimension info if we invisibly show them - // but it must have a current display style that would benefit - return rdisplayswap.test( jQuery.css( elem, "display" ) ) && - - // Support: Safari 8+ - // Table columns in Safari have non-zero offsetWidth & zero - // getBoundingClientRect().width unless display is changed. - // Support: IE <=11 only - // Running getBoundingClientRect on a disconnected node - // in IE throws an error. - ( !elem.getClientRects().length || !elem.getBoundingClientRect().width ) ? - swap( elem, cssShow, function() { - return getWidthOrHeight( elem, name, extra ); - } ) : - getWidthOrHeight( elem, name, extra ); - } - }, - - set: function( elem, value, extra ) { - var matches, - styles = extra && getStyles( elem ), - subtract = extra && augmentWidthOrHeight( - elem, - name, - extra, - jQuery.css( elem, "boxSizing", false, styles ) === "border-box", - styles - ); - - // Convert to pixels if value adjustment is needed - if ( subtract && ( matches = rcssNum.exec( value ) ) && - ( matches[ 3 ] || "px" ) !== "px" ) { - - elem.style[ name ] = value; - value = jQuery.css( elem, name ); - } - - return setPositiveNumber( elem, value, subtract ); - } - }; -} ); - -jQuery.cssHooks.marginLeft = addGetHookIf( support.reliableMarginLeft, - function( elem, computed ) { - if ( computed ) { - return ( parseFloat( curCSS( elem, "marginLeft" ) ) || - elem.getBoundingClientRect().left - - swap( elem, { marginLeft: 0 }, function() { - return elem.getBoundingClientRect().left; - } ) - ) + "px"; - } - } -); - -// These hooks are used by animate to expand properties -jQuery.each( { - margin: "", - padding: "", - border: "Width" -}, function( prefix, suffix ) { - jQuery.cssHooks[ prefix + suffix ] = { - expand: function( value ) { - var i = 0, - expanded = {}, - - // Assumes a single number if not a string - parts = typeof value === "string" ? value.split( " " ) : [ value ]; - - for ( ; i < 4; i++ ) { - expanded[ prefix + cssExpand[ i ] + suffix ] = - parts[ i ] || parts[ i - 2 ] || parts[ 0 ]; - } - - return expanded; - } - }; - - if ( !rmargin.test( prefix ) ) { - jQuery.cssHooks[ prefix + suffix ].set = setPositiveNumber; - } -} ); - -jQuery.fn.extend( { - css: function( name, value ) { - return access( this, function( elem, name, value ) { - var styles, len, - map = {}, - i = 0; - - if ( jQuery.isArray( name ) ) { - styles = getStyles( elem ); - len = name.length; - - for ( ; i < len; i++ ) { - map[ name[ i ] ] = jQuery.css( elem, name[ i ], false, styles ); - } - - return map; - } - - return value !== undefined ? - jQuery.style( elem, name, value ) : - jQuery.css( elem, name ); - }, name, value, arguments.length > 1 ); - } -} ); - - -function Tween( elem, options, prop, end, easing ) { - return new Tween.prototype.init( elem, options, prop, end, easing ); -} -jQuery.Tween = Tween; - -Tween.prototype = { - constructor: Tween, - init: function( elem, options, prop, end, easing, unit ) { - this.elem = elem; - this.prop = prop; - this.easing = easing || jQuery.easing._default; - this.options = options; - this.start = this.now = this.cur(); - this.end = end; - this.unit = unit || ( jQuery.cssNumber[ prop ] ? "" : "px" ); - }, - cur: function() { - var hooks = Tween.propHooks[ this.prop ]; - - return hooks && hooks.get ? - hooks.get( this ) : - Tween.propHooks._default.get( this ); - }, - run: function( percent ) { - var eased, - hooks = Tween.propHooks[ this.prop ]; - - if ( this.options.duration ) { - this.pos = eased = jQuery.easing[ this.easing ]( - percent, this.options.duration * percent, 0, 1, this.options.duration - ); - } else { - this.pos = eased = percent; - } - this.now = ( this.end - this.start ) * eased + this.start; - - if ( this.options.step ) { - this.options.step.call( this.elem, this.now, this ); - } - - if ( hooks && hooks.set ) { - hooks.set( this ); - } else { - Tween.propHooks._default.set( this ); - } - return this; - } -}; - -Tween.prototype.init.prototype = Tween.prototype; - -Tween.propHooks = { - _default: { - get: function( tween ) { - var result; - - // Use a property on the element directly when it is not a DOM element, - // or when there is no matching style property that exists. - if ( tween.elem.nodeType !== 1 || - tween.elem[ tween.prop ] != null && tween.elem.style[ tween.prop ] == null ) { - return tween.elem[ tween.prop ]; - } - - // Passing an empty string as a 3rd parameter to .css will automatically - // attempt a parseFloat and fallback to a string if the parse fails. - // Simple values such as "10px" are parsed to Float; - // complex values such as "rotate(1rad)" are returned as-is. - result = jQuery.css( tween.elem, tween.prop, "" ); - - // Empty strings, null, undefined and "auto" are converted to 0. - return !result || result === "auto" ? 0 : result; - }, - set: function( tween ) { - - // Use step hook for back compat. - // Use cssHook if its there. - // Use .style if available and use plain properties where available. - if ( jQuery.fx.step[ tween.prop ] ) { - jQuery.fx.step[ tween.prop ]( tween ); - } else if ( tween.elem.nodeType === 1 && - ( tween.elem.style[ jQuery.cssProps[ tween.prop ] ] != null || - jQuery.cssHooks[ tween.prop ] ) ) { - jQuery.style( tween.elem, tween.prop, tween.now + tween.unit ); - } else { - tween.elem[ tween.prop ] = tween.now; - } - } - } -}; - -// Support: IE <=9 only -// Panic based approach to setting things on disconnected nodes -Tween.propHooks.scrollTop = Tween.propHooks.scrollLeft = { - set: function( tween ) { - if ( tween.elem.nodeType && tween.elem.parentNode ) { - tween.elem[ tween.prop ] = tween.now; - } - } -}; - -jQuery.easing = { - linear: function( p ) { - return p; - }, - swing: function( p ) { - return 0.5 - Math.cos( p * Math.PI ) / 2; - }, - _default: "swing" -}; - -jQuery.fx = Tween.prototype.init; - -// Back compat <1.8 extension point -jQuery.fx.step = {}; - - - - -var - fxNow, timerId, - rfxtypes = /^(?:toggle|show|hide)$/, - rrun = /queueHooks$/; - -function raf() { - if ( timerId ) { - window.requestAnimationFrame( raf ); - jQuery.fx.tick(); - } -} - -// Animations created synchronously will run synchronously -function createFxNow() { - window.setTimeout( function() { - fxNow = undefined; - } ); - return ( fxNow = jQuery.now() ); -} - -// Generate parameters to create a standard animation -function genFx( type, includeWidth ) { - var which, - i = 0, - attrs = { height: type }; - - // If we include width, step value is 1 to do all cssExpand values, - // otherwise step value is 2 to skip over Left and Right - includeWidth = includeWidth ? 1 : 0; - for ( ; i < 4; i += 2 - includeWidth ) { - which = cssExpand[ i ]; - attrs[ "margin" + which ] = attrs[ "padding" + which ] = type; - } - - if ( includeWidth ) { - attrs.opacity = attrs.width = type; - } - - return attrs; -} - -function createTween( value, prop, animation ) { - var tween, - collection = ( Animation.tweeners[ prop ] || [] ).concat( Animation.tweeners[ "*" ] ), - index = 0, - length = collection.length; - for ( ; index < length; index++ ) { - if ( ( tween = collection[ index ].call( animation, prop, value ) ) ) { - - // We're done with this property - return tween; - } - } -} - -function defaultPrefilter( elem, props, opts ) { - var prop, value, toggle, hooks, oldfire, propTween, restoreDisplay, display, - isBox = "width" in props || "height" in props, - anim = this, - orig = {}, - style = elem.style, - hidden = elem.nodeType && isHiddenWithinTree( elem ), - dataShow = dataPriv.get( elem, "fxshow" ); - - // Queue-skipping animations hijack the fx hooks - if ( !opts.queue ) { - hooks = jQuery._queueHooks( elem, "fx" ); - if ( hooks.unqueued == null ) { - hooks.unqueued = 0; - oldfire = hooks.empty.fire; - hooks.empty.fire = function() { - if ( !hooks.unqueued ) { - oldfire(); - } - }; - } - hooks.unqueued++; - - anim.always( function() { - - // Ensure the complete handler is called before this completes - anim.always( function() { - hooks.unqueued--; - if ( !jQuery.queue( elem, "fx" ).length ) { - hooks.empty.fire(); - } - } ); - } ); - } - - // Detect show/hide animations - for ( prop in props ) { - value = props[ prop ]; - if ( rfxtypes.test( value ) ) { - delete props[ prop ]; - toggle = toggle || value === "toggle"; - if ( value === ( hidden ? "hide" : "show" ) ) { - - // Pretend to be hidden if this is a "show" and - // there is still data from a stopped show/hide - if ( value === "show" && dataShow && dataShow[ prop ] !== undefined ) { - hidden = true; - - // Ignore all other no-op show/hide data - } else { - continue; - } - } - orig[ prop ] = dataShow && dataShow[ prop ] || jQuery.style( elem, prop ); - } - } - - // Bail out if this is a no-op like .hide().hide() - propTween = !jQuery.isEmptyObject( props ); - if ( !propTween && jQuery.isEmptyObject( orig ) ) { - return; - } - - // Restrict "overflow" and "display" styles during box animations - if ( isBox && elem.nodeType === 1 ) { - - // Support: IE <=9 - 11, Edge 12 - 13 - // Record all 3 overflow attributes because IE does not infer the shorthand - // from identically-valued overflowX and overflowY - opts.overflow = [ style.overflow, style.overflowX, style.overflowY ]; - - // Identify a display type, preferring old show/hide data over the CSS cascade - restoreDisplay = dataShow && dataShow.display; - if ( restoreDisplay == null ) { - restoreDisplay = dataPriv.get( elem, "display" ); - } - display = jQuery.css( elem, "display" ); - if ( display === "none" ) { - if ( restoreDisplay ) { - display = restoreDisplay; - } else { - - // Get nonempty value(s) by temporarily forcing visibility - showHide( [ elem ], true ); - restoreDisplay = elem.style.display || restoreDisplay; - display = jQuery.css( elem, "display" ); - showHide( [ elem ] ); - } - } - - // Animate inline elements as inline-block - if ( display === "inline" || display === "inline-block" && restoreDisplay != null ) { - if ( jQuery.css( elem, "float" ) === "none" ) { - - // Restore the original display value at the end of pure show/hide animations - if ( !propTween ) { - anim.done( function() { - style.display = restoreDisplay; - } ); - if ( restoreDisplay == null ) { - display = style.display; - restoreDisplay = display === "none" ? "" : display; - } - } - style.display = "inline-block"; - } - } - } - - if ( opts.overflow ) { - style.overflow = "hidden"; - anim.always( function() { - style.overflow = opts.overflow[ 0 ]; - style.overflowX = opts.overflow[ 1 ]; - style.overflowY = opts.overflow[ 2 ]; - } ); - } - - // Implement show/hide animations - propTween = false; - for ( prop in orig ) { - - // General show/hide setup for this element animation - if ( !propTween ) { - if ( dataShow ) { - if ( "hidden" in dataShow ) { - hidden = dataShow.hidden; - } - } else { - dataShow = dataPriv.access( elem, "fxshow", { display: restoreDisplay } ); - } - - // Store hidden/visible for toggle so `.stop().toggle()` "reverses" - if ( toggle ) { - dataShow.hidden = !hidden; - } - - // Show elements before animating them - if ( hidden ) { - showHide( [ elem ], true ); - } - - /* eslint-disable no-loop-func */ - - anim.done( function() { - - /* eslint-enable no-loop-func */ - - // The final step of a "hide" animation is actually hiding the element - if ( !hidden ) { - showHide( [ elem ] ); - } - dataPriv.remove( elem, "fxshow" ); - for ( prop in orig ) { - jQuery.style( elem, prop, orig[ prop ] ); - } - } ); - } - - // Per-property setup - propTween = createTween( hidden ? dataShow[ prop ] : 0, prop, anim ); - if ( !( prop in dataShow ) ) { - dataShow[ prop ] = propTween.start; - if ( hidden ) { - propTween.end = propTween.start; - propTween.start = 0; - } - } - } -} - -function propFilter( props, specialEasing ) { - var index, name, easing, value, hooks; - - // camelCase, specialEasing and expand cssHook pass - for ( index in props ) { - name = jQuery.camelCase( index ); - easing = specialEasing[ name ]; - value = props[ index ]; - if ( jQuery.isArray( value ) ) { - easing = value[ 1 ]; - value = props[ index ] = value[ 0 ]; - } - - if ( index !== name ) { - props[ name ] = value; - delete props[ index ]; - } - - hooks = jQuery.cssHooks[ name ]; - if ( hooks && "expand" in hooks ) { - value = hooks.expand( value ); - delete props[ name ]; - - // Not quite $.extend, this won't overwrite existing keys. - // Reusing 'index' because we have the correct "name" - for ( index in value ) { - if ( !( index in props ) ) { - props[ index ] = value[ index ]; - specialEasing[ index ] = easing; - } - } - } else { - specialEasing[ name ] = easing; - } - } -} - -function Animation( elem, properties, options ) { - var result, - stopped, - index = 0, - length = Animation.prefilters.length, - deferred = jQuery.Deferred().always( function() { - - // Don't match elem in the :animated selector - delete tick.elem; - } ), - tick = function() { - if ( stopped ) { - return false; - } - var currentTime = fxNow || createFxNow(), - remaining = Math.max( 0, animation.startTime + animation.duration - currentTime ), - - // Support: Android 2.3 only - // Archaic crash bug won't allow us to use `1 - ( 0.5 || 0 )` (#12497) - temp = remaining / animation.duration || 0, - percent = 1 - temp, - index = 0, - length = animation.tweens.length; - - for ( ; index < length; index++ ) { - animation.tweens[ index ].run( percent ); - } - - deferred.notifyWith( elem, [ animation, percent, remaining ] ); - - if ( percent < 1 && length ) { - return remaining; - } else { - deferred.resolveWith( elem, [ animation ] ); - return false; - } - }, - animation = deferred.promise( { - elem: elem, - props: jQuery.extend( {}, properties ), - opts: jQuery.extend( true, { - specialEasing: {}, - easing: jQuery.easing._default - }, options ), - originalProperties: properties, - originalOptions: options, - startTime: fxNow || createFxNow(), - duration: options.duration, - tweens: [], - createTween: function( prop, end ) { - var tween = jQuery.Tween( elem, animation.opts, prop, end, - animation.opts.specialEasing[ prop ] || animation.opts.easing ); - animation.tweens.push( tween ); - return tween; - }, - stop: function( gotoEnd ) { - var index = 0, - - // If we are going to the end, we want to run all the tweens - // otherwise we skip this part - length = gotoEnd ? animation.tweens.length : 0; - if ( stopped ) { - return this; - } - stopped = true; - for ( ; index < length; index++ ) { - animation.tweens[ index ].run( 1 ); - } - - // Resolve when we played the last frame; otherwise, reject - if ( gotoEnd ) { - deferred.notifyWith( elem, [ animation, 1, 0 ] ); - deferred.resolveWith( elem, [ animation, gotoEnd ] ); - } else { - deferred.rejectWith( elem, [ animation, gotoEnd ] ); - } - return this; - } - } ), - props = animation.props; - - propFilter( props, animation.opts.specialEasing ); - - for ( ; index < length; index++ ) { - result = Animation.prefilters[ index ].call( animation, elem, props, animation.opts ); - if ( result ) { - if ( jQuery.isFunction( result.stop ) ) { - jQuery._queueHooks( animation.elem, animation.opts.queue ).stop = - jQuery.proxy( result.stop, result ); - } - return result; - } - } - - jQuery.map( props, createTween, animation ); - - if ( jQuery.isFunction( animation.opts.start ) ) { - animation.opts.start.call( elem, animation ); - } - - jQuery.fx.timer( - jQuery.extend( tick, { - elem: elem, - anim: animation, - queue: animation.opts.queue - } ) - ); - - // attach callbacks from options - return animation.progress( animation.opts.progress ) - .done( animation.opts.done, animation.opts.complete ) - .fail( animation.opts.fail ) - .always( animation.opts.always ); -} - -jQuery.Animation = jQuery.extend( Animation, { - - tweeners: { - "*": [ function( prop, value ) { - var tween = this.createTween( prop, value ); - adjustCSS( tween.elem, prop, rcssNum.exec( value ), tween ); - return tween; - } ] - }, - - tweener: function( props, callback ) { - if ( jQuery.isFunction( props ) ) { - callback = props; - props = [ "*" ]; - } else { - props = props.match( rnothtmlwhite ); - } - - var prop, - index = 0, - length = props.length; - - for ( ; index < length; index++ ) { - prop = props[ index ]; - Animation.tweeners[ prop ] = Animation.tweeners[ prop ] || []; - Animation.tweeners[ prop ].unshift( callback ); - } - }, - - prefilters: [ defaultPrefilter ], - - prefilter: function( callback, prepend ) { - if ( prepend ) { - Animation.prefilters.unshift( callback ); - } else { - Animation.prefilters.push( callback ); - } - } -} ); - -jQuery.speed = function( speed, easing, fn ) { - var opt = speed && typeof speed === "object" ? jQuery.extend( {}, speed ) : { - complete: fn || !fn && easing || - jQuery.isFunction( speed ) && speed, - duration: speed, - easing: fn && easing || easing && !jQuery.isFunction( easing ) && easing - }; - - // Go to the end state if fx are off or if document is hidden - if ( jQuery.fx.off || document.hidden ) { - opt.duration = 0; - - } else { - if ( typeof opt.duration !== "number" ) { - if ( opt.duration in jQuery.fx.speeds ) { - opt.duration = jQuery.fx.speeds[ opt.duration ]; - - } else { - opt.duration = jQuery.fx.speeds._default; - } - } - } - - // Normalize opt.queue - true/undefined/null -> "fx" - if ( opt.queue == null || opt.queue === true ) { - opt.queue = "fx"; - } - - // Queueing - opt.old = opt.complete; - - opt.complete = function() { - if ( jQuery.isFunction( opt.old ) ) { - opt.old.call( this ); - } - - if ( opt.queue ) { - jQuery.dequeue( this, opt.queue ); - } - }; - - return opt; -}; - -jQuery.fn.extend( { - fadeTo: function( speed, to, easing, callback ) { - - // Show any hidden elements after setting opacity to 0 - return this.filter( isHiddenWithinTree ).css( "opacity", 0 ).show() - - // Animate to the value specified - .end().animate( { opacity: to }, speed, easing, callback ); - }, - animate: function( prop, speed, easing, callback ) { - var empty = jQuery.isEmptyObject( prop ), - optall = jQuery.speed( speed, easing, callback ), - doAnimation = function() { - - // Operate on a copy of prop so per-property easing won't be lost - var anim = Animation( this, jQuery.extend( {}, prop ), optall ); - - // Empty animations, or finishing resolves immediately - if ( empty || dataPriv.get( this, "finish" ) ) { - anim.stop( true ); - } - }; - doAnimation.finish = doAnimation; - - return empty || optall.queue === false ? - this.each( doAnimation ) : - this.queue( optall.queue, doAnimation ); - }, - stop: function( type, clearQueue, gotoEnd ) { - var stopQueue = function( hooks ) { - var stop = hooks.stop; - delete hooks.stop; - stop( gotoEnd ); - }; - - if ( typeof type !== "string" ) { - gotoEnd = clearQueue; - clearQueue = type; - type = undefined; - } - if ( clearQueue && type !== false ) { - this.queue( type || "fx", [] ); - } - - return this.each( function() { - var dequeue = true, - index = type != null && type + "queueHooks", - timers = jQuery.timers, - data = dataPriv.get( this ); - - if ( index ) { - if ( data[ index ] && data[ index ].stop ) { - stopQueue( data[ index ] ); - } - } else { - for ( index in data ) { - if ( data[ index ] && data[ index ].stop && rrun.test( index ) ) { - stopQueue( data[ index ] ); - } - } - } - - for ( index = timers.length; index--; ) { - if ( timers[ index ].elem === this && - ( type == null || timers[ index ].queue === type ) ) { - - timers[ index ].anim.stop( gotoEnd ); - dequeue = false; - timers.splice( index, 1 ); - } - } - - // Start the next in the queue if the last step wasn't forced. - // Timers currently will call their complete callbacks, which - // will dequeue but only if they were gotoEnd. - if ( dequeue || !gotoEnd ) { - jQuery.dequeue( this, type ); - } - } ); - }, - finish: function( type ) { - if ( type !== false ) { - type = type || "fx"; - } - return this.each( function() { - var index, - data = dataPriv.get( this ), - queue = data[ type + "queue" ], - hooks = data[ type + "queueHooks" ], - timers = jQuery.timers, - length = queue ? queue.length : 0; - - // Enable finishing flag on private data - data.finish = true; - - // Empty the queue first - jQuery.queue( this, type, [] ); - - if ( hooks && hooks.stop ) { - hooks.stop.call( this, true ); - } - - // Look for any active animations, and finish them - for ( index = timers.length; index--; ) { - if ( timers[ index ].elem === this && timers[ index ].queue === type ) { - timers[ index ].anim.stop( true ); - timers.splice( index, 1 ); - } - } - - // Look for any animations in the old queue and finish them - for ( index = 0; index < length; index++ ) { - if ( queue[ index ] && queue[ index ].finish ) { - queue[ index ].finish.call( this ); - } - } - - // Turn off finishing flag - delete data.finish; - } ); - } -} ); - -jQuery.each( [ "toggle", "show", "hide" ], function( i, name ) { - var cssFn = jQuery.fn[ name ]; - jQuery.fn[ name ] = function( speed, easing, callback ) { - return speed == null || typeof speed === "boolean" ? - cssFn.apply( this, arguments ) : - this.animate( genFx( name, true ), speed, easing, callback ); - }; -} ); - -// Generate shortcuts for custom animations -jQuery.each( { - slideDown: genFx( "show" ), - slideUp: genFx( "hide" ), - slideToggle: genFx( "toggle" ), - fadeIn: { opacity: "show" }, - fadeOut: { opacity: "hide" }, - fadeToggle: { opacity: "toggle" } -}, function( name, props ) { - jQuery.fn[ name ] = function( speed, easing, callback ) { - return this.animate( props, speed, easing, callback ); - }; -} ); - -jQuery.timers = []; -jQuery.fx.tick = function() { - var timer, - i = 0, - timers = jQuery.timers; - - fxNow = jQuery.now(); - - for ( ; i < timers.length; i++ ) { - timer = timers[ i ]; - - // Checks the timer has not already been removed - if ( !timer() && timers[ i ] === timer ) { - timers.splice( i--, 1 ); - } - } - - if ( !timers.length ) { - jQuery.fx.stop(); - } - fxNow = undefined; -}; - -jQuery.fx.timer = function( timer ) { - jQuery.timers.push( timer ); - if ( timer() ) { - jQuery.fx.start(); - } else { - jQuery.timers.pop(); - } -}; - -jQuery.fx.interval = 13; -jQuery.fx.start = function() { - if ( !timerId ) { - timerId = window.requestAnimationFrame ? - window.requestAnimationFrame( raf ) : - window.setInterval( jQuery.fx.tick, jQuery.fx.interval ); - } -}; - -jQuery.fx.stop = function() { - if ( window.cancelAnimationFrame ) { - window.cancelAnimationFrame( timerId ); - } else { - window.clearInterval( timerId ); - } - - timerId = null; -}; - -jQuery.fx.speeds = { - slow: 600, - fast: 200, - - // Default speed - _default: 400 -}; - - -// Based off of the plugin by Clint Helfers, with permission. -// https://web.archive.org/web/20100324014747/http://blindsignals.com/index.php/2009/07/jquery-delay/ -jQuery.fn.delay = function( time, type ) { - time = jQuery.fx ? jQuery.fx.speeds[ time ] || time : time; - type = type || "fx"; - - return this.queue( type, function( next, hooks ) { - var timeout = window.setTimeout( next, time ); - hooks.stop = function() { - window.clearTimeout( timeout ); - }; - } ); -}; - - -( function() { - var input = document.createElement( "input" ), - select = document.createElement( "select" ), - opt = select.appendChild( document.createElement( "option" ) ); - - input.type = "checkbox"; - - // Support: Android <=4.3 only - // Default value for a checkbox should be "on" - support.checkOn = input.value !== ""; - - // Support: IE <=11 only - // Must access selectedIndex to make default options select - support.optSelected = opt.selected; - - // Support: IE <=11 only - // An input loses its value after becoming a radio - input = document.createElement( "input" ); - input.value = "t"; - input.type = "radio"; - support.radioValue = input.value === "t"; -} )(); - - -var boolHook, - attrHandle = jQuery.expr.attrHandle; - -jQuery.fn.extend( { - attr: function( name, value ) { - return access( this, jQuery.attr, name, value, arguments.length > 1 ); - }, - - removeAttr: function( name ) { - return this.each( function() { - jQuery.removeAttr( this, name ); - } ); - } -} ); - -jQuery.extend( { - attr: function( elem, name, value ) { - var ret, hooks, - nType = elem.nodeType; - - // Don't get/set attributes on text, comment and attribute nodes - if ( nType === 3 || nType === 8 || nType === 2 ) { - return; - } - - // Fallback to prop when attributes are not supported - if ( typeof elem.getAttribute === "undefined" ) { - return jQuery.prop( elem, name, value ); - } - - // Attribute hooks are determined by the lowercase version - // Grab necessary hook if one is defined - if ( nType !== 1 || !jQuery.isXMLDoc( elem ) ) { - hooks = jQuery.attrHooks[ name.toLowerCase() ] || - ( jQuery.expr.match.bool.test( name ) ? boolHook : undefined ); - } - - if ( value !== undefined ) { - if ( value === null ) { - jQuery.removeAttr( elem, name ); - return; - } - - if ( hooks && "set" in hooks && - ( ret = hooks.set( elem, value, name ) ) !== undefined ) { - return ret; - } - - elem.setAttribute( name, value + "" ); - return value; - } - - if ( hooks && "get" in hooks && ( ret = hooks.get( elem, name ) ) !== null ) { - return ret; - } - - ret = jQuery.find.attr( elem, name ); - - // Non-existent attributes return null, we normalize to undefined - return ret == null ? undefined : ret; - }, - - attrHooks: { - type: { - set: function( elem, value ) { - if ( !support.radioValue && value === "radio" && - jQuery.nodeName( elem, "input" ) ) { - var val = elem.value; - elem.setAttribute( "type", value ); - if ( val ) { - elem.value = val; - } - return value; - } - } - } - }, - - removeAttr: function( elem, value ) { - var name, - i = 0, - - // Attribute names can contain non-HTML whitespace characters - // https://html.spec.whatwg.org/multipage/syntax.html#attributes-2 - attrNames = value && value.match( rnothtmlwhite ); - - if ( attrNames && elem.nodeType === 1 ) { - while ( ( name = attrNames[ i++ ] ) ) { - elem.removeAttribute( name ); - } - } - } -} ); - -// Hooks for boolean attributes -boolHook = { - set: function( elem, value, name ) { - if ( value === false ) { - - // Remove boolean attributes when set to false - jQuery.removeAttr( elem, name ); - } else { - elem.setAttribute( name, name ); - } - return name; - } -}; - -jQuery.each( jQuery.expr.match.bool.source.match( /\w+/g ), function( i, name ) { - var getter = attrHandle[ name ] || jQuery.find.attr; - - attrHandle[ name ] = function( elem, name, isXML ) { - var ret, handle, - lowercaseName = name.toLowerCase(); - - if ( !isXML ) { - - // Avoid an infinite loop by temporarily removing this function from the getter - handle = attrHandle[ lowercaseName ]; - attrHandle[ lowercaseName ] = ret; - ret = getter( elem, name, isXML ) != null ? - lowercaseName : - null; - attrHandle[ lowercaseName ] = handle; - } - return ret; - }; -} ); - - - - -var rfocusable = /^(?:input|select|textarea|button)$/i, - rclickable = /^(?:a|area)$/i; - -jQuery.fn.extend( { - prop: function( name, value ) { - return access( this, jQuery.prop, name, value, arguments.length > 1 ); - }, - - removeProp: function( name ) { - return this.each( function() { - delete this[ jQuery.propFix[ name ] || name ]; - } ); - } -} ); - -jQuery.extend( { - prop: function( elem, name, value ) { - var ret, hooks, - nType = elem.nodeType; - - // Don't get/set properties on text, comment and attribute nodes - if ( nType === 3 || nType === 8 || nType === 2 ) { - return; - } - - if ( nType !== 1 || !jQuery.isXMLDoc( elem ) ) { - - // Fix name and attach hooks - name = jQuery.propFix[ name ] || name; - hooks = jQuery.propHooks[ name ]; - } - - if ( value !== undefined ) { - if ( hooks && "set" in hooks && - ( ret = hooks.set( elem, value, name ) ) !== undefined ) { - return ret; - } - - return ( elem[ name ] = value ); - } - - if ( hooks && "get" in hooks && ( ret = hooks.get( elem, name ) ) !== null ) { - return ret; - } - - return elem[ name ]; - }, - - propHooks: { - tabIndex: { - get: function( elem ) { - - // Support: IE <=9 - 11 only - // elem.tabIndex doesn't always return the - // correct value when it hasn't been explicitly set - // https://web.archive.org/web/20141116233347/http://fluidproject.org/blog/2008/01/09/getting-setting-and-removing-tabindex-values-with-javascript/ - // Use proper attribute retrieval(#12072) - var tabindex = jQuery.find.attr( elem, "tabindex" ); - - if ( tabindex ) { - return parseInt( tabindex, 10 ); - } - - if ( - rfocusable.test( elem.nodeName ) || - rclickable.test( elem.nodeName ) && - elem.href - ) { - return 0; - } - - return -1; - } - } - }, - - propFix: { - "for": "htmlFor", - "class": "className" - } -} ); - -// Support: IE <=11 only -// Accessing the selectedIndex property -// forces the browser to respect setting selected -// on the option -// The getter ensures a default option is selected -// when in an optgroup -// eslint rule "no-unused-expressions" is disabled for this code -// since it considers such accessions noop -if ( !support.optSelected ) { - jQuery.propHooks.selected = { - get: function( elem ) { - - /* eslint no-unused-expressions: "off" */ - - var parent = elem.parentNode; - if ( parent && parent.parentNode ) { - parent.parentNode.selectedIndex; - } - return null; - }, - set: function( elem ) { - - /* eslint no-unused-expressions: "off" */ - - var parent = elem.parentNode; - if ( parent ) { - parent.selectedIndex; - - if ( parent.parentNode ) { - parent.parentNode.selectedIndex; - } - } - } - }; -} - -jQuery.each( [ - "tabIndex", - "readOnly", - "maxLength", - "cellSpacing", - "cellPadding", - "rowSpan", - "colSpan", - "useMap", - "frameBorder", - "contentEditable" -], function() { - jQuery.propFix[ this.toLowerCase() ] = this; -} ); - - - - - // Strip and collapse whitespace according to HTML spec - // https://html.spec.whatwg.org/multipage/infrastructure.html#strip-and-collapse-whitespace - function stripAndCollapse( value ) { - var tokens = value.match( rnothtmlwhite ) || []; - return tokens.join( " " ); - } - - -function getClass( elem ) { - return elem.getAttribute && elem.getAttribute( "class" ) || ""; -} - -jQuery.fn.extend( { - addClass: function( value ) { - var classes, elem, cur, curValue, clazz, j, finalValue, - i = 0; - - if ( jQuery.isFunction( value ) ) { - return this.each( function( j ) { - jQuery( this ).addClass( value.call( this, j, getClass( this ) ) ); - } ); - } - - if ( typeof value === "string" && value ) { - classes = value.match( rnothtmlwhite ) || []; - - while ( ( elem = this[ i++ ] ) ) { - curValue = getClass( elem ); - cur = elem.nodeType === 1 && ( " " + stripAndCollapse( curValue ) + " " ); - - if ( cur ) { - j = 0; - while ( ( clazz = classes[ j++ ] ) ) { - if ( cur.indexOf( " " + clazz + " " ) < 0 ) { - cur += clazz + " "; - } - } - - // Only assign if different to avoid unneeded rendering. - finalValue = stripAndCollapse( cur ); - if ( curValue !== finalValue ) { - elem.setAttribute( "class", finalValue ); - } - } - } - } - - return this; - }, - - removeClass: function( value ) { - var classes, elem, cur, curValue, clazz, j, finalValue, - i = 0; - - if ( jQuery.isFunction( value ) ) { - return this.each( function( j ) { - jQuery( this ).removeClass( value.call( this, j, getClass( this ) ) ); - } ); - } - - if ( !arguments.length ) { - return this.attr( "class", "" ); - } - - if ( typeof value === "string" && value ) { - classes = value.match( rnothtmlwhite ) || []; - - while ( ( elem = this[ i++ ] ) ) { - curValue = getClass( elem ); - - // This expression is here for better compressibility (see addClass) - cur = elem.nodeType === 1 && ( " " + stripAndCollapse( curValue ) + " " ); - - if ( cur ) { - j = 0; - while ( ( clazz = classes[ j++ ] ) ) { - - // Remove *all* instances - while ( cur.indexOf( " " + clazz + " " ) > -1 ) { - cur = cur.replace( " " + clazz + " ", " " ); - } - } - - // Only assign if different to avoid unneeded rendering. - finalValue = stripAndCollapse( cur ); - if ( curValue !== finalValue ) { - elem.setAttribute( "class", finalValue ); - } - } - } - } - - return this; - }, - - toggleClass: function( value, stateVal ) { - var type = typeof value; - - if ( typeof stateVal === "boolean" && type === "string" ) { - return stateVal ? this.addClass( value ) : this.removeClass( value ); - } - - if ( jQuery.isFunction( value ) ) { - return this.each( function( i ) { - jQuery( this ).toggleClass( - value.call( this, i, getClass( this ), stateVal ), - stateVal - ); - } ); - } - - return this.each( function() { - var className, i, self, classNames; - - if ( type === "string" ) { - - // Toggle individual class names - i = 0; - self = jQuery( this ); - classNames = value.match( rnothtmlwhite ) || []; - - while ( ( className = classNames[ i++ ] ) ) { - - // Check each className given, space separated list - if ( self.hasClass( className ) ) { - self.removeClass( className ); - } else { - self.addClass( className ); - } - } - - // Toggle whole class name - } else if ( value === undefined || type === "boolean" ) { - className = getClass( this ); - if ( className ) { - - // Store className if set - dataPriv.set( this, "__className__", className ); - } - - // If the element has a class name or if we're passed `false`, - // then remove the whole classname (if there was one, the above saved it). - // Otherwise bring back whatever was previously saved (if anything), - // falling back to the empty string if nothing was stored. - if ( this.setAttribute ) { - this.setAttribute( "class", - className || value === false ? - "" : - dataPriv.get( this, "__className__" ) || "" - ); - } - } - } ); - }, - - hasClass: function( selector ) { - var className, elem, - i = 0; - - className = " " + selector + " "; - while ( ( elem = this[ i++ ] ) ) { - if ( elem.nodeType === 1 && - ( " " + stripAndCollapse( getClass( elem ) ) + " " ).indexOf( className ) > -1 ) { - return true; - } - } - - return false; - } -} ); - - - - -var rreturn = /\r/g; - -jQuery.fn.extend( { - val: function( value ) { - var hooks, ret, isFunction, - elem = this[ 0 ]; - - if ( !arguments.length ) { - if ( elem ) { - hooks = jQuery.valHooks[ elem.type ] || - jQuery.valHooks[ elem.nodeName.toLowerCase() ]; - - if ( hooks && - "get" in hooks && - ( ret = hooks.get( elem, "value" ) ) !== undefined - ) { - return ret; - } - - ret = elem.value; - - // Handle most common string cases - if ( typeof ret === "string" ) { - return ret.replace( rreturn, "" ); - } - - // Handle cases where value is null/undef or number - return ret == null ? "" : ret; - } - - return; - } - - isFunction = jQuery.isFunction( value ); - - return this.each( function( i ) { - var val; - - if ( this.nodeType !== 1 ) { - return; - } - - if ( isFunction ) { - val = value.call( this, i, jQuery( this ).val() ); - } else { - val = value; - } - - // Treat null/undefined as ""; convert numbers to string - if ( val == null ) { - val = ""; - - } else if ( typeof val === "number" ) { - val += ""; - - } else if ( jQuery.isArray( val ) ) { - val = jQuery.map( val, function( value ) { - return value == null ? "" : value + ""; - } ); - } - - hooks = jQuery.valHooks[ this.type ] || jQuery.valHooks[ this.nodeName.toLowerCase() ]; - - // If set returns undefined, fall back to normal setting - if ( !hooks || !( "set" in hooks ) || hooks.set( this, val, "value" ) === undefined ) { - this.value = val; - } - } ); - } -} ); - -jQuery.extend( { - valHooks: { - option: { - get: function( elem ) { - - var val = jQuery.find.attr( elem, "value" ); - return val != null ? - val : - - // Support: IE <=10 - 11 only - // option.text throws exceptions (#14686, #14858) - // Strip and collapse whitespace - // https://html.spec.whatwg.org/#strip-and-collapse-whitespace - stripAndCollapse( jQuery.text( elem ) ); - } - }, - select: { - get: function( elem ) { - var value, option, i, - options = elem.options, - index = elem.selectedIndex, - one = elem.type === "select-one", - values = one ? null : [], - max = one ? index + 1 : options.length; - - if ( index < 0 ) { - i = max; - - } else { - i = one ? index : 0; - } - - // Loop through all the selected options - for ( ; i < max; i++ ) { - option = options[ i ]; - - // Support: IE <=9 only - // IE8-9 doesn't update selected after form reset (#2551) - if ( ( option.selected || i === index ) && - - // Don't return options that are disabled or in a disabled optgroup - !option.disabled && - ( !option.parentNode.disabled || - !jQuery.nodeName( option.parentNode, "optgroup" ) ) ) { - - // Get the specific value for the option - value = jQuery( option ).val(); - - // We don't need an array for one selects - if ( one ) { - return value; - } - - // Multi-Selects return an array - values.push( value ); - } - } - - return values; - }, - - set: function( elem, value ) { - var optionSet, option, - options = elem.options, - values = jQuery.makeArray( value ), - i = options.length; - - while ( i-- ) { - option = options[ i ]; - - /* eslint-disable no-cond-assign */ - - if ( option.selected = - jQuery.inArray( jQuery.valHooks.option.get( option ), values ) > -1 - ) { - optionSet = true; - } - - /* eslint-enable no-cond-assign */ - } - - // Force browsers to behave consistently when non-matching value is set - if ( !optionSet ) { - elem.selectedIndex = -1; - } - return values; - } - } - } -} ); - -// Radios and checkboxes getter/setter -jQuery.each( [ "radio", "checkbox" ], function() { - jQuery.valHooks[ this ] = { - set: function( elem, value ) { - if ( jQuery.isArray( value ) ) { - return ( elem.checked = jQuery.inArray( jQuery( elem ).val(), value ) > -1 ); - } - } - }; - if ( !support.checkOn ) { - jQuery.valHooks[ this ].get = function( elem ) { - return elem.getAttribute( "value" ) === null ? "on" : elem.value; - }; - } -} ); - - - - -// Return jQuery for attributes-only inclusion - - -var rfocusMorph = /^(?:focusinfocus|focusoutblur)$/; - -jQuery.extend( jQuery.event, { - - trigger: function( event, data, elem, onlyHandlers ) { - - var i, cur, tmp, bubbleType, ontype, handle, special, - eventPath = [ elem || document ], - type = hasOwn.call( event, "type" ) ? event.type : event, - namespaces = hasOwn.call( event, "namespace" ) ? event.namespace.split( "." ) : []; - - cur = tmp = elem = elem || document; - - // Don't do events on text and comment nodes - if ( elem.nodeType === 3 || elem.nodeType === 8 ) { - return; - } - - // focus/blur morphs to focusin/out; ensure we're not firing them right now - if ( rfocusMorph.test( type + jQuery.event.triggered ) ) { - return; - } - - if ( type.indexOf( "." ) > -1 ) { - - // Namespaced trigger; create a regexp to match event type in handle() - namespaces = type.split( "." ); - type = namespaces.shift(); - namespaces.sort(); - } - ontype = type.indexOf( ":" ) < 0 && "on" + type; - - // Caller can pass in a jQuery.Event object, Object, or just an event type string - event = event[ jQuery.expando ] ? - event : - new jQuery.Event( type, typeof event === "object" && event ); - - // Trigger bitmask: & 1 for native handlers; & 2 for jQuery (always true) - event.isTrigger = onlyHandlers ? 2 : 3; - event.namespace = namespaces.join( "." ); - event.rnamespace = event.namespace ? - new RegExp( "(^|\\.)" + namespaces.join( "\\.(?:.*\\.|)" ) + "(\\.|$)" ) : - null; - - // Clean up the event in case it is being reused - event.result = undefined; - if ( !event.target ) { - event.target = elem; - } - - // Clone any incoming data and prepend the event, creating the handler arg list - data = data == null ? - [ event ] : - jQuery.makeArray( data, [ event ] ); - - // Allow special events to draw outside the lines - special = jQuery.event.special[ type ] || {}; - if ( !onlyHandlers && special.trigger && special.trigger.apply( elem, data ) === false ) { - return; - } - - // Determine event propagation path in advance, per W3C events spec (#9951) - // Bubble up to document, then to window; watch for a global ownerDocument var (#9724) - if ( !onlyHandlers && !special.noBubble && !jQuery.isWindow( elem ) ) { - - bubbleType = special.delegateType || type; - if ( !rfocusMorph.test( bubbleType + type ) ) { - cur = cur.parentNode; - } - for ( ; cur; cur = cur.parentNode ) { - eventPath.push( cur ); - tmp = cur; - } - - // Only add window if we got to document (e.g., not plain obj or detached DOM) - if ( tmp === ( elem.ownerDocument || document ) ) { - eventPath.push( tmp.defaultView || tmp.parentWindow || window ); - } - } - - // Fire handlers on the event path - i = 0; - while ( ( cur = eventPath[ i++ ] ) && !event.isPropagationStopped() ) { - - event.type = i > 1 ? - bubbleType : - special.bindType || type; - - // jQuery handler - handle = ( dataPriv.get( cur, "events" ) || {} )[ event.type ] && - dataPriv.get( cur, "handle" ); - if ( handle ) { - handle.apply( cur, data ); - } - - // Native handler - handle = ontype && cur[ ontype ]; - if ( handle && handle.apply && acceptData( cur ) ) { - event.result = handle.apply( cur, data ); - if ( event.result === false ) { - event.preventDefault(); - } - } - } - event.type = type; - - // If nobody prevented the default action, do it now - if ( !onlyHandlers && !event.isDefaultPrevented() ) { - - if ( ( !special._default || - special._default.apply( eventPath.pop(), data ) === false ) && - acceptData( elem ) ) { - - // Call a native DOM method on the target with the same name as the event. - // Don't do default actions on window, that's where global variables be (#6170) - if ( ontype && jQuery.isFunction( elem[ type ] ) && !jQuery.isWindow( elem ) ) { - - // Don't re-trigger an onFOO event when we call its FOO() method - tmp = elem[ ontype ]; - - if ( tmp ) { - elem[ ontype ] = null; - } - - // Prevent re-triggering of the same event, since we already bubbled it above - jQuery.event.triggered = type; - elem[ type ](); - jQuery.event.triggered = undefined; - - if ( tmp ) { - elem[ ontype ] = tmp; - } - } - } - } - - return event.result; - }, - - // Piggyback on a donor event to simulate a different one - // Used only for `focus(in | out)` events - simulate: function( type, elem, event ) { - var e = jQuery.extend( - new jQuery.Event(), - event, - { - type: type, - isSimulated: true - } - ); - - jQuery.event.trigger( e, null, elem ); - } - -} ); - -jQuery.fn.extend( { - - trigger: function( type, data ) { - return this.each( function() { - jQuery.event.trigger( type, data, this ); - } ); - }, - triggerHandler: function( type, data ) { - var elem = this[ 0 ]; - if ( elem ) { - return jQuery.event.trigger( type, data, elem, true ); - } - } -} ); - - -jQuery.each( ( "blur focus focusin focusout resize scroll click dblclick " + - "mousedown mouseup mousemove mouseover mouseout mouseenter mouseleave " + - "change select submit keydown keypress keyup contextmenu" ).split( " " ), - function( i, name ) { - - // Handle event binding - jQuery.fn[ name ] = function( data, fn ) { - return arguments.length > 0 ? - this.on( name, null, data, fn ) : - this.trigger( name ); - }; -} ); - -jQuery.fn.extend( { - hover: function( fnOver, fnOut ) { - return this.mouseenter( fnOver ).mouseleave( fnOut || fnOver ); - } -} ); - - - - -support.focusin = "onfocusin" in window; - - -// Support: Firefox <=44 -// Firefox doesn't have focus(in | out) events -// Related ticket - https://bugzilla.mozilla.org/show_bug.cgi?id=687787 -// -// Support: Chrome <=48 - 49, Safari <=9.0 - 9.1 -// focus(in | out) events fire after focus & blur events, -// which is spec violation - http://www.w3.org/TR/DOM-Level-3-Events/#events-focusevent-event-order -// Related ticket - https://bugs.chromium.org/p/chromium/issues/detail?id=449857 -if ( !support.focusin ) { - jQuery.each( { focus: "focusin", blur: "focusout" }, function( orig, fix ) { - - // Attach a single capturing handler on the document while someone wants focusin/focusout - var handler = function( event ) { - jQuery.event.simulate( fix, event.target, jQuery.event.fix( event ) ); - }; - - jQuery.event.special[ fix ] = { - setup: function() { - var doc = this.ownerDocument || this, - attaches = dataPriv.access( doc, fix ); - - if ( !attaches ) { - doc.addEventListener( orig, handler, true ); - } - dataPriv.access( doc, fix, ( attaches || 0 ) + 1 ); - }, - teardown: function() { - var doc = this.ownerDocument || this, - attaches = dataPriv.access( doc, fix ) - 1; - - if ( !attaches ) { - doc.removeEventListener( orig, handler, true ); - dataPriv.remove( doc, fix ); - - } else { - dataPriv.access( doc, fix, attaches ); - } - } - }; - } ); -} -var location = window.location; - -var nonce = jQuery.now(); - -var rquery = ( /\?/ ); - - - -// Cross-browser xml parsing -jQuery.parseXML = function( data ) { - var xml; - if ( !data || typeof data !== "string" ) { - return null; - } - - // Support: IE 9 - 11 only - // IE throws on parseFromString with invalid input. - try { - xml = ( new window.DOMParser() ).parseFromString( data, "text/xml" ); - } catch ( e ) { - xml = undefined; - } - - if ( !xml || xml.getElementsByTagName( "parsererror" ).length ) { - jQuery.error( "Invalid XML: " + data ); - } - return xml; -}; - - -var - rbracket = /\[\]$/, - rCRLF = /\r?\n/g, - rsubmitterTypes = /^(?:submit|button|image|reset|file)$/i, - rsubmittable = /^(?:input|select|textarea|keygen)/i; - -function buildParams( prefix, obj, traditional, add ) { - var name; - - if ( jQuery.isArray( obj ) ) { - - // Serialize array item. - jQuery.each( obj, function( i, v ) { - if ( traditional || rbracket.test( prefix ) ) { - - // Treat each array item as a scalar. - add( prefix, v ); - - } else { - - // Item is non-scalar (array or object), encode its numeric index. - buildParams( - prefix + "[" + ( typeof v === "object" && v != null ? i : "" ) + "]", - v, - traditional, - add - ); - } - } ); - - } else if ( !traditional && jQuery.type( obj ) === "object" ) { - - // Serialize object item. - for ( name in obj ) { - buildParams( prefix + "[" + name + "]", obj[ name ], traditional, add ); - } - - } else { - - // Serialize scalar item. - add( prefix, obj ); - } -} - -// Serialize an array of form elements or a set of -// key/values into a query string -jQuery.param = function( a, traditional ) { - var prefix, - s = [], - add = function( key, valueOrFunction ) { - - // If value is a function, invoke it and use its return value - var value = jQuery.isFunction( valueOrFunction ) ? - valueOrFunction() : - valueOrFunction; - - s[ s.length ] = encodeURIComponent( key ) + "=" + - encodeURIComponent( value == null ? "" : value ); - }; - - // If an array was passed in, assume that it is an array of form elements. - if ( jQuery.isArray( a ) || ( a.jquery && !jQuery.isPlainObject( a ) ) ) { - - // Serialize the form elements - jQuery.each( a, function() { - add( this.name, this.value ); - } ); - - } else { - - // If traditional, encode the "old" way (the way 1.3.2 or older - // did it), otherwise encode params recursively. - for ( prefix in a ) { - buildParams( prefix, a[ prefix ], traditional, add ); - } - } - - // Return the resulting serialization - return s.join( "&" ); -}; - -jQuery.fn.extend( { - serialize: function() { - return jQuery.param( this.serializeArray() ); - }, - serializeArray: function() { - return this.map( function() { - - // Can add propHook for "elements" to filter or add form elements - var elements = jQuery.prop( this, "elements" ); - return elements ? jQuery.makeArray( elements ) : this; - } ) - .filter( function() { - var type = this.type; - - // Use .is( ":disabled" ) so that fieldset[disabled] works - return this.name && !jQuery( this ).is( ":disabled" ) && - rsubmittable.test( this.nodeName ) && !rsubmitterTypes.test( type ) && - ( this.checked || !rcheckableType.test( type ) ); - } ) - .map( function( i, elem ) { - var val = jQuery( this ).val(); - - if ( val == null ) { - return null; - } - - if ( jQuery.isArray( val ) ) { - return jQuery.map( val, function( val ) { - return { name: elem.name, value: val.replace( rCRLF, "\r\n" ) }; - } ); - } - - return { name: elem.name, value: val.replace( rCRLF, "\r\n" ) }; - } ).get(); - } -} ); - - -var - r20 = /%20/g, - rhash = /#.*$/, - rantiCache = /([?&])_=[^&]*/, - rheaders = /^(.*?):[ \t]*([^\r\n]*)$/mg, - - // #7653, #8125, #8152: local protocol detection - rlocalProtocol = /^(?:about|app|app-storage|.+-extension|file|res|widget):$/, - rnoContent = /^(?:GET|HEAD)$/, - rprotocol = /^\/\//, - - /* Prefilters - * 1) They are useful to introduce custom dataTypes (see ajax/jsonp.js for an example) - * 2) These are called: - * - BEFORE asking for a transport - * - AFTER param serialization (s.data is a string if s.processData is true) - * 3) key is the dataType - * 4) the catchall symbol "*" can be used - * 5) execution will start with transport dataType and THEN continue down to "*" if needed - */ - prefilters = {}, - - /* Transports bindings - * 1) key is the dataType - * 2) the catchall symbol "*" can be used - * 3) selection will start with transport dataType and THEN go to "*" if needed - */ - transports = {}, - - // Avoid comment-prolog char sequence (#10098); must appease lint and evade compression - allTypes = "*/".concat( "*" ), - - // Anchor tag for parsing the document origin - originAnchor = document.createElement( "a" ); - originAnchor.href = location.href; - -// Base "constructor" for jQuery.ajaxPrefilter and jQuery.ajaxTransport -function addToPrefiltersOrTransports( structure ) { - - // dataTypeExpression is optional and defaults to "*" - return function( dataTypeExpression, func ) { - - if ( typeof dataTypeExpression !== "string" ) { - func = dataTypeExpression; - dataTypeExpression = "*"; - } - - var dataType, - i = 0, - dataTypes = dataTypeExpression.toLowerCase().match( rnothtmlwhite ) || []; - - if ( jQuery.isFunction( func ) ) { - - // For each dataType in the dataTypeExpression - while ( ( dataType = dataTypes[ i++ ] ) ) { - - // Prepend if requested - if ( dataType[ 0 ] === "+" ) { - dataType = dataType.slice( 1 ) || "*"; - ( structure[ dataType ] = structure[ dataType ] || [] ).unshift( func ); - - // Otherwise append - } else { - ( structure[ dataType ] = structure[ dataType ] || [] ).push( func ); - } - } - } - }; -} - -// Base inspection function for prefilters and transports -function inspectPrefiltersOrTransports( structure, options, originalOptions, jqXHR ) { - - var inspected = {}, - seekingTransport = ( structure === transports ); - - function inspect( dataType ) { - var selected; - inspected[ dataType ] = true; - jQuery.each( structure[ dataType ] || [], function( _, prefilterOrFactory ) { - var dataTypeOrTransport = prefilterOrFactory( options, originalOptions, jqXHR ); - if ( typeof dataTypeOrTransport === "string" && - !seekingTransport && !inspected[ dataTypeOrTransport ] ) { - - options.dataTypes.unshift( dataTypeOrTransport ); - inspect( dataTypeOrTransport ); - return false; - } else if ( seekingTransport ) { - return !( selected = dataTypeOrTransport ); - } - } ); - return selected; - } - - return inspect( options.dataTypes[ 0 ] ) || !inspected[ "*" ] && inspect( "*" ); -} - -// A special extend for ajax options -// that takes "flat" options (not to be deep extended) -// Fixes #9887 -function ajaxExtend( target, src ) { - var key, deep, - flatOptions = jQuery.ajaxSettings.flatOptions || {}; - - for ( key in src ) { - if ( src[ key ] !== undefined ) { - ( flatOptions[ key ] ? target : ( deep || ( deep = {} ) ) )[ key ] = src[ key ]; - } - } - if ( deep ) { - jQuery.extend( true, target, deep ); - } - - return target; -} - -/* Handles responses to an ajax request: - * - finds the right dataType (mediates between content-type and expected dataType) - * - returns the corresponding response - */ -function ajaxHandleResponses( s, jqXHR, responses ) { - - var ct, type, finalDataType, firstDataType, - contents = s.contents, - dataTypes = s.dataTypes; - - // Remove auto dataType and get content-type in the process - while ( dataTypes[ 0 ] === "*" ) { - dataTypes.shift(); - if ( ct === undefined ) { - ct = s.mimeType || jqXHR.getResponseHeader( "Content-Type" ); - } - } - - // Check if we're dealing with a known content-type - if ( ct ) { - for ( type in contents ) { - if ( contents[ type ] && contents[ type ].test( ct ) ) { - dataTypes.unshift( type ); - break; - } - } - } - - // Check to see if we have a response for the expected dataType - if ( dataTypes[ 0 ] in responses ) { - finalDataType = dataTypes[ 0 ]; - } else { - - // Try convertible dataTypes - for ( type in responses ) { - if ( !dataTypes[ 0 ] || s.converters[ type + " " + dataTypes[ 0 ] ] ) { - finalDataType = type; - break; - } - if ( !firstDataType ) { - firstDataType = type; - } - } - - // Or just use first one - finalDataType = finalDataType || firstDataType; - } - - // If we found a dataType - // We add the dataType to the list if needed - // and return the corresponding response - if ( finalDataType ) { - if ( finalDataType !== dataTypes[ 0 ] ) { - dataTypes.unshift( finalDataType ); - } - return responses[ finalDataType ]; - } -} - -/* Chain conversions given the request and the original response - * Also sets the responseXXX fields on the jqXHR instance - */ -function ajaxConvert( s, response, jqXHR, isSuccess ) { - var conv2, current, conv, tmp, prev, - converters = {}, - - // Work with a copy of dataTypes in case we need to modify it for conversion - dataTypes = s.dataTypes.slice(); - - // Create converters map with lowercased keys - if ( dataTypes[ 1 ] ) { - for ( conv in s.converters ) { - converters[ conv.toLowerCase() ] = s.converters[ conv ]; - } - } - - current = dataTypes.shift(); - - // Convert to each sequential dataType - while ( current ) { - - if ( s.responseFields[ current ] ) { - jqXHR[ s.responseFields[ current ] ] = response; - } - - // Apply the dataFilter if provided - if ( !prev && isSuccess && s.dataFilter ) { - response = s.dataFilter( response, s.dataType ); - } - - prev = current; - current = dataTypes.shift(); - - if ( current ) { - - // There's only work to do if current dataType is non-auto - if ( current === "*" ) { - - current = prev; - - // Convert response if prev dataType is non-auto and differs from current - } else if ( prev !== "*" && prev !== current ) { - - // Seek a direct converter - conv = converters[ prev + " " + current ] || converters[ "* " + current ]; - - // If none found, seek a pair - if ( !conv ) { - for ( conv2 in converters ) { - - // If conv2 outputs current - tmp = conv2.split( " " ); - if ( tmp[ 1 ] === current ) { - - // If prev can be converted to accepted input - conv = converters[ prev + " " + tmp[ 0 ] ] || - converters[ "* " + tmp[ 0 ] ]; - if ( conv ) { - - // Condense equivalence converters - if ( conv === true ) { - conv = converters[ conv2 ]; - - // Otherwise, insert the intermediate dataType - } else if ( converters[ conv2 ] !== true ) { - current = tmp[ 0 ]; - dataTypes.unshift( tmp[ 1 ] ); - } - break; - } - } - } - } - - // Apply converter (if not an equivalence) - if ( conv !== true ) { - - // Unless errors are allowed to bubble, catch and return them - if ( conv && s.throws ) { - response = conv( response ); - } else { - try { - response = conv( response ); - } catch ( e ) { - return { - state: "parsererror", - error: conv ? e : "No conversion from " + prev + " to " + current - }; - } - } - } - } - } - } - - return { state: "success", data: response }; -} - -jQuery.extend( { - - // Counter for holding the number of active queries - active: 0, - - // Last-Modified header cache for next request - lastModified: {}, - etag: {}, - - ajaxSettings: { - url: location.href, - type: "GET", - isLocal: rlocalProtocol.test( location.protocol ), - global: true, - processData: true, - async: true, - contentType: "application/x-www-form-urlencoded; charset=UTF-8", - - /* - timeout: 0, - data: null, - dataType: null, - username: null, - password: null, - cache: null, - throws: false, - traditional: false, - headers: {}, - */ - - accepts: { - "*": allTypes, - text: "text/plain", - html: "text/html", - xml: "application/xml, text/xml", - json: "application/json, text/javascript" - }, - - contents: { - xml: /\bxml\b/, - html: /\bhtml/, - json: /\bjson\b/ - }, - - responseFields: { - xml: "responseXML", - text: "responseText", - json: "responseJSON" - }, - - // Data converters - // Keys separate source (or catchall "*") and destination types with a single space - converters: { - - // Convert anything to text - "* text": String, - - // Text to html (true = no transformation) - "text html": true, - - // Evaluate text as a json expression - "text json": JSON.parse, - - // Parse text as xml - "text xml": jQuery.parseXML - }, - - // For options that shouldn't be deep extended: - // you can add your own custom options here if - // and when you create one that shouldn't be - // deep extended (see ajaxExtend) - flatOptions: { - url: true, - context: true - } - }, - - // Creates a full fledged settings object into target - // with both ajaxSettings and settings fields. - // If target is omitted, writes into ajaxSettings. - ajaxSetup: function( target, settings ) { - return settings ? - - // Building a settings object - ajaxExtend( ajaxExtend( target, jQuery.ajaxSettings ), settings ) : - - // Extending ajaxSettings - ajaxExtend( jQuery.ajaxSettings, target ); - }, - - ajaxPrefilter: addToPrefiltersOrTransports( prefilters ), - ajaxTransport: addToPrefiltersOrTransports( transports ), - - // Main method - ajax: function( url, options ) { - - // If url is an object, simulate pre-1.5 signature - if ( typeof url === "object" ) { - options = url; - url = undefined; - } - - // Force options to be an object - options = options || {}; - - var transport, - - // URL without anti-cache param - cacheURL, - - // Response headers - responseHeadersString, - responseHeaders, - - // timeout handle - timeoutTimer, - - // Url cleanup var - urlAnchor, - - // Request state (becomes false upon send and true upon completion) - completed, - - // To know if global events are to be dispatched - fireGlobals, - - // Loop variable - i, - - // uncached part of the url - uncached, - - // Create the final options object - s = jQuery.ajaxSetup( {}, options ), - - // Callbacks context - callbackContext = s.context || s, - - // Context for global events is callbackContext if it is a DOM node or jQuery collection - globalEventContext = s.context && - ( callbackContext.nodeType || callbackContext.jquery ) ? - jQuery( callbackContext ) : - jQuery.event, - - // Deferreds - deferred = jQuery.Deferred(), - completeDeferred = jQuery.Callbacks( "once memory" ), - - // Status-dependent callbacks - statusCode = s.statusCode || {}, - - // Headers (they are sent all at once) - requestHeaders = {}, - requestHeadersNames = {}, - - // Default abort message - strAbort = "canceled", - - // Fake xhr - jqXHR = { - readyState: 0, - - // Builds headers hashtable if needed - getResponseHeader: function( key ) { - var match; - if ( completed ) { - if ( !responseHeaders ) { - responseHeaders = {}; - while ( ( match = rheaders.exec( responseHeadersString ) ) ) { - responseHeaders[ match[ 1 ].toLowerCase() ] = match[ 2 ]; - } - } - match = responseHeaders[ key.toLowerCase() ]; - } - return match == null ? null : match; - }, - - // Raw string - getAllResponseHeaders: function() { - return completed ? responseHeadersString : null; - }, - - // Caches the header - setRequestHeader: function( name, value ) { - if ( completed == null ) { - name = requestHeadersNames[ name.toLowerCase() ] = - requestHeadersNames[ name.toLowerCase() ] || name; - requestHeaders[ name ] = value; - } - return this; - }, - - // Overrides response content-type header - overrideMimeType: function( type ) { - if ( completed == null ) { - s.mimeType = type; - } - return this; - }, - - // Status-dependent callbacks - statusCode: function( map ) { - var code; - if ( map ) { - if ( completed ) { - - // Execute the appropriate callbacks - jqXHR.always( map[ jqXHR.status ] ); - } else { - - // Lazy-add the new callbacks in a way that preserves old ones - for ( code in map ) { - statusCode[ code ] = [ statusCode[ code ], map[ code ] ]; - } - } - } - return this; - }, - - // Cancel the request - abort: function( statusText ) { - var finalText = statusText || strAbort; - if ( transport ) { - transport.abort( finalText ); - } - done( 0, finalText ); - return this; - } - }; - - // Attach deferreds - deferred.promise( jqXHR ); - - // Add protocol if not provided (prefilters might expect it) - // Handle falsy url in the settings object (#10093: consistency with old signature) - // We also use the url parameter if available - s.url = ( ( url || s.url || location.href ) + "" ) - .replace( rprotocol, location.protocol + "//" ); - - // Alias method option to type as per ticket #12004 - s.type = options.method || options.type || s.method || s.type; - - // Extract dataTypes list - s.dataTypes = ( s.dataType || "*" ).toLowerCase().match( rnothtmlwhite ) || [ "" ]; - - // A cross-domain request is in order when the origin doesn't match the current origin. - if ( s.crossDomain == null ) { - urlAnchor = document.createElement( "a" ); - - // Support: IE <=8 - 11, Edge 12 - 13 - // IE throws exception on accessing the href property if url is malformed, - // e.g. http://example.com:80x/ - try { - urlAnchor.href = s.url; - - // Support: IE <=8 - 11 only - // Anchor's host property isn't correctly set when s.url is relative - urlAnchor.href = urlAnchor.href; - s.crossDomain = originAnchor.protocol + "//" + originAnchor.host !== - urlAnchor.protocol + "//" + urlAnchor.host; - } catch ( e ) { - - // If there is an error parsing the URL, assume it is crossDomain, - // it can be rejected by the transport if it is invalid - s.crossDomain = true; - } - } - - // Convert data if not already a string - if ( s.data && s.processData && typeof s.data !== "string" ) { - s.data = jQuery.param( s.data, s.traditional ); - } - - // Apply prefilters - inspectPrefiltersOrTransports( prefilters, s, options, jqXHR ); - - // If request was aborted inside a prefilter, stop there - if ( completed ) { - return jqXHR; - } - - // We can fire global events as of now if asked to - // Don't fire events if jQuery.event is undefined in an AMD-usage scenario (#15118) - fireGlobals = jQuery.event && s.global; - - // Watch for a new set of requests - if ( fireGlobals && jQuery.active++ === 0 ) { - jQuery.event.trigger( "ajaxStart" ); - } - - // Uppercase the type - s.type = s.type.toUpperCase(); - - // Determine if request has content - s.hasContent = !rnoContent.test( s.type ); - - // Save the URL in case we're toying with the If-Modified-Since - // and/or If-None-Match header later on - // Remove hash to simplify url manipulation - cacheURL = s.url.replace( rhash, "" ); - - // More options handling for requests with no content - if ( !s.hasContent ) { - - // Remember the hash so we can put it back - uncached = s.url.slice( cacheURL.length ); - - // If data is available, append data to url - if ( s.data ) { - cacheURL += ( rquery.test( cacheURL ) ? "&" : "?" ) + s.data; - - // #9682: remove data so that it's not used in an eventual retry - delete s.data; - } - - // Add or update anti-cache param if needed - if ( s.cache === false ) { - cacheURL = cacheURL.replace( rantiCache, "$1" ); - uncached = ( rquery.test( cacheURL ) ? "&" : "?" ) + "_=" + ( nonce++ ) + uncached; - } - - // Put hash and anti-cache on the URL that will be requested (gh-1732) - s.url = cacheURL + uncached; - - // Change '%20' to '+' if this is encoded form body content (gh-2658) - } else if ( s.data && s.processData && - ( s.contentType || "" ).indexOf( "application/x-www-form-urlencoded" ) === 0 ) { - s.data = s.data.replace( r20, "+" ); - } - - // Set the If-Modified-Since and/or If-None-Match header, if in ifModified mode. - if ( s.ifModified ) { - if ( jQuery.lastModified[ cacheURL ] ) { - jqXHR.setRequestHeader( "If-Modified-Since", jQuery.lastModified[ cacheURL ] ); - } - if ( jQuery.etag[ cacheURL ] ) { - jqXHR.setRequestHeader( "If-None-Match", jQuery.etag[ cacheURL ] ); - } - } - - // Set the correct header, if data is being sent - if ( s.data && s.hasContent && s.contentType !== false || options.contentType ) { - jqXHR.setRequestHeader( "Content-Type", s.contentType ); - } - - // Set the Accepts header for the server, depending on the dataType - jqXHR.setRequestHeader( - "Accept", - s.dataTypes[ 0 ] && s.accepts[ s.dataTypes[ 0 ] ] ? - s.accepts[ s.dataTypes[ 0 ] ] + - ( s.dataTypes[ 0 ] !== "*" ? ", " + allTypes + "; q=0.01" : "" ) : - s.accepts[ "*" ] - ); - - // Check for headers option - for ( i in s.headers ) { - jqXHR.setRequestHeader( i, s.headers[ i ] ); - } - - // Allow custom headers/mimetypes and early abort - if ( s.beforeSend && - ( s.beforeSend.call( callbackContext, jqXHR, s ) === false || completed ) ) { - - // Abort if not done already and return - return jqXHR.abort(); - } - - // Aborting is no longer a cancellation - strAbort = "abort"; - - // Install callbacks on deferreds - completeDeferred.add( s.complete ); - jqXHR.done( s.success ); - jqXHR.fail( s.error ); - - // Get transport - transport = inspectPrefiltersOrTransports( transports, s, options, jqXHR ); - - // If no transport, we auto-abort - if ( !transport ) { - done( -1, "No Transport" ); - } else { - jqXHR.readyState = 1; - - // Send global event - if ( fireGlobals ) { - globalEventContext.trigger( "ajaxSend", [ jqXHR, s ] ); - } - - // If request was aborted inside ajaxSend, stop there - if ( completed ) { - return jqXHR; - } - - // Timeout - if ( s.async && s.timeout > 0 ) { - timeoutTimer = window.setTimeout( function() { - jqXHR.abort( "timeout" ); - }, s.timeout ); - } - - try { - completed = false; - transport.send( requestHeaders, done ); - } catch ( e ) { - - // Rethrow post-completion exceptions - if ( completed ) { - throw e; - } - - // Propagate others as results - done( -1, e ); - } - } - - // Callback for when everything is done - function done( status, nativeStatusText, responses, headers ) { - var isSuccess, success, error, response, modified, - statusText = nativeStatusText; - - // Ignore repeat invocations - if ( completed ) { - return; - } - - completed = true; - - // Clear timeout if it exists - if ( timeoutTimer ) { - window.clearTimeout( timeoutTimer ); - } - - // Dereference transport for early garbage collection - // (no matter how long the jqXHR object will be used) - transport = undefined; - - // Cache response headers - responseHeadersString = headers || ""; - - // Set readyState - jqXHR.readyState = status > 0 ? 4 : 0; - - // Determine if successful - isSuccess = status >= 200 && status < 300 || status === 304; - - // Get response data - if ( responses ) { - response = ajaxHandleResponses( s, jqXHR, responses ); - } - - // Convert no matter what (that way responseXXX fields are always set) - response = ajaxConvert( s, response, jqXHR, isSuccess ); - - // If successful, handle type chaining - if ( isSuccess ) { - - // Set the If-Modified-Since and/or If-None-Match header, if in ifModified mode. - if ( s.ifModified ) { - modified = jqXHR.getResponseHeader( "Last-Modified" ); - if ( modified ) { - jQuery.lastModified[ cacheURL ] = modified; - } - modified = jqXHR.getResponseHeader( "etag" ); - if ( modified ) { - jQuery.etag[ cacheURL ] = modified; - } - } - - // if no content - if ( status === 204 || s.type === "HEAD" ) { - statusText = "nocontent"; - - // if not modified - } else if ( status === 304 ) { - statusText = "notmodified"; - - // If we have data, let's convert it - } else { - statusText = response.state; - success = response.data; - error = response.error; - isSuccess = !error; - } - } else { - - // Extract error from statusText and normalize for non-aborts - error = statusText; - if ( status || !statusText ) { - statusText = "error"; - if ( status < 0 ) { - status = 0; - } - } - } - - // Set data for the fake xhr object - jqXHR.status = status; - jqXHR.statusText = ( nativeStatusText || statusText ) + ""; - - // Success/Error - if ( isSuccess ) { - deferred.resolveWith( callbackContext, [ success, statusText, jqXHR ] ); - } else { - deferred.rejectWith( callbackContext, [ jqXHR, statusText, error ] ); - } - - // Status-dependent callbacks - jqXHR.statusCode( statusCode ); - statusCode = undefined; - - if ( fireGlobals ) { - globalEventContext.trigger( isSuccess ? "ajaxSuccess" : "ajaxError", - [ jqXHR, s, isSuccess ? success : error ] ); - } - - // Complete - completeDeferred.fireWith( callbackContext, [ jqXHR, statusText ] ); - - if ( fireGlobals ) { - globalEventContext.trigger( "ajaxComplete", [ jqXHR, s ] ); - - // Handle the global AJAX counter - if ( !( --jQuery.active ) ) { - jQuery.event.trigger( "ajaxStop" ); - } - } - } - - return jqXHR; - }, - - getJSON: function( url, data, callback ) { - return jQuery.get( url, data, callback, "json" ); - }, - - getScript: function( url, callback ) { - return jQuery.get( url, undefined, callback, "script" ); - } -} ); - -jQuery.each( [ "get", "post" ], function( i, method ) { - jQuery[ method ] = function( url, data, callback, type ) { - - // Shift arguments if data argument was omitted - if ( jQuery.isFunction( data ) ) { - type = type || callback; - callback = data; - data = undefined; - } - - // The url can be an options object (which then must have .url) - return jQuery.ajax( jQuery.extend( { - url: url, - type: method, - dataType: type, - data: data, - success: callback - }, jQuery.isPlainObject( url ) && url ) ); - }; -} ); - - -jQuery._evalUrl = function( url ) { - return jQuery.ajax( { - url: url, - - // Make this explicit, since user can override this through ajaxSetup (#11264) - type: "GET", - dataType: "script", - cache: true, - async: false, - global: false, - "throws": true - } ); -}; - - -jQuery.fn.extend( { - wrapAll: function( html ) { - var wrap; - - if ( this[ 0 ] ) { - if ( jQuery.isFunction( html ) ) { - html = html.call( this[ 0 ] ); - } - - // The elements to wrap the target around - wrap = jQuery( html, this[ 0 ].ownerDocument ).eq( 0 ).clone( true ); - - if ( this[ 0 ].parentNode ) { - wrap.insertBefore( this[ 0 ] ); - } - - wrap.map( function() { - var elem = this; - - while ( elem.firstElementChild ) { - elem = elem.firstElementChild; - } - - return elem; - } ).append( this ); - } - - return this; - }, - - wrapInner: function( html ) { - if ( jQuery.isFunction( html ) ) { - return this.each( function( i ) { - jQuery( this ).wrapInner( html.call( this, i ) ); - } ); - } - - return this.each( function() { - var self = jQuery( this ), - contents = self.contents(); - - if ( contents.length ) { - contents.wrapAll( html ); - - } else { - self.append( html ); - } - } ); - }, - - wrap: function( html ) { - var isFunction = jQuery.isFunction( html ); - - return this.each( function( i ) { - jQuery( this ).wrapAll( isFunction ? html.call( this, i ) : html ); - } ); - }, - - unwrap: function( selector ) { - this.parent( selector ).not( "body" ).each( function() { - jQuery( this ).replaceWith( this.childNodes ); - } ); - return this; - } -} ); - - -jQuery.expr.pseudos.hidden = function( elem ) { - return !jQuery.expr.pseudos.visible( elem ); -}; -jQuery.expr.pseudos.visible = function( elem ) { - return !!( elem.offsetWidth || elem.offsetHeight || elem.getClientRects().length ); -}; - - - - -jQuery.ajaxSettings.xhr = function() { - try { - return new window.XMLHttpRequest(); - } catch ( e ) {} -}; - -var xhrSuccessStatus = { - - // File protocol always yields status code 0, assume 200 - 0: 200, - - // Support: IE <=9 only - // #1450: sometimes IE returns 1223 when it should be 204 - 1223: 204 - }, - xhrSupported = jQuery.ajaxSettings.xhr(); - -support.cors = !!xhrSupported && ( "withCredentials" in xhrSupported ); -support.ajax = xhrSupported = !!xhrSupported; - -jQuery.ajaxTransport( function( options ) { - var callback, errorCallback; - - // Cross domain only allowed if supported through XMLHttpRequest - if ( support.cors || xhrSupported && !options.crossDomain ) { - return { - send: function( headers, complete ) { - var i, - xhr = options.xhr(); - - xhr.open( - options.type, - options.url, - options.async, - options.username, - options.password - ); - - // Apply custom fields if provided - if ( options.xhrFields ) { - for ( i in options.xhrFields ) { - xhr[ i ] = options.xhrFields[ i ]; - } - } - - // Override mime type if needed - if ( options.mimeType && xhr.overrideMimeType ) { - xhr.overrideMimeType( options.mimeType ); - } - - // X-Requested-With header - // For cross-domain requests, seeing as conditions for a preflight are - // akin to a jigsaw puzzle, we simply never set it to be sure. - // (it can always be set on a per-request basis or even using ajaxSetup) - // For same-domain requests, won't change header if already provided. - if ( !options.crossDomain && !headers[ "X-Requested-With" ] ) { - headers[ "X-Requested-With" ] = "XMLHttpRequest"; - } - - // Set headers - for ( i in headers ) { - xhr.setRequestHeader( i, headers[ i ] ); - } - - // Callback - callback = function( type ) { - return function() { - if ( callback ) { - callback = errorCallback = xhr.onload = - xhr.onerror = xhr.onabort = xhr.onreadystatechange = null; - - if ( type === "abort" ) { - xhr.abort(); - } else if ( type === "error" ) { - - // Support: IE <=9 only - // On a manual native abort, IE9 throws - // errors on any property access that is not readyState - if ( typeof xhr.status !== "number" ) { - complete( 0, "error" ); - } else { - complete( - - // File: protocol always yields status 0; see #8605, #14207 - xhr.status, - xhr.statusText - ); - } - } else { - complete( - xhrSuccessStatus[ xhr.status ] || xhr.status, - xhr.statusText, - - // Support: IE <=9 only - // IE9 has no XHR2 but throws on binary (trac-11426) - // For XHR2 non-text, let the caller handle it (gh-2498) - ( xhr.responseType || "text" ) !== "text" || - typeof xhr.responseText !== "string" ? - { binary: xhr.response } : - { text: xhr.responseText }, - xhr.getAllResponseHeaders() - ); - } - } - }; - }; - - // Listen to events - xhr.onload = callback(); - errorCallback = xhr.onerror = callback( "error" ); - - // Support: IE 9 only - // Use onreadystatechange to replace onabort - // to handle uncaught aborts - if ( xhr.onabort !== undefined ) { - xhr.onabort = errorCallback; - } else { - xhr.onreadystatechange = function() { - - // Check readyState before timeout as it changes - if ( xhr.readyState === 4 ) { - - // Allow onerror to be called first, - // but that will not handle a native abort - // Also, save errorCallback to a variable - // as xhr.onerror cannot be accessed - window.setTimeout( function() { - if ( callback ) { - errorCallback(); - } - } ); - } - }; - } - - // Create the abort callback - callback = callback( "abort" ); - - try { - - // Do send the request (this may raise an exception) - xhr.send( options.hasContent && options.data || null ); - } catch ( e ) { - - // #14683: Only rethrow if this hasn't been notified as an error yet - if ( callback ) { - throw e; - } - } - }, - - abort: function() { - if ( callback ) { - callback(); - } - } - }; - } -} ); - - - - -// Prevent auto-execution of scripts when no explicit dataType was provided (See gh-2432) -jQuery.ajaxPrefilter( function( s ) { - if ( s.crossDomain ) { - s.contents.script = false; - } -} ); - -// Install script dataType -jQuery.ajaxSetup( { - accepts: { - script: "text/javascript, application/javascript, " + - "application/ecmascript, application/x-ecmascript" - }, - contents: { - script: /\b(?:java|ecma)script\b/ - }, - converters: { - "text script": function( text ) { - jQuery.globalEval( text ); - return text; - } - } -} ); - -// Handle cache's special case and crossDomain -jQuery.ajaxPrefilter( "script", function( s ) { - if ( s.cache === undefined ) { - s.cache = false; - } - if ( s.crossDomain ) { - s.type = "GET"; - } -} ); - -// Bind script tag hack transport -jQuery.ajaxTransport( "script", function( s ) { - - // This transport only deals with cross domain requests - if ( s.crossDomain ) { - var script, callback; - return { - send: function( _, complete ) { - script = jQuery( "
\ No newline at end of file diff --git a/examples/genomics.html b/examples/genomics.html index 676d8e3..28c907b 100644 --- a/examples/genomics.html +++ b/examples/genomics.html @@ -8,9 +8,8 @@ - - - + + @@ -19,7 +18,7 @@ - - - + + @@ -32,7 +31,7 @@ var seq = "FDSJKLFJDSFKLJDFHADJKLFHDSJKLFHDAFJKLDHFJKLDASFHDJKLFHDSAJKLFHDAKLFJDHSAFKKLFJDSFKLJDFHADJKLFHDSJKLFHDAFJKLDHFJKLDASFHDJKLFHDSAJKLFHDAKLFJDHSAFKKLFJDSFKLJDFHADJKLFHDSJKLFHDAFJKLDHFJKLDASFHDJKLFHDSAJKLFHDAKLFJDHSAFKKLFJDSFKLJDFHADJKLFHDSJKLFHDAFJKLDHFJKLDASFHDJKLFHDSAJKLFHDAKLFJDHSAFKKLFJDSFKLJDFHADJKLFHDSJKLFHDAFJKLDHFJKLDASFHDJKLFHDSAJKLFHDAKLFJDHSAFKKLFJDSFKLJDFHADJKLFHDSJKLFHDAFJKLDHFJKLDASFHDJKLFHDSAJKLFHDAKLFJDHSAFKKLFJDSFKLJDFHADJKLFHDSJKLFHDAFJKLDHFJKLDASFHDJKLFHDSAJKLFHDAKLFJDHSAFKKLFJDSFKLJDFHADJKLFHDSJKLFHDAFJKLDHFJKLDASFHDJKLFHDSAJKLFHDAKLFJDHSAFKKLFJDSFKLJDFHADJKLFHDSJKLFHDAFJKLDHFJKLDASFHDJKLFHDSAJKLFHDAKLFJDHSAFKKLFJDSFKLJDFHADJKLFHDSJKLFHDAFJKLDHFJKLDASFHDJKLFHDSAJKLFHDAKLFJDHSAFKKLFJDSFKLJDFHADJKLFHDSJKLFHDAFJKLDHFJKLDASFHDJKLFHDSAJKLFHDAKLFJDHSAFKKLFJDSFKLJDFHADJKLFHDSJKLFHDAFJKLDHFJKLDASFHDJKLFHDSAJKLFHDAKLFJDHSAFKKLFJDSFKLJDFHADJKLFHDSJKLFHDAFJKLDHFJKLDASFHDJKLFHDSAJKLFHDAKLFJDHSAFKKLFJDSFKLJDFHADJKLFHDSJKLFHDAFJKLDHFJKLDASFHDJKLFHDSAJKLFHDAKLFJDHSAFKKLFJDSFKLJDFHADJKLFHDSJKLFHDAFJKLDHFJKLDASFHDJKLFHDSAJKLFHDAKLFJDHSAFKKLFJDSFKLJDFHADJKLFHDSJKLFHDAFJKLDHFJKLDASFHDJKLFHDSAJKLFHDAKLFJDHSAFKKLFJDSFKLJDFHADJKLFHDSJKLFHDAFJKLDHFJKLDASFHDJKLFHDSAJKLFHDAKLFJDHSAFKLDLSNCDJ"+ "KLFENFIUPERWDJKPCNVDFPIEHFDCFJDKOWFPDJWFKLXSJFDW9FIPUAENDCXAMSFNDUAFIDJFDLKSAFJDSAKFLJDSADJFDW9FIPUAENDCXAMSFNDAAAAAAAAAAAFJDSAKFL"; console.log(seq.length); - var ft2 = new FeatureViewer(seq,"#div2", { + var ft2 = new FeatureViewer.createFeature(seq,"#div2", { showAxis: true, showSequence: true, brushActive: true, diff --git a/examples/index.html b/examples/index.html index ef986bf..4701037 100644 --- a/examples/index.html +++ b/examples/index.html @@ -6,9 +6,10 @@ + - + @@ -94,10 +95,10 @@

Step 1 - Initialize the Feature Viewer

var options = {showAxis: true, showSequence: true, brushActive: true, toolbar:true, bubbleHelp: true, zoomMax:20 }; -var ft = new FeatureViewer("FDSJKLFJDSFKLJDFHADJKLFHDSJKLFHDAFJKLDHFJKLDASFHDJKLFHDSAJKLFHDAKLFJDHSAFKLDLSNCDJKLFENFIUPERWDJKPCNVDDAAFJDSAKFL","#div1", options); +var ft = new FeatureViewer.createFeature("FDSJKLFJDSFKLJDFHADJKLFHDSJKLFHDAFJKLDHFJKLDASFHDJKLFHDSAJKLFHDAKLFJDHSAFKLDLSNCDJKLFENFIUPERWDJKPCNVDDAAFJDSAKFL","#div1", options); //Or with a length instead of a sequence : -//var ft = new FeatureViewer(113,"#div1",options); +//var ft = new FeatureViewer.createFeature(113,"#div1",options);