headers.tsv

headers tables
('Reagent type (species) or resource', 'Designation', 'Source or reference', 'Identifiers', 'Additional information')	1788
('Reagent type (species) or resource', 'Designation', 'Source or reference', 'Identifiers')	49
(0, 1)	48
(0, 1, 2)	27
('Reagent type or resource', 'Designation', 'Source or reference', 'Identifiers', 'Additional information')	27
('Reagent type', 'Designation', 'Source or reference', 'Identifiers', 'Additional information')	26
(0, 1, 2, 3)	20
(0, 1, 2, 3, 4)	18
('Reagent', 'Type', 'Manufacturer', 'Catalog #', 'Comments')	17
('Data collection', 'Unnamed: 1')	14
(0,)	13
('Group 1', 'Group 2', 'Effect size d', 'A priori power', 'Group 1 sample size', 'Group 2 sample size')	13
(0, 1, 2, 3, 4, 5, 6, 7, 8)	11
('Parameter', 'Value')	10
(0, 1, 2, 3, 4, 5, 6, 7)	10
('Reagent type (species) or resource', 'Designation', 'Source or reference', 'Identifier', 'Additional information')	10
("Dunn's multiple comparisons test", 'Significant', 'Summary', 'Adjusted P Value')	9
('Element', 'Weight %', 'Atomic %', 'Net int.', 'Error %', 'Kratio', 'Z', 'R', 'A', 'F')	9
('Property', 'Value')	9
(0, 1, 2, 3, 4, 5)	8
('Channel', 'Gmax (S/cm2)')	8
('Reagent type', 'Designation', 'Source', 'Identifiers', 'Additional information')	7
('Designation', 'Source or reference', 'Identifiers', 'Additional information')	7
('Groups', 'F test statistic', 'Partial η2', 'Effect size f', 'A priori power', 'Total sample size')	7
('Reagent type (species) or resource', 'Designation', 'Source or reference', 'Identifiers', 'Additional Information')	6
("Dunn's multiple comparisons test", 'Significant?', 'Summary', 'Adjusted P Value')	6
('Reagent type (species) or resources', 'Designation', 'Source or reference', 'Identifiers', 'Additional information')	6
('Retention volume (mL)', '11 to 16', '16 to 20', '>20', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	6
('Fixed effects:', 'Estimate', 'Std. error', 'DF', 't-value', 'p-value')	6
('Primer ID', 'Forward sequence', 'Reverse sequence')	6
('Data collection', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3')	5
('Reagent type (species) or resource', 'Designation', 'Source or reference', 'Identifiers', 'Additional information', 'Unnamed: 5')	5
('Gene', 'Forward primer', 'Reverse primer')	5
('Figure', 'Comparator 1', 'Comparator 2', 'Mean 1', 'Mean 2', 'SE of diff.', 'N 1', 'N 2', 'Summary', 'Adjusted P Value')	5
('Variable', 'Value', 'Unit')	5
('Dataset HeLa', 'Diffusion coefficient (µm2/s)', 'Occupancy (%)', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	5
('Primer', 'Sequence')	5
('Unnamed: 0', 'CDMD', 'Phenix', 'Rosetta', 'Refmac')	5
('Unnamed: 0', 'Unnamed: 1', 'Unnamed: 2', 'MNI', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	5
('Parameter', 'Description')	5
('Pre type', 'Exp. ref.', 'Hold (mV)', 'Erev (mV)', 'Amp. (pA,mV)', 'Diff. %', 't10\u2005−\u200590 (ms)', 'Diff. %.1', 'τdecay (ms)', 'Diff. %.2')	5
('Post type', 'Exp. ref.', 'Hold (mV)', 'Erev (mV)', 'Amp. (pA,mV)', 'Diff. %', 't10\u2005−\u200590 (ms)', 'Diff. %.1', 'τdecay (ms)', 'Diff. %.2')	5
('Reagent type (species) or resource', 'Designation', 'Source', 'Identifiers', 'Additional information')	4
('Reagent type (species)or resource', 'Designation', 'Source or reference', 'Identifiers', 'Additional information')	4
('Unnamed: 0', 'G1', 'G2', 'Prometaphase', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	4
(0, 1, 2, 3, 4, 5, 6)	4
('Reagent type (species) or resource', 'Designation', 'Source or reference', 'Additional information')	4
('Species', 'MotX candidate', 'MotY candidate', 'FlgO candidate', 'FlgP candidate', 'FlgT candidate')	4
('Compound', 'Name', 'Retention time', 'Day 1', 'Day 7', 'Day 14', 'Foraging', 'p-value')	4
('Covariate', 'AOR', 'p-value')	4
('Brain Region Activation', 'Height: p<0.005 Extent: p<0.05', 'Height: p<0.005 Extent: p<0.01', 'Height: p<0.001 Extent: p<0.05', 'Height: p<0.001 Extent: p<0.01')	4
('Data collection', 'Unnamed: 1', 'Unnamed: 2')	4
('Ms', 'SEC', '100kD filter', 'Unnamed: 3', 'Unnamed: 4')	4
('Scaffold', 'Start', 'End', 'Strand', 'Id with PpOMLV', 'E value', 'Coverage', 'FEVE')	4
('Models', 'P(M | Data)', 'BFM', 'BF10', 'Error (%)')	4
('ANOVA; α=0.05', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4')	4
('Substrate', 'Variant', 'Constant (WT)', 'Effect size d', 'A priori power', 'Sample size per group')	4
(0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12)	3
('Process type', 'Parameter name', 'Description', 'Range', 'Default')	3
('Item', 'Mean\xa0±\xa0SEM of WT', 'Mean\xa0±\xa0SEM of DKO', 'p Value', 'Unnamed: 4')	3
('Group', 'n', 'mAHP (mV)', 'p-Value', 'sAHP (mV)', 'p-Value.1')	3
('Group', 'n', 'ADP Amplitude (mV)', 'p-Value', 'AUC (mV*ms)', 'p-Value.1')	3
('Dataset', 'C statistic', 'Df', 'p-value', 'ΔAIC', 'No.\xa0of\xa0studies', 'N')	3
('Translation model', 'Input(s)', 'rxy', 'rxz', 'rxyz', 'SSIMxy', 'SSIMxz', 'SSIMxyz')	3
('ssVEP-SNRs:', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4')	3
('Data collection and processing', 'Unnamed: 1')	3
('Gene', 'Forward', 'Reverse')	3
('Metric', 'Term', 'Df', 'Sum Sq.', 'Mean Sq.', 'F stat.', 'R2', 'P')	3
('Unnamed: 0', 'Forward', 'Reverse')	3
('Region', 'MNI coordinates', 'peak', 'cluster', 'Unnamed: 4', 'Unnamed: 5')	3
('Table Analyzed', 'oocytes count 6 hr water/PGN combo set 2 + set 1')	3
('Gene', 'Forward (5’−3’)', 'Reverse (5’−3’)')	3
('Simulation parameter', 'Symbol', 'Value', 'Notes')	3
('Parameter', 'Symbol', 'Value', 'Notes')	3
('Reagent type (species)', 'Designation', 'Source or reference', 'Identifiers', 'Additional information')	3
('Component', 'Effects', 'χ2', 'Df', 'p', 'R2m')	3
('Locus ID', 'Gene name', 'Circadian expression', 'Tissue specific expression', 'Closest homolog', 'Publications (PMID)', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12', 'Unnamed: 13', 'Unnamed: 14')	3
('Dynamical regime', 'Parameters', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	3
('Unnamed: 0', 'N (Female, Male)', 'Age (range)', 'Approx. IQ (range; SD)', 'AQ (range; SD)')	3
('X-Function', 'Kruskal-Wallis ANOVA', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	3
('Gene set name', 'Gene set description', 'FDR q-value', 'Enriched genes')	3
('Allele', 'Molecular lesion', 'Defect in PVD', 'Physical location†')	3
('Reagent type (species) or Resource', 'Designation', 'Source or reference', 'Identifiers', 'Additional information')	3
('Reagent or resource', 'Source', 'Identifier')	3
('Repeat class', 'Family', 'Counts', 'Bases', '% of assembly')	3
('Model', 'DF', '% Deviance Explained', 'AIC')	3
('Parameter', 'Label', 'Value', 'Unnamed: 3')	3
('Reagent type', 'Designation', 'Source or reference', 'Identifiers')	3
('Unnamed: 0', 'Unnamed: 1', 'From', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5')	3
('Subunit', 'Gene')	3
('Cells', 'Group 1', 'Group 2', 'Effect size d', 'A priori power', 'Group 1 sample size', 'Group 2 sample size')	3
('Unnamed: 0', 'Df', 'Sum sq', 'Mean sq', 'F', 'p')	3
('Fixed effects', 'Estimate', 'Std. error', 'z', 'p')	3
('Plasmid', 'Description', 'Source')	2
('ordering', 'Number cases per cluster', 'μ (Tianjin)', 'σ (Tianjin)', 'μ (Singapore)', 'σ (Singapore)')	2
('GOID', 'GO term', 'P-Value', '% Associated Genes', 'Associated genes found')	2
('Gene', 'Sequence')	2
('Group', 'n', '20 Hz, 2 s, 2 mV below (%)', 'p-Value', 'n.1', '20 Hz, 250 ms, 2 mV below (%)', 'p-Value.1', 'n.2', '20 Hz, 250 ms, 5 mV below (%)', 'p-Value.2')	2
('Parameter', 'male', 'female', 'Unnamed: 3', 'Unnamed: 4')	2
(0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10)	2
('Parameter', 'Simulation value', 'Physical value')	2
('Unnamed: 0', 'Time', 'Condition (DREADD - SHAM)', 'Time x Condition')	2
('Dataset', 'Response', 'Predictor', 'Std.est.', 'Est.', 'SE', 'Crit.value', 'Df', 'p-value')	2
('Onset', 'Sex', 'Age', 'Pathology', 'Location', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12', 'Unnamed: 13')	2
('Year', 'Scenario', 'Median', '95% Cr interval')	2
('Model', 'Integration', 'Extrema detection', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12')	2
('Brain region', 'Total number of electrodes', 'Electrodes with state-dependent slope modulation')	2
('Unnamed: 0', 'Index allele', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	2
('Unnamed: 0', 'Unnamed: 1', 'Unnamed: 2', 'Index allele', 'Unnamed: 4', 'Unnamed: 5')	2
('Parameter', 'Value', 'Description')	2
('Neuron class', 'Drosophila', 'Locust', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	2
('Unnamed: 0', 'Chr./scaffold', 'CEN', 'Core centromere', '% GC genome', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	2
('Unnamed: 0', 'Average beta', 'T value', 'P value', 'Standard deviation')	2
('siRNA', 'Mixes of', 'Species', 'Supplier', 'References')	2
('Model', 'Contrast', 'Trait', 't-value', 'p-value')	2
('Parameter', 'Model', 'Contrast', 'T value', 'P value')	2
('Reagent type or resources', 'Designation', 'Source or reference', 'Identifier', 'Additional information')	2
('Gene symbol', 'Gene name', 'Fold change')	2
('Unnamed: 0', 'Ngfr-WT', 'Ngfr-KO', 'Unnamed: 3')	2
('Reagent type', 'Reagent or resource', 'Source', 'Identifier', 'Additional information')	2
('Type', '1', '2', '3', '4')	2
('Genotype', 'Analysis', 'Chlorotic area', 'Intensity of chlorosis', 'Leaf deformation', 'Leaf shunting')	2
('Cell type', 'Phenotype', 'Parameter', 'Weight')	2
('Unnamed: 0', 'Suicide attempters (n\xa0=\xa034)', 'Non-attempters (n\xa0=\xa068)')	2
('Reagent type', 'Designation', 'Source', 'Identifier', 'Additional information')	2
('Unnamed: 0', 'β', 'β(std. Err.)', 'standardised β', 't', 'p')	2
('Main effect/interaction', 'Statistics', 'Further information')	2
('Unnamed: 0', 'Cercopithecoidea', 'Hominidae', 'Hylobatidae', 'Platyrrhini')	2
('Unnamed: 0', 'bgPC1', 'bgPC2', 'bgPC3')	2
('Unnamed: 0', 'Fish 1', 'Fish 2', 'Fish 3', 'Merged')	2
('Parameters', 'Unnamed: 1', 'unit')	2
('Figure 1', 'Unnamed: 1')	2
("Fisher's exact test", 'Significant', 'Summary', 'Adjusted P Value')	2
('Table Analyzed', 'Data 1')	2
('Table Analyzed', 'oocytes count 24 hr water/PGN combo set 2 + set1')	2
('Mann-Whitney test', 'Unnamed: 1')	2
('Reagent type (species) or resource', 'Designation', 'Source reference', 'Identifier', 'Additional information')	2
('Reagent (species) or resource', 'Designation', 'Source or reference', 'Identifiers', 'Additional information')	2
('Jαβ\xa0(µA.\xa0ms.cm-2)', 'Feedforward', 'PC', 'PV', 'SOM', 'VIP')	2
('Unnamed: 0', 'Ka (1/Ms)', 'Kd (1/s)', 'KD (M)')	2
('Sample', 'Total reads', '% Mapped', 'Accession no.')	2
('Property', 'Experiment', 'p', '+/+: Mean\xa0±\xa0SEM, n', '+/-: Mean\xa0±\xa0SEM, n')	2
('Unnamed: 0', 'Embryos with no heat shock', 'Heat shocked embryos', 'Unnamed: 3')	2
('Unnamed: 0', 'B', 'SE', 't-value')	2
('Part', 'Description (link)', 'Company', 'Item number')	2
('Parameter', 'Std. β', 'p')	2
('Age category (years)', 'Women (n\xa0=\xa0491)', 'Men (n\xa0=\xa0524)', 'Total (n\xa0=\xa01,015)', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	2
('Parameter', 'Model one outcome: grade 0.5 fracture (borderline)', 'Model two outcome: grade one fracture (mild)', 'Model three outcome: grade two fracture (moderate)', 'Model four outcome: grade three fracture (severe)')	2
('Parameter', 'Model 1', 'Model 2', 'Model 3', 'Model 4', 'Model 5', 'Model 6')	2
('Resource', 'Designation', 'Source or reference', 'Identifiers', 'Additional information')	2
('Reagent type or resource', 'Designation', 'Source of reference', 'Identifiers', 'Additional information')	2
('Characteristic \\ cluster number', 'Cluster 1', 'Cluster 2', 'Cluster 3')	2
('Dataset KRAS4b', 'Diffusion coefficient (µm2/s)', 'Occupancy (%)', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	2
('Donor genotype (neutrophil)', 'Recipient genotype (endothelium)', 'Mice', 'Venules', 'Diameter (μm)', 'Leukocyte counts (106 cells/ml)', 'Mean blood velocity (mm/s)', 'Newtonian wall shear rate (s−1)')	2
('Strain name', 'Genotype', 'Reference')	2
('Unnamed: 0', 'Younger (Y)', 'Older (O)', 'Unnamed: 3', 'Unnamed: 4')	2
('Unnamed: 0', 'Amplitude', 'Latency', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10')	2
('Measure', 'LA (\xa0=\xa017)', 'HA (\xa0=\xa017)', 'Group comparisons', 'Effect size', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	2
('Parameter', 'Variable', 'Value')	2
('Characteristic', 'TBDM', 'TB', 'P value')	2
('Sample treatment', 'Asx D/L', 'Glx D/L', 'Ser D/L', 'Ala D/L', 'Val D/L', 'Unnamed: 6')	2
('Primers used for quantitative PCR', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3')	2
('Reagent type (species) Or resource', 'Designation', 'Source or reference', 'Identifiers', 'Additional information')	2
('Song trait', 'One rate', 'Two rates', 'p-value')	2
('Song trait', 'Two rates', 'Three rates', 'p-value')	2
('Reconstruction', 'Unnamed: 1')	2
('Unnamed: 0', 'WT - Mg2+', 'WT\xa0+\xa0CTD Mg2+', 'WT - EDTA', 'WT\xa0+\xa0CTD - EDTA')	2
('Source', 'Target (wij)')	2
('Target', 'Fwd. primer', 'Rev. primer')	2
('Region I → region J', 'Mean ΔI\u2004→\u2004J', 'Se', 'T', 'N', 'P', 'adj. P')	2
('Unnamed: 0', 'Proteins Combinations', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	2
('Reagent type', 'Designation', 'Reference', 'Identifier')	2
('Reagent type (species) or resource', 'Designation', 'Source', 'Identifier', 'Additional information')	2
('Unnamed: 0', 'Sum of squares', 'Mean square', 'Numerator DF', 'Denominator DF', 'F', 'p-value', 'Unnamed: 7')	2
('Unnamed: 0', 'True value (ml)', 'Corrected prediction (ml)', 'Difference (ml)', '% difference')	2
('Variable', 'Description')	2
('Gene', 'Hypothesis log-likelihood', 'Unnamed: 2', 'Site class 0', 'Site class 1', 'Site class 2a', 'Site class 2b', 'LRT statistic')	2
('Factor', 'χ2', '-log p-value')	2
('Gene', 'Full name', '-log(p)*', 'Function')	2
('Cic DNA motif', 'Brain region', 'Motif occurrence', 'Down-Regulated', 'Shuffled', 'p-value', 'q-value')	2
('Contrast', 'Brain region', 'Effect size')	2
('Experiment 1', 'Baseline', 'Early clamp', 'Late clamp', 'No feedback')	2
('Gene name', 'Mutations', 'Normalized regrowth (24 hr)', 'N', 'P value', 'Molecular function', 'Closest human Genea')	2
('Parameter', 'Symbol', 'Value')	2
('Reagent type (species) or resource', 'Designation', 'Source or reference')	2
('Strain', 'Genotype')	2
('Fly stock', 'Description')	2
('Unnamed: 0', 'Preparation', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4')	2
('Reaction number', 'Reaction')	2
('Parameter', 'Units', 'Best-fit', 'Lower bound', 'Upper bound')	2
('Meta-analysis', 'K', 'Meta-analytic mean [95% CrI]', 'I2population ID [95% CrI] (%)', 'I2study ID [95% CrI] (%)', 'I2overall [95% CrI] (%)', 'Egger’s regression [95% CrI]')	2
('Meta-regression', 'Estimates', 'Mean [95% CrI]')	2
('Region of sampling', 'Countries (N)', 'Sequences (N, %)')	2
('Region of sampling', 'Monophyletic clusters (N)', 'Clustered sequences (N, %)')	2
('Unnamed: 0', 'SRR 3883773', 'SRR 3883772', 'SRR 3883758', 'SRR 3883771', 'SRR 3883770', 'SRR 3883769', 'SRR 3883768', 'SRR 3883767', 'SRR 3883765', 'SRR 3883764', 'SRR 3883763', 'SRR 3883762')	2
('Construct', 'N', 'Overall Kd (μM)', 'Overall ΔH (kcal/mol)', 'Overall TΔS (kcal/mol)', 'Overall ΔG (kcal/mol)')	2
('Alias', 'Gender', 'Age', 'Handedness')	2
('Deletion mutation', 'Amino acids', 'Primers', 'Sequences')	2
('Model and Foreground†', 'ΔAIC‡', 'lnL', 'Parameters', 'Null', 'P [df]', 'Unnamed: 6', 'Unnamed: 7')	2
('Model', 'lnL', 'Parameters1', 'Null', 'P [df]2', 'Δ AIC§', 'Unnamed: 6', 'Unnamed: 7')	2
('Time window', 'Functional form', 'Coefficient (95% CI)', 'p-value')	2
('Unnamed: 0', '3 months', '9 months', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	2
('Change in GS–CS+ representational distance', 'β', 'SE', 't', 'p')	2
('Unnamed: 0', 'EC50 (µM) [conf. int.]*', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	2
('Unnamed: 0', '[σE,\u2006x,σE,\u2006y,σE,\u2006z]', 'NE', 'ηE', 'wE,\u2006init', 'NEf')	2
('Unnamed: 0', '[σI,\u2006x,σI,\u2006y,σI,\u2006z]', 'NI', 'ηI', 'wI,\u2006init', 'NIf')	2
('Unnamed: 0', 'tsim', 'L')	2
('Fly #', 'bMD', 'bMR', 'bER', 'bED', 'T0', 'TM', 'TE', 'HM', 'HE', 'Error')	2
('Variables', 'Odds ratio', '95% CI', 'Z value', 'P value', 'Unnamed: 5')	2
('Cell name', 'TV58g', 'TV50a', 'MS14i', 'MS19b', 'AJ50j', 'AJ50h', 'AJ44j', 'MS74b', 'Unnamed: 9')	2
('Construct (plants analysed)', 'No. of plants Nin positive', '% of plants with Nin induction', 'No. of nodulated plants', '% of nodulated plants')	2
('Unnamed: 0', 'Mice injected with AAV-GFAP-mCherry-Cre', 'Mice injected with AAV-hSyn-mCherry-Cre')	2
('ID', 'Species', 'Common name', 'Family', 'Diet type', 'Biomass [gr]', 'References')	2
('Region', 'Z score', 'X', 'Y', 'Z', 'K voxels', 'P')	2
('Probe', 'Sequence (5’ to 3’)', 'Oligo name')	2
('p*', 'k', 'T', 'Z', 'MNI coordinates (mm)', 'Region mask', 'Unnamed: 6', 'Unnamed: 7')	2
('Unnamed: 0', 'Unnamed: 1', 'LD-SP/SP', 'LD-SP/PIP', 'LD-PIP/PIP', 'LD-PIP/SP')	2
('ENSEMBL gene ID', 'ENSEMBL gene name', 'Protein type', 'Fold-change (decrease)', 'Expression domain')	2
('Property', 'Unnamed: 1', 'Motor unit type', 'WT', 'SOD1G93A', 'Diff.')	2
('Property', 'Unnamed: 1', 'Motor unit type', 'FUSWT', 'FUSP525L', 'Diff.')	2
('Design', 'Mutations')	2
('Unnamed: 0', 'AIC', 'BIC', 'Unnamed: 3', 'Unnamed: 4')	2
('Model', 'k', 'Mean r2', 'Median r2', 'BIC', 'BIC-BICmodel1')	2
('Vaccine coverage', 'εS', 'εI', 'Incidence (Herds)')	2
('Term', 'Enrichment Score')	2
('Unnamed: 0', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Frequency (random expectancy x 10–3)', 'Unnamed: 7')	2
('Significance t-test 2-tail', 'wild-type R1', 'wild-type R2', 'wild-type R3', 'wild-type R4', 'wild-type R5', 'wild-type R6')	2
('Country', 'Targeting priority', 'Rationale for targeting priority', 'Key messages', 'Use of mass media', 'Use of IPCs', 'Use of advocates')	2
("Box's Test of Equality of Covariance Matrices", "Box's M", 'F', 'df1', 'df2', 'p-value')	2
("Mauchly's Test of Sphericity", "Mauchly's W", 'df', 'χ²', 'p-value')	2
('pair-wise post-hoc LSD tests', 'p-value')	2
('Unnamed: 0', 'CYD dengue vaccine group', 'Control group', 'Vaccine efficacy Observed', 'Vaccine Efficacy with imputation for missing genotype data', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11')	2
('Unnamed: 0', 'Unnamed: 1', 'Estimated interaction with observed vaccine efficacy', 'Estimated interaction with vaccine efficacy with imputation', 'Unnamed: 4', 'Unnamed: 5')	2
('Microarray replicates', '21 fear-induced miRNAs', '21 random miRNAs')	2
('Trait', 'Type', 'Subcategories')	2
('Variables', 'Patients', 'Unnamed: 2')	2
('Unnamed: 0', 'Geometric mean (95% CI)', 'Unnamed: 2', 'Unnamed: 3')	2
('Sample', 'Mean slope', 'SD', 'N')	2
('Unnamed: 0', 'Unnamed: 1', 'Undulation frequency (Hz)', 'Forward velocity (μm/s)', 'Reverse velocity (μm/s)', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10')	2
('Group', 'Effect size d', 'A priori power', 'Group 1 sample size')	2
('Cells', 'Group 1 across time', 'Group 2 across time', 'Unnamed: 3', 'Effect size f', 'A priori power', 'Samples per group')	2
('Unnamed: 0', 'Value', 'Std. error', 'DF', 't', 'p', '(Intr)')	2
('Symbol', 'Fold- Change', 'P-Value', 'Gene name')	1
('Gene symbol', 'Fold-change', 'p-Value', 'Gene name')	1
('Symbol', 'Fold-change', 'p-Value', 'Gene name')	1
('Group', 'Statistics', 'Resting membrane potential (mV)', 'Access resistance (mΩ)', 'Input resistance (mΩ)', 'mAHP (mV)', 'sAHP (mV)', 'Action potential amplitude (mV)', 'Action potential half width (ms)', 'Action potential threshold (mV)', 'Sag ratio')	1
('Group', 'Statistics', 'Resting membrane potential (mV)', 'Access resistance (mΩ)', 'Input resistance (mΩ)', 'mAHP (mV)', 'sAHP (mV)', 'Action potential amplitude (mV)', 'Action potential half width (ms)', 'Action potential threshold (mV)')	1
('Unnamed: 0', 'Vps45', 'Vps45–Tlg21-310', 'Vps45–Tlg2', 'Vps45V306D,F335R–Tlg2')	1
('Protein', 'Tag', 'Purification steps')	1
('EtOH treatment:', 'E7.25', 'E7.5', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Treatment', 'Genotype (# embryos with HPE/total (%))*', 'Unnamed: 2', 'Unnamed: 3')	1
('Treatment', 'Genotype (# affected/total (%))*', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4')	1
('Rank', 'Acronym', 'Common meaning(s)', 'Count')	1
('Error', 'Count', 'Average error (%)', 'Upper limit on error (%)')	1
('Reason', 'Titles', 'Abstract')	1
('Unnamed: 0', 'Holocomplex at low [Ca2+] PDB: 6XQN EMDB: EMD-22290', 'Ca2+-bound MICU1-MICU2 PDB: 6XQO EMDB: EMD-22291')	1
('Guideline', 'Examples')	1
('Unnamed: 0', 'ggCLC-7', 'hsCLC-7/OSTM1', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5')	1
('Score', 'Activity', 'General condition', 'Behaviour')	1
('Data collection and processing', 'Unnamed: 1', 'Unnamed: 2')	1
('Role', 'HCW asymptomatic screening arm', 'HCW symptomatic screening arm', 'Total number of hospital employees')	1
('Week commencing', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('General', 'ADP (n\xa0=\xa0215)', 'HFF (n\xa0=\xa092)', 'Delayed (n\xa0=\xa085)')	1
('Group', 'Anomalure*', 'Duiker†', 'Squirrel‡')	1
('Coded level', 'Term', 'Estimate', 'SE', '95% CI')	1
('Drug', 'Target', 'Predicted Effect')	1
('Prenatal characteristics', 'Case Diabetes at follow up', 'Control No Diabetes at follow up', 'p-value')	1
('Neurological manifestations', 'Observations', 'Supportive neuro-diagnostic measures', 'Treatment', 'References')	1
('Unnamed: 0', 'Homo sapiens', 'Mus musculus')	1
('Unnamed: 0', 'Unnamed: 1', 'IC50 values (nM)', 'Unnamed: 3')	1
('Unnamed: 0', 'ENaCFL', 'Unnamed: 2', 'Unnamed: 3')	1
('Unnamed: 0', 'MZ (n\xa0=\xa0150)', 'DZ (n\xa0=\xa0110)', 'Statistic', 'p-value')	1
('TG class', 'Number of associated lipids', 'Number of transcript associations')	1
('Biological Pathways', 'Gene Transcripts*', 'Relevance to the CNS')	1
('Lipid', 'Beta', 'SE', 't', 'p-value', 'h2', 'p-value for h2')	1
('Study and cohort details', 'Findings', 'Reference')	1
('Journal specialty', '2019 papers', 'COVID-19 papers', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Age', 'Proportion of cases', 'Pr(hospitalisation | confirmed case)', 'Pr(ICU admission | confirmed case)')	1
('Unnamed: 0', 'Imported cases contributing to transmission', 'Unnamed: 2', 'Unnamed: 3')	1
('Parameter', 'Definition', 'Value/Prior distribution')	1
('COVID-19 probability criteria', 'Unnamed: 1')	1
('Stratification of COVID-19 probability', 'Implications for exclusion from work', 'Unnamed: 2')	1
('Unnamed: 0', 'Clinical area', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5')	1
('Red (high risk)', 'Amber (medium risk)', 'Green (low risk)')	1
('Unnamed: 0', 'PPE ‘Scenarios’', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4')	1
('Patient ID', 'Type', 'HCW_ward', 'Ct value', 'Seq Attempted', 'Seq_ID', '% Sequence Coverage', 'Average Seq Depth', 'PANGOLIN lineage')	1
('Unnamed: 0', 'Distribution of COVID-19 clinical probability scores for individuals with a positive SARS-CoV-2 test result', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4')	1
('Strain + treatment', 'Fluorescent dye', 'Mean emission (AU)', 'SD of emission\xa0(AU)', 'p-value (T-test)', 'Voltage estimates (mV)', 'Voltage estimate variance')	1
('Parasite', 'FTSH1 Peptidase Motif (partial amino acid sequence)', 'Actinonin IC50 (µM)')	1
('Genotype', 'Larvae', 'Dead embryos', 'Total (embryo output)')	1
('Strain name', 'Genotype', 'Purpose')	1
('Unnamed: 0', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Mendelian Randomization estimates', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('Unnamed: 0', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Mendelian randomization estimates', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('Unnamed: 0', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Mendelian randomization estimates', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Unnamed: 0', 'Therapy', 'Target', 'Outcome', '# SNPs', 'Measure', 'Estimate', '95% CI', 'p-value')	1
('Country', 'Preprints, senior author (proportion)', 'Preprints, any author (proportion)')	1
('Unnamed: 0', 'hFzd5ICL3BRIL/anti-BRIL Fab/anti-Fab Nb (EMD-21927) (PDB ID: 6WW2)')	1
('Primer', '5’-Sequence-3’', 'Source')	1
('Strain', 'Description', 'Source')	1
('Symptom (p-value<1E-10 in gray)', 'COVID+ Count (%) (N\xa0=\xa02317)', 'COVID- Count (%) (N\xa0=\xa074850)', '(COVID+/COVID-) Relative Ratio', 'Relative ratio (95% CI)', '2-tailed p-value', 'BH-corrected p-value')	1
('Symptom', 'COVID-19 (N\xa0=\xa077167)', 'Day = −7', 'Day = −6', 'Day = −5', 'Day = −4', 'Day = −3', 'Day = −2', 'Day = −1')	1
('Unnamed: 0', 'VASH1-SVBP-microtubule')	1
('Mutation', '* FRET %', 'Phenotype')	1
('Enzymes', '5 mM H2O2', '[Enzyme]', 'kobs (min−1)')	1
('Process', 'Cell\xa0cycle\xa0regulation', 'HIF\xa0pathway', 'Immune\xa0response', 'Quality\xa0Control', 'Unnamed: 5')	1
('Assoc score↓', 'Cohen’s d (+)', 'Mann-W U norm. (-)', 'Logistic log loss (-)', 'Logistic Brier score (-)')	1
('Unnamed: 0', 'Mean (mg/dl)', 'Lower 95% confidence interval', 'Upper 95% confidence interval')	1
('Strains or plasmids', 'Relevant genotype or phenotype', 'References')	1
('Unnamed: 0', 'EMC2•EMC9', 'EMC2•EMC9.1')	1
('Unnamed: 0', 'Dataset 1', 'Dataset 2', 'Dataset 3', 'Dataset 4', 'Dataset 5')	1
('Reference', 'Virus', 'Antibody source', 'Number of patients', 'Efficacy', 'Safety')	1
('Species', 'Collection', 'ID', 'Estimated age', 'CRL/Max length')	1
('Aco_ARE_Oligo', 'Sequence')	1
('Receptor', 'Aco', 'Cyp450', 'Strain')	1
('Unnamed: 0', 'SeMet AvaR1', 'AvaR1-avenolide', 'AvaR1-DNA')	1
('Unnamed: 0', 'Complex', 'Subunit', 'Gene', 'Mitochondrial localization', 'Respiratory specific localization', 'Unnamed: 6')	1
('Unnamed: 0', 'Recording site', 'Number of recording sessions', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Behavioral state', 'Slow-Delta', 'Alpha', 'Beta', 'Spindle activity', 'Unnamed: 5')	1
('Normalized V/[E] (min−1)', 'HDAC1', 'CoREST(RCOR1)', 'MiDAC(MiDEAS)', 'NuRD(MTA1)', 'Sin3B(Sin3)', 'SMRT(NCoR2)')	1
('V/[E] (min−1)', 'HDAC1', 'CoREST(RCOR1)', 'MiDAC(MiDEAS)', 'NuRD(MTA1)', 'Sin3B(Sin3)', 'SMRT(NCoR2)')	1
('Design', 'Targeted Antigens', 'Experimental Molecular Weight (kDa)', 'Target Molecular Weight (kDa)', 'SAXS X value', 'Resolution, backbone r.m.s.d. structure (Å, Å)')	1
('Condition', 'Plants tested KM', 'Plants counted KM', 'Plants counted MG')	1
('Dataset', 'PlantSeg (default parameters)', 'PlantSeg (tuned parameters)', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Method', 'Peripodial', 'Proper disc')	1
('Network and resolution', 'Accuracy (%)', 'Precision', 'Recall', 'F 1')	1
('Segmentation', 'ARand', 'VOIsplit', 'VOImerge')	1
('Segmentation', 'ARand', 'VOIsplit', 'VOImerge', 'Accu. (%)', 'ARand.1', 'VOIsplit.1', 'VOImerge.1', 'Accu. (%).1')	1
('Dataset', 'Generic confocal (Default)', 'ds3 confocal', 'ds3 confocal + rescaling', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9')	1
('ds3 confocal + rescaling', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9')	1
('ds3 confocal + rescaling', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Parasite line', 'No. of MG sporozoites', 'No. of HL sporozoites', 'No. of SG sporozoites', 'SGS pos./total counts', 'SGS/MGS')	1
('Parasite line', 'Route of inoculation', 'Infected Mice‡', 'Prepatency (days)')	1
('Parasite lines', 'Infected mice*')	1
('Coating agent', 'Concentration', 'Protocol')	1
('Unnamed: 0', 'λabs,max (nm)', 'λem,max (nm)', 'QY')	1
('Symbol', 'log2FC (KO/WT)', 'Padj', 'dEJ', 'uORF', "3'UTR length", 'Symbol.1', 'log2FC (KO/WT).1', 'Padj.1', 'dEJ.1', 'uORF.1', "3'UTR length.1")	1
('Patient no.', 'Disease', 'Surgery side', 'Trajectories', 'Gender', 'Age at onset', 'Age at surgery', 'Disease duration (y)')	1
('Unnamed: 0', 'RMP, mV', 'Rin, MΩ', 'N, Cells')	1
('Unnamed: 0', 'mKate2 Frequency, mean ±SEM', 'BIN1-mKate2 Frequency, mean ±SEM', 'mKate2 Amplitude, mean ±SEM', 'BIN1-mKate2 Amplitude, mean ±SEM')	1
('Sample prepared @', 'DHBc 2 weeks', 'DHBc 10 months', 'DHBcR124EΔ 2 weeks', 'DHBc+FkpA 2 weeks', 'DHBcR124E 3 months', 'Unnamed: 6')	1
('Unnamed: 0', 'DHBc', 'DHBcR124E∆')	1
('Mouse', 'Recording sessions', 'Trials/session', 'Go trials/session', 'No-Go trials/session', 'Recorded cells/session')	1
('Mouse', 'Approach cells', 'Odor sampling cells', 'Moving cells', 'Waiting cells', 'Drinking cells', 'Others', '(Total)')	1
('Mouse', 'Recording sessions', 'Trials/session', 'Eating trials/session', 'No-Eating trials/session', 'Recorded cells/session')	1
('Mouse', 'Approach cells', 'Eating cells', 'Removal cells', 'Others', '(Total)')	1
('KD', 'kon, M−1 s−1', 'tequil*', 'Unnamed: 3')	1
('Unnamed: 0', 'Equilibrium*', 'Kinetic', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5')	1
('Unnamed: 0', 'NH4+', 'K+', 'Unnamed: 3', 'Unnamed: 4')	1
('Unnamed: 0', 'Z (Å)', 'Free energy (kJ/mol)', 'Unnamed: 3', 'Unnamed: 4')	1
('Without intermediates', 'Incubation\xa0(days)', 'Serial interval\xa0(days)', 'Mean difference\xa0(days)', 'Portion pre-symptomatic(-)')	1
('Tianjin', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3')	1
('Data', 'Number of\xa0Cases', 'Mean Incubation\xa0Period (days)', 'Mean Serial\xa0Interval (days)', 'Reference')	1
('Residue', 'Residues in other domains within 5 Å', 'Type of interaction', 'Mutation chosen')	1
('Data Collection', 'Phasing data set', 'Refinement data set')	1
('Option', 'Example(s)')	1
('Group/Parameter', 'SD-control', 'SD-TMAO', 'P', 'Unnamed: 4')	1
('Group/ Parameter', 'SHHF-control', 'SHHF-TMAO', 'P', 'Unnamed: 4')	1
('Group/ Parameter', 'ISO-control', 'ISO-TMAO', 'P', 'Unnamed: 4')	1
('Unnamed: 0', 'SO', 'dSP', 'sSP', 'SR', 'SLM', 'All layers')	1
('Unnamed: 0', 'Mean', 'SEM')	1
('Unnamed: 0', 'Spindle count', 'Spindle density (per min)', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Unnamed: 0', 'MNI coordinates', 'Unnamed: 2', 'Unnamed: 3')	1
('Parameter', 'Time point', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5')	1
('Probe set ID', 'Gene symbol', 'Gene title', 'Day 6 vs. baseline (fold change)')	1
('Probe set ID', 'Gene symbol', 'Gene title', 'End of treatment vs. baseline (fold change)')	1
('Probe set ID', 'Gene symbol', 'Gene title', 'Fold change')	1
('Go id', 'GO term', 'P-Value', '% Associated Genes', 'Associated genes found')	1
('Atlas label', 'MNI coordinates', 'Classification % (SEM)', 'Unnamed: 3', 'Unnamed: 4')	1
('Atlas label', 'MNI coordinates', 'Beta (SEM)', 't-value', 'Unnamed: 4', 'Unnamed: 5')	1
('Molecule', 'Abbreviation', 'Function', 'Accession number', 'Reference')	1
('Unnamed: 0', 'Time accuracy', 'Grid accuracy', 'Requirements')	1
('Unnamed: 0', 'PyDDM', 'HDDM', 'EZ-Diffusion', 'CHaRTr', 'DMAT', 'fast-dm')	1
('Gene', 'Description', 'Proposed role', 'Read count', 'Log2 change vs NG2-dsRed+', 'Log2 change vs S100β-GFP+', 'Reference')	1
('Antibody name', 'Immunogen', 'Labeling specificity', 'Source', 'Concentration')	1
('Name', 'dm6 Coordinates', 'Associated genes', 'Length (kb)', 'Nurse cell state', 'Follicle cell state', 'S2 cell state')	1
('RNAi Lines', 'Source', 'Stock number', 'Insertion site', 'Vector:', 'Other info:')	1
('Epitope', 'Species', 'Source/Reference', 'Concentration for IF')	1
('Oligo name', 'Sequence (5’-3’)')	1
('Accession ChIP epitope or Input', 'sample', 'Unnamed: 2', 'citation')	1
('Breast cancer cell line/Patient sample', 'Known mutations', 'Intrinsic subtype', 'Receptor status', 'Responsive to Unacylated Ghrelin')	1
('Parameter', 'Value', 'Units')	1
('Mac I cluster top 35 differentially expressed genes', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3')	1
('Mac II cluster top 35 differentially expressed genes', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3')	1
('Mac III cluster top 35 differentially expressed genes', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3')	1
('Mac IV cluster top 35 differentially expressed genes', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3')	1
('Mac V cluster top 35 differentially expressed genes', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3')	1
('Mig-DC versus cDC2 cluster top 20 differentially expressed genes', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3')	1
('Mig-DC versus cDC1 cluster top 20 differentially expressed genes', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3')	1
('cDC2\xa0versus cDC1 cluster top 20 differentially expressed genes', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3')	1
('Mast cell top 25 differentially expressed genes', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3')	1
('Basophil top 25 differentially expressed genes', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3')	1
('Neutrophil top 25 differentially expressed genes', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3')	1
('Unnamed: 0', 'TthV/A-ATPase', 'V1EGdasol', 'Isolated Vo')	1
('Unnamed: 0', 'Matched twin cohort: twins exposed vs. unexposed to loss of a co-twin', 'Twin-sibling cohort: twins exposed to loss of a co-twin vs. their full siblings', 'Unnamed: 3', 'Unnamed: 4')	1
('Model information', 'Matched twin cohort: twins exposed vs. unexposed to loss of a co-twin', 'Twin-sibling cohort: twins exposed to loss of a co-twin vs. their full siblings', 'Unnamed: 3', 'Unnamed: 4')	1
('Unnamed: 0', 'Twins who lost a monozygotic twin vs. matched unexposed monozygotic twins or their full siblings', 'Twins who lost a dizygotic twin vs. matched unexposed dizygotic twins or their full siblings', 'Unnamed: 3', 'Unnamed: 4')	1
('Purpose', 'Amplifies', 'Primers')	1
('Group', 'n', '100 pA (%)', 'p-value', 'n.1', '150 pA (%)', 'p-value.1', 'n.2', '200 pA (%)', 'p-Value')	1
('Group', 'n', 'Session 1 (% Late CR’s)', 'p-Value', 'Session 5 (% Late CR’s)', 'p-Value.1')	1
('Group', 'n', '100 pA (%)', 'p-Value', 'n.1', '150 pA (%)', 'p-Value.1', 'n.2', '200 pA (%)', 'p-Value.2')	1
('Group', 'n', 'Probability (%)', 'p-Value')	1
('Group', 'n', 'Mean Firing Rate (spikes/sec)', 'p-Value', 'Peak Firing Rate (spikes/sec)', 'Latency to Onset (s)', 'p-Value.1')	1
('Group', 'n', 'Mean Firing Rate (spikes/sec)', 'p-Value', 'Peak Firing Rate (spikes/sec)', 'Firing Rate Across Time p-value', 'Latency to Onset (s)', 'p-Value.1')	1
('Group', 'n', 'Mean firing rate (spikes/sec)', 'p-Value')	1
('Group', 'n', 'ADP Amplitude (mV) pre', 'ADP Amplitude (mV) post', 'Pre-Post p-value', 'AUC (mV*ms) pre', 'AUC (mV*ms) post', 'Pre-Post p-value.1')	1
('Group', 'RMP (mV)', 'Rinput (MΩ)', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5')	1
('Motor coordination (time to fall, s)', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Parameter (general)', 'Description')	1
('(b)', 'IBM (well-mixed)', 'IBM (d\xa0=\xa010)', 'IBM (d\xa0=\xa01)', 'IBM (d\xa0=\xa00)')	1
('Predictor*', 'Estimated effect†', 'Adjusted P-value (α\xa0=\xa00.05)‡', 'Variance explained§', 'Unnamed: 4')	1
('Unnamed: 0', 'Unnamed: 1', 'Unnamed: 2', '37°C*', '25°C*', 'Unnamed: 5', 'Unnamed: 6')	1
('Specificity', 'Positions*')	1
('Parameter', 'male', 'female', 'p values', 'Unnamed: 4', 'Unnamed: 5')	1
('Subunit name', 'Uniprot ID', 'Chain ID', 'Total residues', 'Atomic residues', 'Poly-Ala', 'Un-modeled residues', '% atomic', 'TMH', 'Identified RNA editing sites*', 'Ligands, lipids')	1
('Location', 'Subunit', 'Mammals', 'Y. lipolytica', 'V. radiata')	1
('Subunit 1', 'Subunit 2', 'Inter-subunit interface', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Variable', 'Value', 'Source')	1
('Strain', 'Nuclear genotype', 'mtDNA', 'Source')	1
('Unnamed: 0', 'Gene coding for', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4')	1
('Condition tested', 'CFUs total', 'Num of rep', 'Med td (hrs)', 'IQR td (hrs)', 'Med T-Lag time (hrs)', 'IQR T-Lag time (hrs)', 'Med T-Exp (hrs)', 'IQR T-Exp (hrs)', 'Med Num Dbl', 'IQR Num Dbl')	1
('Total number of sample reads (number of trials)', 'Number of D94G SNPs detected (number of success) p=r', 'Ratio of resistant cells to sensitive cells (probability of trial success)', '95% Confidence interval [Low]-[High]')	1
('Unnamed: 0', 'Unnamed: 1', 'QRDR', 'QRDR.1', 'Unnamed: 4')	1
('Performance measure', 'Relative performance after different alignments')	1
('S. cerevisiae', 'H. sapiens')	1
('Protein complex', 'Plasmid name', 'Names used in this paper', 'Proteins expressed*', 'Vector', 'References')	1
('Case', 'λ', 'γ', 'r')	1
('Case', 'ω̂', 'λ1/λ2')	1
('Unnamed: 0', 'SEC-SAXS+SEC-SANS', 'SAXS', 'Unnamed: 3', 'Unnamed: 4')	1
('Data for integration', 'Srel', 'χ2', 'Unnamed: 3')	1
('ROI', 'Contrast', 'Mean', 'SEM', 't', 'P')	1
('ROI', 'Space', 'Mean', 'SEM', 'P')	1
('Condition', 'tIF (s)', 'tOF (s)')	1
('Unnamed: 0', 'GDP', 'GTP')	1
('Unnamed: 0', 'Pmol/mg protein', 'Unnamed: 2')	1
('Compound', 'RT (min)', 'Quantitation transition (CE)', 'Confirmation transition (CE)')	1
('Hox protein', 'DRG expression', 'pSN expression', 'RC level', 'Hox co-expression')	1
('Dataset', 'Temporal range', 'Nisolates', 'Geographic range', 'Metadata available', 'SRA study ID/Reference')	1
('Variant', 'Unnamed: 1', 'Genetic', 'Phenotypic', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Variant', 'Diagnostic assay', 'Documented association with diagnostic failure', 'Prevalence in dataset', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('Variant', 'Reference accession', 'Coordinates of genetic locus in reference entry', 'Position of mutation in reference locus')	1
('Unnamed: 0', 'In Lab', 'Online Version 3', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Unnamed: 0', 'Version 1', 'Version 2', 'Version 3', 'Version 4', 'Version Effect', 'Paranoia Effect', 'Interaction', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12', 'Unnamed: 13', 'Unnamed: 14')	1
('Unnamed: 0', 'Block effect †', 'Group effect‡', 'Interaction effect', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Unnamed: 0', 'Group effect †', 'Interaction effect‡', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Unnamed: 0', 'Block', 'Group', 'Version', 'Block*group* Version', 'Group*version', 'Block*group', 'Block*version', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12', 'Unnamed: 13', 'Unnamed: 14')	1
('Unnamed: 0', 'ω3', 'µ30', 'κ', 'ω2', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9')	1
('Item', 'Prompt')	1
('Unnamed: 0', 'Win-switch rate', 'U-value', 'Lose-stay rate', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('Unnamed: 0', 'Low Paranoia (n=56)†', 'High Paranoia (n=16)†', 'Paranoia Group Effect‡', 'Paranoia x Block Effect‡', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11')	1
('Unnamed: 0', 'In lab', 'Online', 'Rats')	1
('Questionnaire/subscale', 'Experiment 1', 'Experiment 2')	1
('Discipline', 'Journal A', 'Journal B', 'Journal C', 'Journal D')	1
('Cluster', 'Location', 'Size (Mb)', '# of KRAB-ZFPs*', 'ChIP-seq data')	1
('Virus characterization', 'Pair 1 viruses', 'Pair 2 viruses', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5')	1
('HSA21p', 'gene start', 'HSA21q Paralog', 'gene start.1')	1
('Issues', 'TcMAC21', 'Tc1', 'Ts65Dn', 'Ts1Cje', 'Dp(16)1Yey/+ or Dp1Tyb', 'Dp(10)1Yey/+; Dp(16)1Yey/+; Dp(17)1Yey/+')	1
('Unnamed: 0', 'Experiment', 'Genetic background', 'Age', 'Eu', 'TcMAC21')	1
('Unnamed: 0', 'Gene or aim', 'Primer name (forward)', "Forward primer(5'−3')", 'Primer name (reverse)', "Reverse primer(5'−3')", 'Product size')	1
('Group', 'Age (years)', 'Chronicity (years)', 'LHPC volume (mm3)', 'RHPC volume (mm3)', 'LHPC % volume loss relative to CTLa', 'RHPC % volume loss relative to CTLa', 'WASI')	1
('Unnamed: 0', 'HPC', 'CTL', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'HPC1', 'HPC2', 'HPC3', 'HPC4')	1
('Unnamed: 0', 'Wild type (EMDB-10429) (PDB 6TAX)', 'R4753K (EMDB-10430) (PDB 6TAY)')	1
('Unnamed: 0', 'Nucleosome-CHD4 complex (EMD-10058) (PDB 6RYR)', 'Nucleosome-CHD42 complex (EMDB-10059) (PDB 6RYU)')	1
('Unnamed: 0', 'Mutated Residue', 'Location', 'Predicted effect based on structure', 'Biochemical observations')	1
('Notation/Terminology', 'Physical Interpretation', 'Definition')	1
('Unnamed: 0', 'AII #1', 'AII #2', 'AII #3', 'Mean\xa0±SD')	1
('Unnamed: 0', 'Axons\xa0(Figure 3C2)', 'Cell 1 (Figure 4)', 'Cell 2 (Figure 4)')	1
('Name', 'Relevant characteristics', 'Source*/reference')	1
('Name', 'Sequence (5´→3´)')	1
('Unnamed: 0', 'Chr coor (bp)', 'Size (kb)', 'Size compared to native centromere (%)', 'GC%', 'Genes spanned by neocentromere', 'Gene ID', '% covered by Neocentromere', 'Exons inside neocentromere')	1
('Target name', 'Primer name', "Sequence (5'>3')", 'Description', 'Reference')	1
('Unnamed: 0', 'Unnamed: 1', 'AMPA', 'Kainate', 'NMDA', 'GABAA', 'GABAB', 'GABAA/BZ', 'M₁', 'M₂', 'M₃', 'α₁', 'α₂', '5-HT₁A', '5-HT₂', 'A₁', 'D₁')	1
('Transmitter', 'Receptor', 'Ligand (nM)', 'Property', 'Displacer', 'Incubation buffer', 'Pre-incubation', 'Main incubation', 'Final rinsing')	1
('Exp.', 'Test type', 'Mean agreement', 'Chance')	1
('B56γ12-380', 'Titrant', 'KD (µM)*', 'ΔH (kcal/mol)', 'TΔS (kcal/mol)')	1
('Unnamed: 0', 'B56:KIF4ALE,PE*,†', 'B56:AIM1*,‡')	1
('Male Mice Facility trained 24/7', 'Group', 'Days under headfix protocol', 'Days with head-fixation', 'Total head-fixes', 'Total hours head-fixed', 'Head-fixes /day', 'Minutes head-fixed /day', 'Success rate GO trials of last 5 days [%]', 'Number of trials daily average based on 5 days at max success, all outcomes')	1
('Description', '#', 'Manufacturer', 'Part Number')	1
('Unnamed: 0', 'sample', '#dyes', '#NLSs', 'A', 'IMAX', 'τ', 'J', 'ΔG')	1
('Capsid', 'Diameter [nm]', 'F(R) [kBT]', 'ϵ [kBT]')	1
('Community', 'Intra-organizational activities', 'Inter-organizational activities')	1
('Key element', 'Teaching and learning principle')	1
('Unnamed: 0', 'Dataset 1', 'Dataset 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('Unnamed: 0', 'Dataset 3 CALHM6_Ca2+', 'Dataset 4 CALHM2_Ca2+', 'Unnamed: 3')	1
('(A)', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4')	1
('Data set', 'Reference', 'Pathway', 'Pre/post', 'Freq.', 'Npulses', 'Experiment', '10 min', '15 min', '20 min', 'SD')	1
('(A)', 'Unnamed: 1', 'Forw.', 'Backw.', 'Unnamed: 4', 'Unnamed: 5', 'Forw..1', 'Backw..1')	1
('(B)', 'Unnamed: 1')	1
('Species', 'Unnamed: 1', 'Conc. (nM)', 'Species.1', 'Unnamed: 4', 'Conc. (nM).1', 'Species.2', 'Unnamed: 7', 'Conc. (nM).2')	1
('Specific NAIVE BDQ genes', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('hk-MTB + PZA', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('NDMM', 'Class', 'Conservation Pattern', 'fitMk model', 'SIMMAP changes', 'D', 'P (Ho: D\xa0=\xa00)', 'P (Ho: D\xa0=\xa01)', 'Phylogenetic interpretation')	1
('Unnamed: 0', 'TD males (N\xa0=\xa029)', 'Autistic males (N\xa0=\xa023)', 'TD females (N\xa0=\xa033)', 'Autistic females (N\xa0=\xa025)', 'Sex', 'Diagnosis', 'Sex* diagnosis')	1
('A: Neuron model', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3')	1
('Values of model parameters', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3')	1
('Parameter', 'Value used to generate data', 'Mean of inferred values', 'Std of inferred values')	1
('System', 'Chemical or nutrient', 'Unit1', 'Unit2', 'Quality criteria', 'Citation')	1
('Dataset', 'Variable', 'Publication bias p', 'Publication bias', 'Intercept', 'SE')	1
('Response', 'QM', 'Df', 'N', 'p-value')	1
('Dataset', 'Response', 'Predictor', 'Estimate', 'SE', 'Crit.value', 'Df', 'p-Value')	1
('Dataset', 'Response', 'Predictor', 'QM', 'p-value')	1
('Dataset', 'Response', 'Predictor', 'Std.est', 'Est.', 'SE', 'Crit.value', 'Df', 'p-value')	1
('Unnamed: 0', 'CSS', 'TGACv1', 'RefSeqv1.0', 'Durum wheat', 'Wild emmer wheat')	1
('Collection', 'Short description', 'Number of accessions', 'Genotyping', 'Data/seed availability', 'More information/Reference')	1
('Variety', 'Habit', 'Origin', 'Availability †')	1
('Onset', 'Unnamed: 1')	1
('Unnamed: 0', 'Unanimous', '2/3 agree', 'No consensus', 'P value')	1
('A.Reviewer agreement on human data', 'Unnamed: 1', 'Unnamed: 2')	1
('Year', 'Scenario', '95% CrI low', '50% CrI low', 'Median', '50% CrI high', '95% CrI high')	1
('Covariate', 'Interpretation')	1
('Scenario', 'Temperature rise (°C) [range]', 'CO2 concentrations (ppm)')	1
('Location', 'Sample size', 'Year', 'Reference')	1
('Parameter', '95% CrI low', 'Median', '95% CrI high', 'Meaning')	1
('Unnamed: 0', 'PKIACCEPTOR3', 'PKIACCEPTOR28', 'PKIACCEPTOR59', 'PKIDONOR-ACCEPTOR')	1
('Mutation', 'Sequence', 'V0.5 (mV)', 'Unnamed: 3', 'Unnamed: 4')	1
('Parameter', 'Best estimate (Used in Figure 2)', 'Plausible range (Used in Figure 3)', 'References and notes')	1
('GWAS trait', 'Number of eQTLs genes (background) with at least one GWAS hit', 'Number of MMnet genes with at least one GWAS hit', 'Frequency (%) eQTLs genes (background) with at least one GWAS hit', 'Frequency (%) MMnet genes with at least one GWAS hit', 'P-value MMnet enrichment over background (hypergeometric test)')	1
('Flight phase', 'Search', 'Approach', 'Buzz', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Translation model', 'Input(s)', 'rxy', 'SSIMxy')	1
('Gene', 'Description', 'Assay', 'Notes')	1
('Genome', 'Medium', 'Mean copy number', 'Minimum copy number*', 'Maximum copy number*')	1
('Genome', 'Medium', 'Gene', 'Mean copy number', 'Minimum number*', 'Maximum number*', 'Adjusted p-value†')	1
('Species', '#Tandem runs', 'Behavioral pattern', 'Sampling period (s)', '#Time steps', 'History length k')	1
('Species', 'Behavioral pattern', 'TL\u2004→\u2004F', 'TL\u2004→\u2004Fs', 'TF\u2004→\u2004L', 'TF\u2004→\u2004Ls', '${\\overset{\\sim}{T}}_{L\\rightarrow F}({\\overset{\\sim}{T}}_{F\\rightarrow L})$')	1
('Species', 'Behavioral pattern', 'H1:\xa0TL\u2004→\u2004F\u2004>\u2004TL\u2004→\u2004Fs', 'H1:\xa0TF\u2004→\u2004L\u2004>\u2004TF\u2004→\u2004Ls', 'H1:\xa0TL\u2004→\u2004F\u2004>\u2004TF\u2004→\u2004L', 'H1:\xa0TF\u2004→\u2004L\u2004>\u2004TL\u2004→\u2004F')	1
('Figure', 'Source', 'd.f.', 'Sum of squares', 'F-score', 'p-value')	1
('Unnamed: 0', 'Unnamed: 1', 'Spiking neurons P3-P10', 'Non-spiking P3-P10', 'Spiking plus non-spiking P3-P5', 'Spiking plus non-spiking P6-P8', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9')	1
('Figure', 'Variable', 'ß', 'SE', 'Df', '/t/', 'VIF', 'RMSE', 'p-value')	1
('Figure', 'Term', 'Estimate', 'Standard error', 'T', 'p-value')	1
('Unnamed: 0', 'Frequency of spontaneous excitatory synaptic currents (Hz)', 'Frequency of spontaneous inhibitory synaptic currents (Hz)', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Unnamed: 0', 'Frequency of spontaneous excitatory synaptic currents', 'Unnamed: 2', 'Frequency of spontaneous inhibitory synaptic currents')	1
('Gene name', 'Oligo name', 'Sequence', 'forward/reverse')	1
('Variables', 'Unnamed: 1', 'Unnamed: 2')	1
('Biological parameters', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3')	1
('Numerical parameters', 'Unnamed: 1', 'Unnamed: 2')	1
('Parameters', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3')	1
('Unnamed: 0', 'Model parameters', 'Unnamed: 2', 'Unnamed: 3')	1
('Target', 'Species', 'Catalog #')	1
('Measure', 'Mean (SD)', 'Range')	1
('Unnamed: 0', 'Variable', 'β', 'SE', 'p', 'Adjusted R2')	1
('Sample name', 'Cell count when sampling', 'Cell count after thaw and wash in PBS', 'TARGET conc. of cells', 'Cell count after extra dilution in PBS', 'Number of cells expected', 'Number of cells identified after sequencing')	1
('Cell line', 'HEK293T', 'NCI-H1703', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5')	1
('Receptor', 'LRP6-mCherry', 'LRP6-tdTomato', 'LRP6-tdTomato.1', 'xKremen2-mCherry', 'xKremen2- mCherry, LRP6')	1
('Model parameter', 'Value', 'Description')	1
('Figure number', 'Conditions', 'NSyn', 'NDishes', 'NCultures', 'Mean\xa0±\xa0SEM', 'Statistical test', 'Pval')	1
('Run ID', 'Patient ID', 'Sample type', 'Collection site', 'Sequencing platform', 'Total UTD', 'Passed UTDs', 'Validation rate*', 'AUC')	1
('Patient ID', 'Sample type', 'Collection site', 'Analysis performed', 'Unnamed: 4')	1
('BFM/0', 'Model', 'Lateral inhibition', 'Quadratic trend', 'Linear trend', 'Unnamed: 5', 'Inhibition vs quadratic', 'Inhibition vs Linear')	1
('Component of the TME', 'Impact on T Cell Metabolism', 'Effect on Anti-Tumor Immunity')	1
('Sorting algorithm', 'Language', 'Notes')	1
('Study set', '# Rec. / # Elec. / Dur.', 'Source lab.', 'Description')	1
('Strain', 'String', 'Log null-fitness', 'Non-epistatic', 'Log MIC', 'Non-epistatic.1')	1
('Journal (articles with imaging/total articles, percentage)', 'Imaging figures (%)', 'Imaging methods (%)', 'Pass methods quality (%)')	1
('Gene', 'Protein name', 'Construct', 'Species', 'Template', 'Agg. sim [µs]')	1
('Motor', 'Duty Ratio', 'ADP Release Rate [s-1]', 'Citation')	1
('Simulation set', 'No. of states', 'Cluster radius [nm2]', 'Lag time [ns]')	1
('Scalp EEG', 'original', 'new')	1
('Compounds', 'MRM transition', 'RT (min)', 'Collision energy (V)', 'Unnamed: 4')	1
('Compound', 'Comment', 'Precursor ion', 'MS1 resolution', 'Product ion', 'MS2 resolution', 'RT', 'RT delta min (total)')	1
('Construct', 'Concentration injected (μM)', 'Concentration at detector* (μM)', 'Absolute mass (kDa)', 'Protomers/oligomer†')	1
('Highest-order term included', 'KD')	1
('Unnamed: 0', 'Unnamed: 1', 'Success in three-leg rubbing', 'Success in climbing, time to climb§ (in seconds)', 'Unnamed: 4', 'Unnamed: 5')	1
('Miller, 1950', 'Rajashekhar and Singh, 1994', 'Flood et al., 2013', 'Schwarz et al., 2017', 'Muscle location', 'Split GAL4', 'AD split half', 'DBD split half', 'MNs in # proboscis sides', 'Dend- rites', 'Soma', 'Nerve')	1
('GAL4 line', 'Motor neurons in proboscis', 'GAL4 line.1', 'Motor neurons in proboscis.1', 'GAL4 line.2', 'Motor neurons in proboscis.2')	1
('mn', 'Activation phenotypes', 'Silencing phenotypes')	1
('Model ID', 'Citation', 'CPU(s)', 'Ram(MB)', 'File(MB)')	1
('Cell type', 'ℓ [µm]', 'vT [µm/min]', 'vτ [µm/min]')	1
('Unnamed: 0', 'Myosin peak position', 'Anterior-posterior myosin', 'Chiral flow properties')	1
('Measured vel.', 'wt', 'ect-2', 'rga-3', 'Equations S13–S16', 'wt.1', 'ect-2.1', 'rga-3.1')	1
('Condition', 'Angular skew velocity ω\u2009[°/s]\xa0from\xa0theory', 'Measured average\xa0spindle\xa0skew rate [°/s]')	1
('Species', 'Synonymous', 'Missense', 'Nonsense')	1
('Channel name', 'Fluorophore', 'Fortessa HTS (1)', 'Fortessa', 'Fortessa HTS (2)')	1
('Unnamed: 0', 'Variations of word ABCDE', 'four letter words', 'five letter words', 'six letter words', 'Total')	1
('Alignment', 'Letter model correlation', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4')	1
('Middle Letter Transposition', 'Edge Letter Transposition', 'Middle Letter Substitution', 'Edge Letter Substitution', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('ROI', 'Definition', '#voxels (mean ± sd)', 'ROI peak location')	1
('Genotype of breeding pairs', 'Ubiad1 genotype of offspring', 'Unnamed: 2', 'Unnamed: 3')	1
('Unnamed: 0', 'Independent variable', 'Df', 'Micro- arthropod', 'Acari', 'Orib_', 'Meso_', 'Pros_', 'Collem- bola', 'Isot_', 'Ento_', 'Smin_', 'Kati_', 'Hypo_', 'Onyc_')	1
('Compound', 'cLogP', 'cLogD (pH7.4)', 'Molecular weight (g/mol)', 'Topological polar surface area (Å2)', 'No. hydrogen bond donors', 'Strongest basic pKa calculation', 'CNS MPO score')	1
('Donor ID', 'Age', 'Sex', 'Cause of death')	1
('Donor ID', 'Discs', 'Thompson grade and Degeneration', 'Cell type', 'Type of culture', 'Type of assays', 'Results')	1
('Unnamed: 0', 'Donor ID', '9', '11', '13', '14')	1
('IMS', 'Inf. lip', 'Sup. lip', 'Nose', 'Eyebrows', 'Forehead', 'R. cheek', 'L. cheek', 'Sup. R. eyelid', 'Inf. R. eyelid', 'Sup. L. eyelid', 'Inf. L. eyelid')	1
('Unnamed: 0', 'Vision', 'Reported best corrected acuity', 'Strabismus', 'Eye movements', 'Mid-level perception* (modified t-test)2')	1
('Unnamed: 0', 'frPanx- ΔLC (EMD-21150) (PDB: 6VD7)')	1
('Experiment 1', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9')	1
('Time', 'Procedures')	1
('external_gene_name', 'description', 'TdTOSX+CD45- logFC', 'TdTOSX+CD45- linearFC')	1
('external_gene_ name', 'description', 'TdTOSX+CD45+ logFC', 'TdTOSX+CD45+ linearFC')	1
('Substrate (concentration)', 'kobs* (U/mg)', 'Enantiomeric excess product (ee)')	1
('Single mutants', 'kobs* (U/mg)', 'Tm\xa0app (°C)', 'ΔTm (°C)')	1
('Enzyme', 'Tm (°C)', 'kcat (s−1)', 'KM,NADP+ (µM)', 'kcat/KM,NADP+ (s−1 mM−1)', 'Conversion and ee (COBA)', 'Conversion and ee (4-CAP)')	1
('Cosolvent', 'Tm (°C)', 'ΔTm (°C)')	1
('Enzyme', 'Abbreviation', 'Size (aa)', 'Quaternary structure', 'ΔTm', 'Reference')	1
('Cryo-EM data collection, refinement and validation statistics', 'Unnamed: 1', 'Unnamed: 2')	1
('Unnamed: 0', 'RMP (mV)', 'AP threshold (mV)', 'AP amplitude (mV)', 'AP half-width (μs)', 'AHP (mV)', 'ADP (mV)')	1
('Symbols', 'Description', 'DLD-1', 'RPE-1 p53-/-', 'Range for data fitting (both models)', 'Reason/Source of information')	1
('Unnamed: 0', 'Index allele', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5')	1
('Unnamed: 0', 'Index allele', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4')	1
('Infection', 'Outcome', 'Covariates')	1
('Unnamed: 0', 'Risk of HAM/TSP', 'N', 'Unnamed: 3', 'Unnamed: 4')	1
('Unnamed: 0', 'Early viral load set point', 'Time to low CD4 cell count', 'N', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('Unnamed: 0', 'Coefficient', 'P value', 'N in group')	1
('Unnamed: 0', 'Odds of spontaneous clearance', 'N', 'Unnamed: 3', 'Unnamed: 4')	1
('Unnamed: 0', 'Odds of poor prognosis', 'N', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Mouse/Body Part', 'Body', 'Ears', 'Nose', 'Hands')	1
('Monkeys', 'Beta', 'SEM', 't-statistics', 'p-value', '95% confidence interval Lower\xa0Upper', 'Unnamed: 6')	1
('Monkeys', 'Stage 1', 'Stage 2', 'Stage 3', 'Stage 4', 'Stage 5')	1
('Time (s) (post-docking)', 'vSUV', 'vSUV + Cpx', 'Syt1-vSUV', 'Syt1-vSUV + Cpx')	1
('Unnamed: 0', 'vSUV', 'vSUV + cpx', 'Syt1-vSUV', 'Syt1-vSUV + cpx')	1
('Time (s) (post-docking)', 'vSUV', 'Syt1WT', 'Syt1F349A', 'Syt13DA', 'Syt1Q', 'Syt1LLQQ')	1
('Unnamed: 0', 'vSUV', 'Syt1WT', 'Syt1F349A', 'Syt13DA', 'Syt1Q', 'Syt1LLQQ')	1
('Time (s) (post-docking)', 'vSUV', 'Syt1WT', 'Syt1F349A', 'Syt1Q', 'Syt1LLQQ')	1
('Unnamed: 0', 'vSUV', 'Syt1WT', 'Syt1F349A', 'Syt1Q', 'Syt1LLQQ')	1
('<5 Years', '5–10 Years', '>10 Years')	1
('<5Years', '5–10 Years', '>10 Years')	1
('Characteristics', 'Phases one and two', 'Phase three (workshop)')	1
('(a)', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9')	1
('Unnamed: 0', 'EE-MCB\xa0(mol%)', 'PC/PS/CH/PI(3)P/SM-MCB (mol%)', 'PC/PS/CH/PI(3)P/PlasmPE-MCB (mol%)', 'PC/PS/CH-MCB (mol%)', 'PC/PS-MCB\xa0(mol%)')	1
('Unnamed: 0', '10 nM GFP-Rab5/GDI', '10 nM GFP-Rab5/GDI, 100 nM Rabex5/Rabaptin5, 1 µM GDI, 1 mM GDP', '10 nM GFP-Rab5/GDI, 100 nM Rabex5/Rabaptin5, 1 µM GDI, 1 mM GTP')	1
('Unnamed: 0', '10 nM GFP-Rab5/GDI, 1 µM GDI, 1 mM GTP', '10 nM GFP-Rab5/GDI, 50 nM Rabex5/Rabaptin5, 1 µM GDI, 1 mM GTP', '10 nM GFP-Rab5/GDI, 100 nM Rabex5/Rabaptin5, 1 µM GDI, 1 mM GTP')	1
('Unnamed: 0', 'PC/PS (0% PI(3)P)', 'PC/PS (1% PI(3)P)', 'EE (0% PI(3)P)', 'EE (1% PI(3)P)')	1
('Unnamed: 0', 'PC/PS (1% PI(3)P)', 'PC/PS/CH (1% PI(3)P)', 'PC/PS/CH/PlasmPE (1% PI(3)P)', 'PC/PS/CH/SM (1% PI(3)P)', 'EE (1% PI(3)P)')	1
('Unnamed: 0', 'Expected theoretical outcome (100% flipping)', 'Expected theoretical outcome (70% flipping)', 'Expected theoretical outcome (50% flipping)', 'Actual outcome from imaging and manual counting', 'Actual outcome measured by flow cytometry (~70% labelled)')	1
('Sample and assay', 'Level', 'Reference Range*')	1
('PDB entry, Septin•nucleotide (oligomeric state)', 'Residues within 5 Å (capitalized) of position corresponding to ScCdc3 Thr302*', 'Residues within 5 Å (capitalized) of His corresponding to ScCdc3 His262')	1
('Species', 'Amino acid at position corresponding to ScCdc3 Lys181', 'Amino acid at position corresponding to ScCdc10 Lys155', 'Amino acid at position corresponding to ScCdc10 Gln265')	1
('Subject', 'Age', 'Gender', 'Amputation characteristics', 'Implant duration (days)', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('Naturalness', 'Depth', 'Mechanical', 'Tingle', 'Movement', 'Temperature')	1
('Unnamed: 0', 'Single', 'Multi', 'Total', 'Unnamed: 4', 'Unnamed: 5')	1
('Parameter', 'All Cells (n=26)', 'Males (n=15)', 'Females (n=11)', 'p value')	1
('Parameter', 'All Cells (n=28)', 'Males (n=15)', 'Females (n=13)', 'p value')	1
('Model', 'Genotype', 'Cre field', 'Organismal/behavioral phenotype', 'Histologic findings', 'Rationale for use', 'Impact of torsinB modulation')	1
('Gene', 'Primer name', 'Cycle', 'Band sizes')	1
('Patient', 'Age', 'Sex', 'Education', 'Laterality', 'Time since stroke', 'Lesion site', 'Lesion\xa0size (cm3)', '% overlap with AG', '% overlap with SMG', 'AAT')	1
('Task/condition', 'RTs ± SEM (in ms)', 'ERs ± SEM (in %)')	1
('Region', 'Side', 'MNI coordinates (x, y, z)', 'T', 'Cluster size', 'Unnamed: 5', 'Unnamed: 6')	1
('Parameter', 'Orexin neuron-ablated mice', 'Orexin and MCH-ablated mice', '- fold Difference (OXMC/OX)', 'P value')	1
('Parameter', 'DT sleep', 'Cataplexy')	1
('Cytokines (pg/ml)', 'Control (n\xa0=\xa0104)', 'age-related macular degeneration (n\xa0=\xa0234)', 'P value')	1
('Unnamed: 0', 'Unnamed: 1', 'Relative risk ratio', 'Relative risk ratio.1', 'Unnamed: 4', 'Unnamed: 5')	1
('Group', 'Clone #', 'Period (hr)*', 'STDEV', 'Group.1', 'Clone #.1', 'Period (hr)*.1', 'STDEV.1')	1
('Gene', 'DE gene (SP vs LP)', 'Fold change (LP/SP)', 'Adjusted P-Value', 'DE gene (SSP vs LSP)', 'DE gene (SLP vs LLP)', 'Coding mutation', 'DMR (SP vs LP)')	1
('Description', 'Genotype', 'Use', 'Figures')	1
('Description', 'Number of recording sessions', 'Total fly count', 'Stimulus duration', 'Interleave duration')	1
('Unnamed: 0', 'hM3Dq', 'Pitx2::Cre; hM3Dq')	1
('Unnamed: 0', 'Pitx2::Cre;tdTomato', 'Pitx2::Cre;tdTomato;hM4Di', 'Pitx2::Cre;tdTomato;hM3Dq')	1
('Unnamed: 0', 'hM4Di', 'Pitx2::Cre;hM4Di')	1
('Small molecule', 'Bioactivity', 'MIC 50 (mM)', 'MIC 90 (mM)', 'Result')	1
('Unnamed: 0', 'M48', 'M49', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Unnamed: 0', 'M48', 'M49', 'Total')	1
('Unnamed: 0', 'Total number', 'IG1', 'IG2-90', 'Unnamed: 4', 'Unnamed: 5')	1
('Tier', 'Core SNPs', 'Accessory genes')	1
('Protein', 'Function', 'Domain', 'Reference')	1
('Year', 'Study deaths from snakebite/all causes', 'Standardized death rate /100,000 (all ages) and age-specific rates /100,000*', 'Snakebite mortality risk†', 'Estimated national deaths (000)‡', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('Age range', 'Male\xa0(LL, UL)', 'Female\xa0(LL, UL)', 'Both\xa0(LL, UL)')	1
('Unnamed: 0', 'Unnamed: 1', 'Study deaths in MDS', 'Annual average standardized death rate /100,000', 'Estimated deaths for 2001-14 (000)', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('Unnamed: 0', 'Government reporting*', 'MDS estimates', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Age group/Year', '2001', '2002', '2003', '2004', '2005', '2006', '2007', '2008', '2009', '2010', '2011', '2012', '2013', '2014', '2001-14')	1
('In- hospital case-fatality rate/100 bites', "Out-of-hospital to in-hospital hypothetical ratio K = I(h')/I(h)", 'Hypothetical % who sought hospital treatment 1/(k+1)', 'Expected no. of snakebites in 000', 'No. of envenomations in 000', 'No. of dry bites in 000', 'Unnamed: 6', 'Unnamed: 7')	1
('Source of study', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Unnamed: 0', 'Unnamed: 1', 'No. of studies', 'Total no. of snakebites', 'Total no. of snakebite deaths', 'Sources of studies', 'Publication year/number of studies', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12', 'Unnamed: 13', 'Unnamed: 14', 'Unnamed: 15', 'Unnamed: 16', 'Unnamed: 17', 'Unnamed: 18', 'Unnamed: 19', 'Unnamed: 20', 'Unnamed: 21', 'Unnamed: 22', 'Unnamed: 23', 'Unnamed: 24', 'Unnamed: 25', 'Unnamed: 26')	1
('Unnamed: 0', 'Relative risk of snakebite mortality', 'Unnamed: 2', 'Unnamed: 3')	1
('Mouse strain/genotype', 'Body weight (+ / - SD)')	1
('Name', 'Low', 'δ', 'θ', 'α', 'β1', 'β2', 'γ1', 'γ2', 'γ3')	1
('#', 'Modality', 'Family', 'Input', 'Feature', 'Variants', 'Spatial selection')	1
('Modality', 'MEG sensor', 'MEG source', 'MRI', 'fMRI', 'Common cases')	1
('ID', 'Family', 'Input', 'Feature', 'Variant', 'Importance', 'MAE')	1
('#', 'Name', 'Type', 'Variables (38)')	1
('Para.', 'Visual homing', 'Optimal integration tuning PI', 'Optimal integration tuning VH', 'Route following', 'Whole model ZV', 'Whole model FV')	1
('Name', 'Function', 'Num', 'Network', 'Brain region', 'Neuron in species(e.g.)', 'Reference')	1
('Category', 'Behaviour', 'Sex', 'Description', 'Reference')	1
('Proposed mechanism', 'Cooperative behaviour', 'Sex of test subjects', 'Origins of test subjects', 'Task', 'References')	1
('Unnamed: 0', 'Follow-up round 1 (N =\xa0253)', 'Follow-up round 2 (N =\xa0125)', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Unnamed: 0', 'Model 1: univariable (n =\xa0378)', 'Model 2: multivariable (n =\xa0378)', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Unnamed: 0', '1', '2', '3', '4', '5', '6', '7', '8', '9')	1
('Unnamed: 0', 'GP', 'GPa', 'PhK', 'GSa/GS', 'GDE', 'GLUT4', 'Glycogen', 'Serca 1', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12')	1
('GDE', 'Patient ID', 'unique peptide count', 'protein sequence coverage (%)')	1
('Unnamed: 0', 'MHN', 'MHS', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10')	1
('GPa whm', 'GPa mic', 'PhK mic', 'GDE mic', 'GLUT4 mic', 'Glycogen mic')	1
('Model', 'Drosophila', 'Locust', 'Unnamed: 3')	1
('Genomic target', 'Exon', '5’/3’ Homology arm length', 'Reporter expression', 'Number of germline transmitting adults', 'Percentage of germline transmitting adults')	1
('Genomic target', '# of germline transmitting adults', '# of precise 5’ junctions by PCR', '# of precise 3’ junctions by PCR', '# of precise integrations by Southern')	1
('GnRH proximal dendrites', 'Unnamed: 1')	1
('Chromosome number', 'Core centromere', 'Full-length centromere', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('Clade C', 'Clade B1', 'Clade B2', 'Clade A', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Protein name', 'Score', 'Spi %', 'Sequence')	1
('BBSome subunit A', 'BBSome subunit B', 'Interface area (A-B) [Å2]', 'ΔiG (A-B) [kcal/mol]')	1
('BBS gene', 'mutation', 'phenotype', 'Reference')	1
('Unnamed: 0', 'F-statistic', 'Unnamed: 2', 'Unnamed: 3')	1
('Variable', 'Treatment cohort', 'Intact', 'Reinnervated', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9')	1
('Structure restraints', 'XPLOR-NIH*', 'PDB 6MIE†')	1
('Unnamed: 0', 'Unnamed: 1', 'Task', 'Stimulus', 'Response')	1
('Genus', 'Isolation media', 'TTX-producing isolates', 'Replicates above LOD', 'Replicates above LLOQ', 'TTX (ng mL−1)±\xa0SEM', 'TTX symbiont in other animals')	1
('Construct', 'N', 'IC50', 'IC50 Ratio')	1
('Name', 'Forward', 'Reverse', 'Usage')	1
('Unnamed: 0', 'All isolates', 'Shared sequence isolates', 'p-value†')	1
('MGE*', 'Length (kb)', '% GC', 'Replicons†', 'MOB Family‡', 'Antibiotic resistance Genes§', 'Metal interaction Genes¶')	1
('Unnamed: 0', 'Cryo-EM structure of the StOAD βγ sub-complex (PDB 6IWW)')	1
('Measurement', 'DNA', 'DNA.1', 'DRNA/RNA', 'RNA', 'RNA.1')	1
('Measurement', 'Technology', 'Strengths', 'Weaknesses', 'Single-cell version?')	1
('Strengths and weaknesses of the ever-evolving compendium of scRNA-seq technologies and analysis packages have been evaluated reviewed extensively in Ziegenhain et al., 2017; Chen et al., 2019a; Haque et al., 2017. Here, we provide a basic overview of the strengths of the general approaches.', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3')	1
('Antigen', 'Reactivity', 'Host Species', 'Origin')	1
('Gene', 'Species', 'Company', 'Reference (Sequence)')	1
('Evolutionary Conserved Region (ECR)', 'Forward', 'Reverse')	1
('Unnamed: 0', 'MT1', 'MT2', 'MT2/MT1', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12')	1
('Concentration of complexes [average number of complexes per square micrometer]', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('Locus', 'M1', 'P30')	1
('EAP', 'Movie number', 'Initiation', 'Stabilization', 'Initiation+Stabilization', 'Maturation', 'Biochemical measurements of CME', 'Unnamed: 7')	1
('Protein', 'Mol. weight', 'Putative localization in spirochete filaments', 'Gene names Leptospira biflexa (Uniprot ID)', 'Gene names Leptospira interrogans (Uniprot ID)', 'Protein copies per cell in L. interrogans  (Malmström et al., 2009)', 'Sequence homologies')	1
('Unnamed: 0', 'FcpA_1', 'FcpA_2', 'FcpA_3', 'FcpB')	1
('Leptospira strain', 'Inner Curvature*', 'Outer Curvature†', 'Both‡', 'Total # Images')	1
('Sample name', 'Organism', 'Conclusion')	1
('Unnamed: 0', 'Anterior arch of the atlas*', 'Ribs†', 'Sternum attachment‡', 'Lumbar§', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Unnamed: 0', 'Strain', 'Genotype')	1
('Strain', 'Genotype', 'Description', 'Sequence name', 'Sequence 5′−3′', 'PAM')	1
('WdiE type', 'Total carbon chain length and degree of unsaturation', 'FA composition (%)', 'The most abundant molecular species predicted', 'Unnamed: 4', 'Unnamed: 5')	1
('Name in this study', 'Location', 'IMPC abbreviation')	1
('Unnamed: 0', 'Pure 1-sided', '2- sided', '1-sided + 2-sided mix', 'Semi- diffusive', '1-sided + loading bias', 'Switching', '1-sided with traversal', '1-sided + 3D attraction')	1
('Unnamed: 0', 'Activated mature B cells', 'FrB pro-B cells')	1
('Seed', 'Region of interest', 'F(1,87)', 'p')	1
('strain', 'genotype', 'notes')	1
('Unnamed: 0', 'GSA activity (ProA)', 'NAGSA activity (neo-ArgC)', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Enzyme', 'KM, ATP (mM)', 'kcat (s−1)', 'kcat/KM,ATP (M−1 s−1)', 'UMP Kd (µM)', 'UMP a', 'ornithine Kd (µM)', 'ornithine a')	1
('Figure 2B\xa0- Region 1', 'p value', 'Figure 2B - Region 2', 'p value.1')	1
('Figure 2B', 'Region 1 N', 'Region 2 N')	1
('Figure 5D- Chirality', 'p value', 'Figure 5D - Rotation', 'p value.1')	1
('Figure 5D', 'Chirality - N', 'Rotation - N')	1
('Figure 5—figure supplement 1B - Chirality', 'p value', 'Figure 5—figure supplement 1B - Rotation', 'p value.1')	1
('Figure 5—figure supplement 1B', 'Chirality - N', 'Rotation - N')	1
('Unnamed: 0', 'Dark', 'one ps', '10 ps')	1
('Object', 'Label', '1ps', '1ps.1', '10ps', '10ps.1')	1
('Full name', 'Abbr.', 'Full name.1', 'Abbr..1', 'Full name.2', 'Abbr..2')	1
('Unnamed: 0', 'Sharing incentive', 'Open access', 'Stable false positive rate')	1
('Unnamed: 0', 'QQQ')	1
('Buffer R', 'Buffer F', 'Ion flux monitored', 'Protein-lipid ratio (µg/mg)', 'Protein per assay (µg)')	1
('Ferret', 'Stimulus duration (ms)', 'Repetitions', 'Interstimulus interval (s)', 'Frequency range (Hz)')	1
('Unnamed: 0', 'Number of events')	1
('Unnamed: 0', 'UKB', 'Ukbbn')	1
('Phenotype', 'Sex', 'Coef', 'Ci (2.5%)', 'Ci (97.5%)', 'p-value', 'N', 'Events')	1
('Variant effect', 'Number of variants')	1
('Reagent type (Species or Source)', 'Designation', 'Source', 'Identifier', 'Add. info')	1
('Bacterial plasmids (all constructs are in the pTrcHis6A expression vector and start with the sequence MGGSHHHHHHGMASHHHHHARALEVLFQGPM)', 'Unnamed: 1')	1
('Mutation', 'Forward primer', 'Reverse primer')	1
('Neuron type', 'Initial AIS L (μm)', 'Initial AIS x1/2 (μm)', 'Final AIS L (μm)', 'Final AIS x1/2 (μm)', 'ΔVs (mV)', 'ΔVs theory (mV)', 'Reference')	1
('Reagent type (species) or\xa0resource', 'Designation', 'Source or\xa0reference', 'Identifiers', 'Additional\xa0information')	1
('Unnamed: 0', 'Number of EdU-retaining cells in…', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4')	1
('Gene', 'Forward Primer', 'Reverse Primer')	1
('Age', 'csf1a', 'csf1b', 'il34')	1
('Line', 'Hatched', 'Unhatched', 'Total')	1
('Line', 'Fertile1', 'Sterile', 'Censored2', 'Total')	1
('% of ↓ contained in →', 'Cognitive Atlas (895)', 'MeSH (21287)', 'NeuroNames (7146)', 'NIF (6912)', 'NeuroSynth (1310)', 'NeuroQuery(7547)')	1
('Unnamed: 0', 'False positives', 'False negatives')	1
('Unnamed: 0', 'NeuroSynth', 'NeuroQuery')	1
('Name', 'Url')	1
('Dataset', 'Type', 'Count', 'Citations')	1
('Template Brain', 'Description', 'Resources', 'DOI', 'Citation')	1
('Unnamed: 0', 'BBSome (EMD-21144) (PDB 6VBU)', 'BBSome:ARL6:GTP (EMD-21145) (PDB 6VBV)')	1
('Protein', 'NCBI accession', 'Protein length (residues)', 'Molecular mass (kDa)', 'Total built residues (BBSome)', 'Total built residues (BBSome: ARL6:GTP)')	1
('Gene', 'Protein mutation', 'Phenotype', 'Reference')	1
('Unnamed: 0', 'TRPC6-AM-1473 EMD-20954 PDB 6UZA', 'TRPC6-AM-0883 EMD-20953 PDB\xa06UZ8')	1
('Unnamed: 0', 'No. of neurons', 'No. of 100 s epochs', 'Stimulus presentations in 100 s epochs', 'No. of neuronal ensembles (Q)')	1
('Unnamed: 0', 'H37Rv (4,411,532 bp)', 'MT-0080_PB (4,426,525 bp)', 'P value')	1
('Specimen code', 'HLA-A', 'HLA-B', 'HLA-C', 'Shared antigenic epitopes', '% of multimer-positive CD8+ TILs', 'IFN-γ ELISPOT analysis', 'Number of cloned TCRs', 'Tumor reactivity')	1
('Variable', 'Parameter', 'Wavelength', 'Value', 'Units')	1
('Unnamed: 0', '920 nm', '1320 nm', '1280 nm')	1
('Variable', 'Parameter', 'Value', 'Units')	1
('Unnamed: 0', 'Objective lens focal length (mm)', '1/e2beam diameter at the back aperture (mm)', 'Effective NA', 'Pulse duration τ (fs)', 'gp(n)')	1
('Acronym', 'Meaning')	1
('Unnamed: 0', 'Complex between COMPASS and the H2B-Ub nucleosome (EMDB-21157) (PDB 6VEN)')	1
('Model', 'Region', 'Cluster size', 'X', 'Y', 'Z')	1
('Unnamed: 0', 'Subcellular localization', 'N reactive proteins', 'Baseline reactivity', 'Post-Immz reactivity', 'Baseline reactivity (protected)', 'Post-Immz reactivity (protected)', 'Baseline reactivity (unprotected)', 'Post-Immz reactivity (unprotected)')	1
('Gene name', 'Average log fold change', 'Fraction of Cd34-high, Car4-high cells expressing this gene', 'Fraction of other ECs expressing this gene')	1
('Gene name', 'Average log fold change', 'Fraction of proliferating ECs expressing this gene', 'Fraction of all cells expressing this gene')	1
('Gene name', 'Average log fold change', 'Fraction of Car4-high ECs expressing this gene', 'Fraction of all cells expressing this gene')	1
('Receptor', 'Ligand', 'Evidence', 'Receptor cluster', 'Ligand cluster')	1
('Gene', 'Primer type', 'Forward sequence (5’ to 3’)', 'Reverse sequence (5’ to 3’)')	1
('Genotype', 'Total', 'No scar', 'Interspersed scar', 'Transmural scar')	1
('Parameter', 'Comparison', 'Statistical test', 'Multiple testing correction', 'p value')	1
('Reagent type (species) or resource', 'Designation', 'Source or reference', 'Identifiers (RRID_AB)', 'Additional information (dilution)')	1
('Protein', 'Concentration', 'Species', 'Clone', 'Company', 'RRID_AB:')	1
('Algorithm 1. Algorithm to generate a representative line for the top of stripe X0 (lt)', 'Unnamed: 1')	1
('Algorithm 2. Algorithm to calculate the tortuosity (tort) of line L generated from a simulated X0', 'Unnamed: 1')	1
('Algorithm 3. Algorithm to calculate the tortuosity (tort) of line L generated from a real fish', 'Unnamed: 1')	1
('Ambulatory skills', 'Score')	1
('Data Collection', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4')	1
('Symptom Category', 'Test/observation', 'Result')	1
('Gene symbol', 'Annotation symbol', 'RNAi line', 'Migration defect (c306-Gal4)', 'Expression level in ovary (modENCODE)')	1
('Figure', 'Panel', 'Genotype')	1
('Term', 'Estimated coefficient', 'SE', 't-statistic', 'p-value')	1
('Unnamed: 0', 'PCa/PNa', 'Sr/PNa', 'PK/PNa', 'PCs/PNa')	1
('Systematics', 'Unnamed: 1', 'Unnamed: 2')	1
('Reagent (species)', 'Designation', 'Source', 'Additional info')	1
('Region', 'Number of introductions or translocations')	1
('Collection', 'Number of specimens')	1
('Target', 'Forward', 'Reverse', 'Size bp')	1
('Genotype', 'Normal germline, %', 'Tum, %', 'Pro, %', 'N')	1
('Genotype', 'PLA density in SPC zone (/um^2) x 10−2', 'P value,vs. control', 'N')	1
('Genotype', 'PLA density in SPC zone (/um^2) x 10−1', 'p value,vs. control', 'N')	1
('Transgene', 'Mutated variable region (VR) sequence', 'Rescues fbf-1(lf)?', 'Rescues fbf-2(lf)?', 'Dependent on CCR4-NOT')	1
('Metric', 'Term', 'Df', 'Sum sq.', 'Mean sq.', 'F stat.', 'P')	1
('Metric', 'Group', 'Term', 'Df', 'Sum Sq.', 'Mean Sq.', 'F stat.', 'R2', 'P')	1
('Plasmid Name', 'Fungal Bioluminescent Pathway Components', 'Plasmid Type')	1
('Component', 'Source', 'Unnamed: 2', 'Cost')	1
('Fluorescence quenching', 'Construct', 'Term', 'Estimate', 'Standard error')	1
('Current inhibition', 'Construct', 'Term', 'Estimate', 'Standard error')	1
('Full MWC', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4')	1
('Lever', 'End lever-press training', 'Conditioned punishment')	1
('Names', 'Mol. weight (kDa)', 'p-values (WT vs FAP52)', 'Exclusive unique peptide counts in WT (quantitative values after normalization)')	1
('Name', 'Molecular Weight in kDa (MW)', 'Average quantitative Value (AQV)', 'Rough Stoichiometric Peptide Abundance (RSPA)*', 'T.\xa0thermophila Homologs**', 'Human homologs***', 'Localization in C. reinhardtii')	1
('Description', 'Type', 'Symbol', 'Figure 2', 'Figure 2—figure supplement 2', 'Figure 2—figure supplement 1', 'Figure 3, 4')	1
('Description', 'Type', 'Symbol', 'Figure 5', 'Figures 6–8')	1
('Coenocytic organism', 'Length scale', 'Wave time', 'Wave speed', 'Nuclear division', 'Synchrony index', 'References')	1
('Plasmid creation', 'Target amplicon (Source DNA)', 'Primer name', 'Primer sequence (5’→ 3’)')	1
('Request ID', 'Strain name', 'Plasmid', 'Integrated gene(s)')	1
('Protein', 'Amino acid sequence')	1
('FIGURE', 'PANEL', 'ABBREVIATED GENOTYPE', 'COMPLETE GENOTYPE (‘Y’ represents the Y chromosome)')	1
('Figure', 'Panel', 'Abbreviated genotype', 'COMPLETE GENOTYPE (‘Y’ represents the Y chromosome)')	1
('System', 'total #', 'multicellular #', 'P')	1
('(A) Downregulated protein class', 'Unnamed: 1')	1
('PANTHER pathway', 'PANTHER accession', 'Gene list')	1
('Reagent type (species) or resource', 'Unnamed: 1', 'Source or reference', 'Identifiers', 'Additional information')	1
('Unnamed: 0', 'Discovery', 'Validation', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('VPM amplitude', 'EXC', 'PV', 'SST', 'VIP')	1
('VPM slope', 'EXC', 'PV', 'SST', 'VIP')	1
('POm amplitude', 'EXC', 'PV', 'SST', 'VIP')	1
('POm slope', 'EXC', 'PV', 'SST', 'VIP')	1
('Unnamed: 0', 'PL Innervation vs.', 'IL Innervation vs.', 'Unnamed: 3', 'Unnamed: 4')	1
('Unnamed: 0', 'Unnamed: 1', 'rsFC BLA-PL vs.Time in Open', 'rsFC BLA-IL vs.Time in Open', 'Unnamed: 4', 'Unnamed: 5')	1
('PD28 rsFC BLA-PL', 'PD28 rsFC BLA-IL', 'Unnamed: 2', 'Unnamed: 3')	1
('FJC fits', 'Contour length (nm/nt)', 'Persistence length (nm)', 'Elastic modulus (pN)')	1
('Metric', 'Article-level variable', 'Coef.', 'Std. error', '95% CI (lower)', '95% CI (upper)', 'p-value', 'Adj. p-value')	1
('Metric', 'Journal-level variable', 'Coef.', 'Std. error', '95% CI (lower)', '95% CI (upper)', 't-statistic', 'p-value', 'Adj. p-value')	1
('Figure 5D: animal number of each group and each time point', 'Unnamed: 1', 'Figure 6A: animal number of each group and each time point (Please note that these cohorts were different from Figure 5D)', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Figure 7A: animal number of each group and each time point', 'Unnamed: 1', 'Figure 7C: animal number of each group and each time point', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12')	1
('Figure 7—figure supplement 1B: Animal number of each group and each time point', 'Unnamed: 1', 'Figure 7—figure supplement 1D: Animal number of each group and each time point', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Virus', 'T-number', 'Diameter\xa0(nm)', 'Thickness h (nm)', 'E (Gpa)', 'Y\xa0(N/m)', 'σ\xa0(nm)', 'Scaled line tension λ', 'Föppl-von Karman γ')	1
('Muropeptide (non-reduced)', 'Theoretical neutral mass', 'MurNAc-alk labeled H. pylori', 'Control H. pylori', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('Strain', 'Genotype/description', 'Construction', 'Reference')	1
('Primer name', 'Sequence (5’ to 3’)')	1
('Antibody', 'Company and clone', 'Dilution')	1
('Antibody', 'Supplier (Clone)', 'Dilution')	1
('Cell\xa0type', 'Delay-active', 'Delay-suppressed', 'Other', 'Total')	1
('Test conditions', 'Delay responsiveness', 'Neuron number')	1
('Delay responsibility', 'Side-dependency', 'Cell types', 'N', '%')	1
('Test conditions', 'Delay responsiveness', 'Neurons', 'Unnamed: 3')	1
('Genotype', 'Animal ID', 'Age at surgery', 'Age at experiments ended')	1
('Reference', '% excluded participants (‘non-learners’)', 'CS+/CS– cut-off (in µS) for ‘non-learners’', 'N trialsacq total CS+/CS–', 'N trialsacq considered CS+/CS–', 'Trials phase (unless otherwise stated, this refers to fear acquisition training)', 'Additional criteria/notes')	1
('Record', '% excluded participants (‘non-responders’)', 'Cut-off (in µS) for a valid SCR', 'Valid responses in at least % of trials', 'Stimulus type (also referred to as ‘trial’) on which the exclusion is based', 'Additional criteria/notes')	1
('A) t-tests: CS+/CS– discrimination based on raw values', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Exclusion group (cumulative)', 'CS+ M (SD)', 'CS– M (SD)', 'df', 't', 'pbonf_corr', 'd')	1
('Reference', 'N', 'Minimum amplitude cutoff (in µS) for valid SCRs', 'Scoring details', 'Number of…', '‘Non-responses’ towards…', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12', 'Unnamed: 13')	1
('Reference', 'a) n (%) of individuals with 0, 1, 2, 3, 4, 5, 6, 7, and 8 SCRs towards the US. b) M (%)\xa0of valid CS responses for these individuals.', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9')	1
('Engagement type', 'General description')	1
('Unnamed: 0', 'WPM', 'W')	1
('Unnamed: 0', 'WPM\xa0(%)', 'W (%)')	1
('Event type', 'WPM', 'W', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Pageviews/event', 'WPM', 'W', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Unnamed: 0', 'WPM pages', 'W pages', 'WPM pages, compared to other W pages,...')	1
('Character', 'Hexapoda (Dicondylia)', 'Eumalacostraca and Remipedia', 'Correspondence')	1
('Unnamed: 0', 'Patient 013', 'Patient 020')	1
('Unnamed: 0', 'Unstimulated PBMCs', 'Stimulated PBMCs')	1
('Clonal family (antibodies)', 'Germline', 'Isotype', 'Reads for all clonotypes', 'Unnamed: 4')	1
('Block (Direction)', 'Target', 'Cursor', 'Perturbation', '# of trials')	1
('Target', 'Cursor', 'Perturbation', '# of trials')	1
('Session', 'Block (randomized in each session)')	1
('MP/Target jump', '# of trials (randomized in each block)')	1
('Panel', 'Graph type', 'N value', 'Statistical test used', 'Precision', 'p-value')	1
('Name', 'Median, sec', 'Mean, sec', 'S.D., sec*', '95%ile, sec', 'N tracks', 'N samples')	1
('Name', 'Lifetime Median, sec', 'Lifetime Mean, sec', 'Lifetime S.D., sec*', 'Lifetime 95%ile, sec', 'End-to-end distance Median, nm', 'n tracks', 'N movies (datasets with\xa0>\xa040 tracks)', 'N samples', 'D, nm2/sec †')	1
('Name', 'Median, sec', 'Mean, sec', 'S.D., sec *', '95%ile, sec', 'N tracks', 'N movies (datasets with\xa0>\xa040 tracks)', 'N samples', 'D, nm2/sec †')	1
('Data collection', '5A6-CD81 LEL')	1
('Cell line', 'Background', 'Response to PD-1 blockade therapy', 'Particulars', 'Source')	1
('Background', 'Name of tumor', 'Releasing suppressive factor (related to Figure 3)', 'Activation of acquired immunity (related to Figure 5)')	1
('Variable', 'Definition', 'Source')	1
('Session', 'Sample Type', 'Rough Milling', 'Rough Milling Success', 'Polishing', 'Polishing Success', 'Instrument #')	1
('Strain', 'Identifier', 'Genotype', 'Source or reference')	1
('Milling\xa0Pattern\xa0#', 'Pattern\xa0Attributes')	1
('35S::RFP-DA1', '35S::DA2-FLAG', 'p35S::GFP-UBP12', 'pUBQ10::HA-BB', 'Cleaving inhibition')	1
('35S::HA-DA1', '35S::DA2-FLAG', 'pUBP10::UBP12-BFP', 'pUBP10::NLS-GFP-TCP14-mCherry', 'Cleaving inhibition, FRET')	1
('Feature', 'Slope', 'P (slope)', 'Marginal R2', 'Conditional R2', 'Slope (min)', 'Slope (max)', 'P (vs linear)')	1
('Replication (SGR)', 'IC50 (μM)', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4')	1
('Unnamed: 0', 'Unnamed: 1', 'Rab5', 'SNX1', 'Lyso')	1
('Reagent type or resource', 'Designation', 'Source', 'Identifiers', 'Additional information')	1
('Rab5 data', 'Survival function Ψ(t)', 'Fit parameters for Figure 4')	1
('Receptor', 'Ligand', 'Bound na+', 'Number of OPLS3e trajectories', 'Number of CHARMM36 trajectories', 'Accumulated simulation time (ns)')	1
('Unnamed: 0', '[3H]spiperone saturation binding', '[3H]spiperone competition binding', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Unnamed: 0', 'Spiperone-d2 saturation binding', 'Spiperone-d2\xa0competition binding', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12')	1
('Cluster ID', 'Percentage (%)', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Unnamed: 0', 'RNAP-Ocr', 'Unnamed: 2')	1
('Unnamed: 0', 'Unnamed: 1', 'Mismatch', 'Unnamed: 3', 'Unnamed: 4', 'Match', 'Unnamed: 6')	1
('Unnamed: 0', 'Unnamed: 1', 'Unnamed: 2', 'Pre fixation', 'Unnamed: 4', 'Unnamed: 5', 'Post fixation', 'Unnamed: 7')	1
('Unnamed: 0', 'N', 'Retrieval', 'Associative novelty', 'Subsequent memory')	1
('Unnamed: 0', 'N', 'Power', 'Sin(θ)', 'Cos(θ)', 'Speak', 'STrough', 'Asym', 'Full')	1
('Unnamed: 0', 'N', 'Power', 'Sin(θ)', 'Cos(θ)', 'SPeak', 'STrough', 'Asym', 'Full')	1
('Unnamed: 0', 'S1', 'S2', 'S3', 'S4', 'S5')	1
('Reagent type (species) or resource', 'Designation', 'Source or reference', 'Identifier(s)', 'Additional information')	1
('Species', 'Occurrence records', 'AUC ensemble models')	1
('Unnamed: 0', 'Emotional (Median (IQR))', 'Neutral (Median (IQR))', 'Z', 'p-value')	1
('Unnamed: 0', 'Unnamed: 1', '(+,+)', '(+,0)', '(0,+)', '(0,0)')	1
('Unnamed: 0', '(+,+)', '(+,0)', '(0,+)', '(0,0)')	1
('Unnamed: 0', 'Revenge (mean\xa0±\xa0SD)', 'Control (mean\xa0±\xa0SD)', 'F', 'p', 'η2p')	1
('Relative and absolute quantification of PBP1b', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Active/Passive Membrane Properties', 'VGluT3+ BCs (mean\xa0±\xa0SEM, n\xa0=\xa030–37 observations/parameter, from 37 cells)', 'VGluT3+ DTIs (mean\xa0±\xa0SEM, n\xa0=\xa024–26 observations/parameter, from 26 cells)')	1
('Figure', 'Question', 'Finding')	1
('Unnamed: 0', 'Unnamed: 1', 'MMSE', 'Tremor', 'Rest tremor', 'Postural tremor of hands', 'Finger tapping', 'Hand movement', 'RAM', 'Unnamed: 9', 'Total', 'Unnamed: 11', 'Unnamed: 12', 'Unnamed: 13', 'Nr. of units: contralateral +', 'Unnamed: 15', 'Unnamed: 16', 'Unnamed: 17', 'Unnamed: 18')	1
('Protein', 'Inhibitor', 'KM (µM)', 'vmax*', 'Ki (µM)', 'α')	1
('Unnamed: 0', 'EcoDMT-Br-BIT complex')	1
('EcoDMT-Br-BIT complexes', '1', '2', '3', '4', '5')	1
('Unnamed: 0', 'TEBIT', 'TMBIT', 'Br-BIT', 'Br-DBFIT')	1
('Compound', 'Smile', 'IC50 (hDMT1) (µM)', 'IC50 (hDMT1-S476V) (µM)', 'IC50 (hDMT1-N520L) (µM)', 'IC50 (hDMT1-F523A) (µM)')	1
('Compound', 'Retention time', 'Purity [%]', 'HPLC method*')	1
('Group', 'Recording area', 'Single units', 'Multi units', 'Awake total mice', 'Awake total units', 'Anesthetized total mice', 'Anesthetized total units', 'Total units')	1
('Reagent type (species) or resource', 'Designation', 'Source or reference', 'Identifiers', 'Additional i nformation')	1
('Drug', 'Predicted target pathway', 'Developed for', 'Concentration (µM)')	1
('Unnamed: 0', 'Target gene', 'Life stage expression (FPKM)', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11')	1
('Unnamed: 0', 'Red', 'Green', 'IR', 'dL5**-MG2I (minor)', 'dL5**-MG2I (major)')	1
('Unnamed: 0', 'Red x dL5**-MG2I', 'Green x dL5**-MG2I')	1
('Service', 'Database size (millions)', 'Individuals shown', 'IBS/IBD Segments Reported')	1
('Strategy', 'Prevents IBS tiling', 'Prevents IBS probing', 'Prevents IBS baiting')	1
('Matching pairs', 'Unnamed: 1', 'Target 1', 'Target 2', 'Target 3', 'Target 4')	1
('Spatial muscle group', 'Nerve', 'Motor neurons (synonyms)', 'Target muscles (synonyms)', 'Synapse Type')	1
('Forward', 'Co-activated muscles')	1
('Muscle position', 'Motor Neurons', 'Pre-Motor Neurons')	1
('Factor', 'Meaning', 'Values')	1
('#', 'Name', 'Description', 'Value', 'Reference')	1
('DIV', 'No.\u2009of', 'Regular ladder', 'Ladder in patches', 'No visible ladder', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('Unnamed: 0', 'Model', 'Strain-softening of steady state moduli', 'Solid-like steady state', 'Peak in relaxation time vs strain')	1
('Unnamed: 0', 'Humpback whale', 'Humpback juvenile', 'Minke whale', 'Bryde’s whale', 'Gray whale', 'Sperm whale', 'Right whale')	1
('Trajectory', 'Starting location', 'Characteristics', 'Species', '# events')	1
('Length (m)', 'Mass (kg)', 'Emergence (%)', 'Duration (secs)', 'Final velocity (m/s)', 'Stroke freq (Hz)', 'Energy (MJ)', 'Max power (kW)', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12')	1
('Antibody', 'Fluorochrome', 'Catalogue #', 'Clone', 'Dilution', 'Supplier')	1
('Antibody', 'Catalogue#', 'Supplier')	1
('Unnamed: 0', 'Patient', 'Sex', 'Age (years)', 'MS type', 'Disease duration (years)', 'Time to post mortem (h)', 'Number of lesions', 'Active', 'Chronic active', 'Chronic inactive', 'Remyeli-nating')	1
('Unnamed: 0', 'v0.9', 'v1.2 pseudomolecules and contigs', 'v1.2 pseudomolecules only')	1
('Plant trait', 'K statistics', 'p-value (10,000 simulations)')	1
('Unnamed: 0', 'Nd-pgls', 'Nd-sim', 'Es-pgls', 'Es-sim')	1
('Name', 'Efficiency of cleavage', 'SaCas9 sgRNA + PAM (g was added as needed)', 'Target sequences (GenBank: KT899744)')	1
('DNA sequences used in the EMSA assays', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3')	1
('Theoretical Rg (Å)', 'Unnamed: 1')	1
('Type', 'Upregulated in axons', 'Downregulated in axons', 'Enriched in axons, not regulated')	1
('Unnamed: 0', 'Checkerboard', 'Side-by-Side', 'Isolated', 'Both', 'Tomograms', 'Tetramers', 'Rats')	1
('Unnamed: 0', 'Median Cluster Area (nm2 x 103)', 'Mean Cluster Area (nm2 x 103)', 'Number of Clusters Examined')	1
('Unnamed: 0', 'Tomograms', 'dSTORM Images', 'Unnamed: 3', 'Unnamed: 4')	1
('Unnamed: 0', 'Checkerboard', 'Unnamed: 2', 'Side-by-Side', 'Unnamed: 4', 'Unnamed: 5')	1
('Strain', 'Phage', 'Plasmid', '% Lysogens')	1
('Unnamed: 0', 'Suicide attempters (n\xa0=\xa034)', 'Non-attempters (n\xa0=\xa068)', 'p')	1
('Location', 'MNI Coordinates', 'Peak t', 'Volume (mm3)', 'Unnamed: 4', 'Unnamed: 5')	1
('Unnamed: 0', 'Attempter (n\xa0=\xa034)', 'Non-attempter (n\xa0=\xa068)', 'Unnamed: 3', 'Unnamed: 4')	1
('Quantity', 'Meaning', 'Definition')	1
('Parameter', 'Value', 'Source')	1
('Bead sequence number', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3')	1
('Organelle', 'Fly protein', 'clones obtained', 'population imaged', 'clones imaged', 'insertion sequence verified', 'Immunostained', 'Correct GFP localization', 'DGRC stock#', 'S2R+ expression (modENCODE RPKM)')	1
('Unnamed: 0', 'Individuals', 'Measurements', 'Included IPTs')	1
('Unnamed: 0', 'Component elements', 'Measurement', 'Statistical methods')	1
('Unnamed: 0', 'Baseline measurements in all individuals', 'Baseline measurements in individuals with corresponding BAs', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('BAs', 'Number of individuals', 'Number of deaths', 'Median follow-up time (year)', 'Model 1', 'Model 2')	1
('BA residuals', 'Model 1', 'Model 2')	1
('Motif name/TF', 'Representative CNN filter logo', 'Motif logo', 'CNNs with filter match q\xa0<\xa00.05', 'Similar TF motifs discovered')	1
('Sample', 'Unnamed: 1', 'In UDM', 'In C8E4', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11')	1
('W1118', '24 hr 5.0°', '28 hr 28.4°')	1
('Genotype', 'Time', 'Grand Mean Vector (GM)', 'Length of Grand Mean Vector (r)', 'Number of means (wings)', 'Mean CSD')	1
('32 hr angles', 'W1118 54.6°', 'pksple1 59.3°', 'pkpk-sple13 47.6°', 'pkpk30 348.5°')	1
('PUFA Analogue', 'IKs I/I0 (7 μM) (mean\xa0±\xa0SEM)', 'Km IKs (μM) (mean\xa0±\xa0SEM)', 'Adj R2 of Hill Fit', 'ICa I/I0 (7 μM) (mean\xa0±\xa0SEM)', 'Km ICa (μM) (mean\xa0±\xa0SEM)', 'Adj R2 of Hill Fit.1', 'INa I/I0 (7 μM) (mean\xa0±\xa0SEM)', 'Km INa (μM) (mean\xa0±\xa0SEM)', 'Adj R2 of Hill Fit.2')	1
('PUFA Analogue', 'Control', '0.2 mM', '0.7 mM', '2 mM', '7 mM', '20 mM')	1
('Unnamed: 0', 'Social', 'Non-social', 'Unnamed: 3')	1
('Unnamed: 0', 'Unnamed: 1', 'Group 1 PLA Day 1', 'Group 2 MPH Day 1', 'Unnamed: 4')	1
('LyNa-VAs', 'Chemical name', 'Structure', 'EC50 (μM)*', 'ITPC2\xa0(pA)**')	1
('Genotype', 'Silenced (S)', 'Expressed (E)', 'S → E (kon, gen−1)', 'E → S (koff, gen−1)', 'E/S', 'kon/koff')	1
('Unnamed: 0', 'HypD with glycerol bound', 'HypD with Hyp bound')	1
('HypD', 'Radical per monomer (%)', 'Activity detected by quantification of proline', 'Km (mM)', 'Un-normalized kcat (s−1)', 'Glycyl radical- normalized kcat (s−1)', 'Catalytic efficiency using normalized kcat (M−1 s−1)')	1
('Primer', 'Sequence (5′ to 3′)', 'Annealing temperature\xa0used, °C')	1
('Symbol', 'Definition')	1
('Species', 'Subfamily', 'Family', 'Length (cm)', 'Max width (cm)', 'Mass (g)')	1
('Individual', 'Length (cm)', 'Max width (cm)', 'Mass (g)')	1
('Z (mm)', 'a0', 'a1', 'b1', 'a2', 'b2', 'W')	1
('Unnamed: 0', 'hsSlo1 + β4 Open', 'hsSlo1 + β4 Closed', 'hsSlo1 Open', 'hsSlo1 Closed')	1
('ShortName', 'β4 sequence', 'β1 sequence', 'Unnamed: 3', 'ShortName.1', 'β4 sequence.1', 'β1 sequence.1')	1
('strain', 'CRO\xa0MIC (μg/mL)', 'penA (PBP2)', 'ponA (PBP1)', 'PorB 120/121', 'RpoB', 'RpoD')	1
('Strain', 'MIC (μg/ml)', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Protein name', 'Gene', 'Reference', 'TMD', 'Cluster')	1
('Protein name', 'Gene name', 'OMIM#', 'Gene locus', 'Neuropathy')	1
('Unnamed: 0', 'Rin (MΩ)', 'Cm (pF)', 'gGABAAR (pS)', 'gGABAAR/Cm (MΩ/pS)', 'N', 'N.1')	1
('Alcohol Devaluation', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('Figure 4a, b', 'Drinking paradigm IA20%−2BC 24h-withdrawal', 'Rat number', 'Last four drinking session (g/kg /24 )')	1
('Unnamed: 0', 'II.1', 'II.2', 'II.4', 'II.5')	1
('Unnamed: 0', 'Tobacco consumption', 'Tobacco consumption - heavy smokers (≥20 cigs/day)', 'Tobacco consumption - light smokers (<20 cigs/day)', 'Smoking cessation', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12', 'Unnamed: 13', 'Unnamed: 14', 'Unnamed: 15', 'Unnamed: 16', 'Unnamed: 17')	1
('Unnamed: 0', 'Unnamed: 1', 'Unnamed: 2', 'DSM-IV ND diagnosis', 'DSM-IV ND symptoms', 'FTND (≥4)', 'FTND score', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12', 'Unnamed: 13', 'Unnamed: 14', 'Unnamed: 15')	1
('Unnamed: 0', 'Hoolock', 'Hylobates', 'Symphalangus', 'Pongo', 'Gorilla', 'Pan', 'Homo')	1
('Unnamed: 0', 'R2', 'p', 'slope', 'SE', '95% CI', 'intercept', 'SE.1', '95% CI.1', 'Unnamed: 9', 'Unnamed: 10')	1
('Hominidae', 'Hylobatidae', 'Cercopithecoidae', 'Platyrrhini')	1
('Character #', 'Character definition', 'Character statesa', 'Synapomorphic for')	1
('Family', 'Species', 'n', 'M', 'F', '?')	1
('Unnamed: 0', 'Delta rule', 'Bayes learner rule', 'Unnamed: 3', 'Unnamed: 4')	1
('% explorations', 'β', 'ϕ', 'ρ')	1
('Unnamed: 0', 'Μφ', 'Λφ', 'Unnamed: 3', 'Unnamed: 4')	1
('Unnamed: 0', 'LooLM - LooQM', 'ß2 estimate', 'ß2p-value', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Unnamed: 0', 'R²', 'ß1 estimate', 'ß1p-value', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('region of', 'peak voxel (mm)', 'reference for', 'Unnamed: 3', 'Unnamed: 4')	1
('Growth condition', 'Abbrv.', 'Nitrogen source', 'Carbon source')	1
('Category', 'ID', 'Description', 'Interpretation', '# Samples', 'Fraction of samples', 'Sample identities')	1
('locus/complex', 'gene id', 'gene name', 'function prediction', 'involved in resistance (R)/treatment failure (TF) to drug:', 'reference', 'evidence from reference', 'gene copy number (gene CN)', 'Unnamed: 8', 'Unnamed: 9')	1
('Gene name', 'Gene codes v41 (v38) TritrypDB (http://tritrypdb.org/tritrypdb/)', 'Annotation', 'Fixed genomic variation between L. infantum and L. donovani (changes L.inf\xa0>\xa0.don)', 'Evidence for pathogenic function')	1
('Type', 'Soma', 'Adend trunk', 'Adend1', 'Adend2', 'Adend tuft', 'Adend oblique', 'Bdend1', 'Bdend2', 'Bdend3')	1
('Cell type (rows) Channel/mechanism Type (columns)', 'Na (fast)', 'K (fast)', 'Km', 'KCa', 'Ca (L-type)', 'Ca (T-type)', 'Ca decay', 'HCN', 'Leak', 'Dipole')	1
('(From ↓, To →)', 'L2/3 PN', 'L2/3 Basket', 'L5 pn', 'L5 basket')	1
('Sequence', 'F/R', 'Description')	1
('Main experiment, using alpha stimulation', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Descriptive statistics', 'HR (95% CI) for onset of dementia per one z-score* higher', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5')	1
('Dementia cases Number (%)', 'HR (95% CI) for onset of dementia per one z-score* higher')	1
('Descriptive statistics', 'HR (95% CI) for onset of dementia per one z-score* higher', 'Unnamed: 2', 'Unnamed: 3')	1
('Substrate', 'Chain modifying E2 or E3', 'E3', 'KM (10−9 M)', 'kcat (min−1)', 'R2')	1
('Unnamed: 0', '293T-FiTx', '293T/17', 'HeLa', 'MRC5')	1
('Unnamed: 0', 'Substrate prior to ubiquitin transfer*', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5')	1
('Unnamed: 0', 'SeMet SidJ–CaM', 'Native SidJ–CaM (PDB ID: 6PLM)')	1
('Construct', 'Source', 'Ionic Strength', 'kcat (sec−1)', 'K0.5,MT (nM)')	1
('Unnamed: 0', 'Dm Klp61F motor-AMPPNP (15 protofilaments)', 'Dm Klp61F- motor AMPPNP (14 protofilaments)', 'Dm KLP61F motor-tail- nucleotide free (15 protofilaments)', 'Dm Klp61F5 motor-tail-nucleotide free (14-protofilaments)')	1
('Unnamed: 0', 'Dm-Klp61F motor AMPPNP-MT', 'Dm-Klp61F motor -Nucleotide free-MT')	1
('FL-Eg5-GFP', 'Motility (nm/s)', 'Motor Fluorescence (Au)', 'Run length (μm)')	1
('Single motor velocities in relation to free MT sliding motility', 'Unnamed: 1', 'Unnamed: 2')	1
('Reagent type (species) or resource', 'Designation', 'Source or reference', 'Identifier', 'Additional Information')	1
('1', 'Reagent type (species) or resource', 'Designation', 'Source or reference', 'Identifiers', 'Additional information')	1
('φ1', 'φ2', 'φ3', 'φ4', 'φ5', 'φ6', 'φrec')	1
('Unnamed: 0', 'Manual', 'Fiji/auto local threshold', 'TrackMate spot detection', 'RACE', 'Ilastik Pixel Classif- ication (1.17)', 'Fiji WEKA', 'Cyto- Census V0.1')	1
('Unnamed: 0', 'Ilastik pixel classification (1.17) (raw)', 'Ilastik pixel classification (1.17) (post-processed)', 'CytoCensus V0.1')	1
('Unnamed: 0', 'Ormdl1–/– Ormdl2+/+ Ormdl3+/–', 'Ormdl1–/– Ormdl2+/+ Ormdl3+/+', 'Ormdl1–/– Ormdl2+/+ Ormdl3–/–', 'Ormdl1–/– Ormdl2+/– Ormdl3+/–', 'Ormdl1–/– Ormdl2+/– Ormdl3+/+', 'Ormdl1–/– Ormdl2+/– Ormdl3–/–', 'Ormdl1–/– Ormdl2–/– Ormdl3+/+', 'Ormdl1–/– Ormdl2–/– Ormdl3+/–', 'Ormdl1–/– Ormdl2–/– Ormdl3–/–')	1
('Reagents type (species) or resource', 'Designation', 'Sourceor reference', 'Identifiers', 'Additional information')	1
('Reagent type (species)', 'Designation', 'Source or reference', 'Identifiers', 'Additional Information')	1
('Simulation volume', 'Unnamed: 1', 'Unnamed: 2')	1
('Models presented in main figures', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3')	1
('Parameter', 'Explanation and reference', 'Value')	1
('Unnamed: 0', 'Unnamed: 1', '6 months', 'Unnamed: 3', '12 months', 'Unnamed: 5', 'Unnamed: 6')	1
('Incidence Group', 'Case numbers: Previous estimates', 'Case numbers: Our no vaccination scenario Mean estimates (and 95% Cis)', 'Case numbers: Our vaccination scenario Mean estimates (and 95% Cis)')	1
('Name', 'Region', 'Year of collection', '−31.9', '−6.36', '−3.74', '−0.15', 'K13°', '3.4', '8.6', '15.1', '72.3')	1
('Perturbation size', '1', '2', '3', 'Size (1-3)')	1
('Perturbation of size', '1', '2')	1
('Target protein', 'Z-ratio (30’ v 0’)', 'Target protein.1', 'Z-ratio (60’ v 0’)')	1
('Unnamed: 0', 'Full data sets', 'Partial data sets', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11')	1
('Distance', 'Spindle parameter', 'Meiosis I', 'Meiosis II', 'Unnamed: 4', 'Unnamed: 5')	1
('kinetic\xa0parameter', 'value', 'reference')	1
('Unnamed: 0', 'k-2 [s-1]', 'KM [μM]', 'k1 [μM-1s-1]')	1
('Unnamed: 0', 'Unnamed: 1', 'Min.', 'Max.', 'Mean', 'Std.', 'IQR', 'Range', 'Diff.', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12', 'Unnamed: 13', 'Unnamed: 14')	1
('Tests of normality', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Unnamed: 0', 'Unnamed: 1', 'Unnamed: 2', 'Chi-Sq.(χ2)', 'Asy. sig. p value')	1
('λ', 'No. different comb', 'Comb. with highest freq.', 'Freq. of comb.', 'Relative freq. (%)')	1
('Unnamed: 0', 'Results of 10-fold cross validation over 30 runs', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('Proposed ensemble subspace kNN (EkNN) model (No. of learners (NL): 30;\xa0Subspace Dimension\xa0(SD): 16)', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Unnamed: 0', 'Ad hoc test', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Unnamed: 0', 'Best prediction model results', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5')	1
('Patient group', 'Gleason score', 'Number of patients', 'Age range (years)', 'PSA range (ng/ml)')	1
('Patient group', 'Count', '%')	1
('Antibody', 'Fluorochrome', 'Clone no.', 'Supplier')	1
('Unnamed: 0', 'Akin et al., 2014', 'Present study')	1
('Designation', 'Genotype (as reported in FlyBase when available)', 'Description')	1
('Unnamed: 0', 'Dilution', 'Fixation', 'Source')	1
('miRNA', 'Proposed roles in sMNs', 'Targets/interaction', 'Organism/cell models', 'Methods of genetic analyses', 'References')	1
('miRNA', 'Role in MN disease', 'Targets', 'Organism/cell models and expression profiles', 'Findings and proposed mechanism of SMA pathogenesis', 'References')	1
('SMN-associated RBPs', 'RBP interaction assay', 'General functions in posttranscriptional regulation of mRNA', 'Proposed roles in miRNA metabolism/processing', 'Neuronal modeling mechanism', 'References')	1
('Sex', 'Genotype (N)', 'Mean (SEM)', 'Statistics')	1
('Figure', 'Groups (n;N)*: Mean (sem)', 'Test$', 'Results', 'p-value')	1
('Genotype', 'RMP (mV)', 'Rin (MΩ)', 'Rheobase (pA)', 'Capacitance (pF)', 'Kir2 current density (pA/pF)')	1
('Unnamed: 0', '100% EPC', '25%LBA/EPC SUV', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5')	1
('Unnamed: 0', 'Cognitively normal (CN)', 'Mild cognitive impairment (MCI)', 'Alzheimer’s disease (AD)', 'Unnamed: 4')	1
('Unnamed: 0', 'Cognitively normal (CN)', 'Mild cognitive impairment (MCI)', 'Alzheimer’s disease (AD)', 'CN β− vs CN β+', 'CN β− vs MCI', 'CN β− vs AD', 'CN β+ vs MCI', 'CN β+ vs AD', 'MCI vs AD', 'Unnamed: 10')	1
('Unnamed: 0', 'Fractional anisotropy', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11')	1
('Unnamed: 0', 'MMSE Rho (p value)', 'Delayed recall Rho (p value)', 'Trail making test Rho (p value)', 'Clock-drawing test Rho (p value)')	1
('Residues', 'M/z', 'Z', 'Sequence')	1
('Unnamed: 0', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', '95% Confidence interval', 'Unnamed: 6', 'Unnamed: 7')	1
('Antibody', 'Dilution', 'Supplier', 'Catalog #', 'Validation')	1
('ABCA5', '(WHRN)', '(NSG2)', 'PLSCR5', 'TMSB4X')	1
('Unnamed: 0', 'Desensitization', 'Activation', 'Dose response', 'Unnamed: 4')	1
('Unnamed: 0', 'Activation τ (ms)', 'Desensitization τ (s)')	1
('Unnamed: 0', 'Desensitization', 'Activation', 'Cysteamine response', 'Unnamed: 4')	1
('Protein', 'S. pombe', 'S. cerevisiae', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('GFP-tagged protein pair', 'The ratio of peak fluorescence intensities')	1
('A.\xa0Peak molecules per patch vs total molecules per cell in budding yeast', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3')	1
('Unnamed: 0', 'SP vs TP', 'Subcutaneous\xa0(s.c.) TP vs orthotopic\xa0(ortho.)TP', 'References', 'Unnamed: 4')	1
('Peptide Name', 'Sequence', 'AlphaScreen VP1 IC50 (nM)', 'SPR VP1 KD (nM)', 'Relative IC50 (vs D1min)', 'Relative KD (vs D1min)')	1
('Name', 'Forward primer (5′-to-3′)', 'Reverse primer (5′-to-3′)')	1
('Gene', 'PrimeTime Primer')	1
('Unnamed: 0', 'Unnamed: 1', 'Parabigeminal nucleus', 'Shared', 'Pulvinar', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12', 'Unnamed: 13', 'Unnamed: 14', 'Unnamed: 15')	1
('Reagent (type) or Resource', 'Designation', 'Source or reference', 'Identifiers', 'Additional information')	1
('Rank', 'Name', 'P-value', 'q-value (Benjamini)', '# Target Sequences with Motif', '% of Targets Sequences with Motif', '# Background Sequences with Motif', '% of Background Sequences with Motif', 'Motif')	1
('Data collection statistics', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4')	1
('Unnamed: 0', 'Prior mean', 'Prior variance')	1
('Name', 'Inbred/ outbred*', 'Coat color', 'Origine', 'Use and characteristics')	1
('Name', 'Sequence (5’ → 3’)', 'Target', 'Purpose')	1
('Organ', 'pLB1+ neurons', 'N events/total flies')	1
('(A) Organ', 'pLB1+/Tdc2+ neurons', 'pLB1+/Tdc2- neurons', 'N events/total flies')	1
('Antibody', 'Source', 'Dilution')	1
('Mann-Whitney test', 'Significant', 'Summary', 'Adjusted P Value')	1
('Sample', 'No. of sequenced reads', '% of mapped reads', 'No. of called ChIP-seq peaks', '% of ChIP-seq peaks present in both replicates')	1
('Sample', 'Total no. of peaks', 'No. of peaks in −1.5 kb to +0.5 kb window around TSS', 'Average distance to nearest TSS (bp)', 'Associated genomic feature (% of peaks)', 'No.\xa0of targeted genes', 'Unnamed: 6', 'Unnamed: 7')	1
('Gene ID', 'Imprinting status', 'Description of function')	1
('Sample', 'No. trimmed reads', '% of mapped reads', 'No. of Ler reads', 'No. of Col reads', 'Purity (%)')	1
('Optical fiber', 'Sperm accumulation at the central regions of the imaging field', 'Sperm depleted of distal regions of the imaging field', '[Ca2+]i rise (fold)')	1
('Sequences', 'Classification', 'Number of sequences', 'Predicted frequency', 'Observed frequency')	1
('Unnamed: 0', 'NRTIs', 'NNRTIs', 'PIs', 'INSTIs')	1
('Unnamed: 0', 'NRTIs', 'NNRTIs', 'PI', 'Insti')	1
('Unnamed: 0', 'Unnamed: 1', 'E92Q', 'L74M', 'N155H', 'Q148H', 'G140S', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11')	1
('Unnamed: 0', 'Unnamed: 1', 'P225H', 'Y188L', 'L100I', 'K103N/E', 'Y181C/G', '■', 'E138K/R', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12', 'Unnamed: 13', 'Unnamed: 14')	1
('Unnamed: 0', 'Unnamed: 1', 'I50V', 'I84V', 'L90M', 'V82A', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9')	1
('Reagent type (species) or resource information', 'Designation', 'Source or reference', 'Identifiers', 'Unnamed: 4', 'Additional')	1
('Unnamed: 0', 'Wild type', 'D27F', 'D27N', 'D27G', 'D27C')	1
('Gene', 'Forward (5’ → 3’)', 'Reverse (5’ → 3’)')	1
('Contrast', 'Label', '[x y z]', 'Brodmann areas', 'Glasser parcellation', 't-value', 'Cluster size')	1
('Variable', 'Males', 'Females', 'Total')	1
('Risk Factor Model', 'Parameters', 'Priors', 'Posterior Median (95% CrI)*', 'WAIC†')	1
('Transmission Model (Equations in Methods)', 'Parameters', 'Priors', 'Posterior Median (95% CrI)*', 'WAIC †')	1
('Parameter', 'Method', 'Estimate', 'Uncertainty interval', 'Key Assumptions')	1
('MICE', 'Sex', 'wildtype', 'V358A/+', 'V358A/V358A', 'Unnamed: 5')	1
('Unnamed: 0', 'Mutation', 'Domain/Motif', 'Name', 'Putative function')	1
('Sample name', '#Gb', '#mapped reads', '#rRNA-reads', '#clean reads (Non-rRNA)', '%rRNA rate', 'Coverage (x)', 'R2 correlation')	1
('Unnamed: 0', 'Study 1 (EMG)', 'Study 2 (EMG)', 'Study 3 (TMS)', 'Study 4 (EEG)', 'Study 5 (EEG)')	1
('Estimated parameters', 'Pooled study 1 and 2')	1
('Unnamed: 0', 'F', 'Sig.')	1
('Surgery', 'Treatment', 'Phase of the estrous cycle', 'N')	1
('cell class', 'image set', 'mice', 'sessions', 'total cells')	1
('Reagents or resource', 'Designation', 'Source or reference', 'Identifiers', 'Additional information')	1
('final vector', 'Source', 'insert')	1
('T (°C)', 'Treatment', 'No. ofTracks', 'Mean\xa0µ', 'SD', 'Orders of Magnitude', 'SD.1')	1
('T (°C)', 'Treatment', 'N tracks', 'Mu', 'SD', 'Orders of magnitude of the data', 'SD.1')	1
('Unnamed: 0', 'Unnamed: 1', 'Cumulative Probability Distribution (%)', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5')	1
('T (oC)', 'Treatment', 'No. of tracks', 'Mean α', 'SD', 'Mean R2', 'SD.1')	1
('GPCR', 'PDB code', 'Resolution (Å)', 'Ligand G protein/G protein memetic', 'State', 'Mutation in the TM region')	1
('Receptor', 'PDB code', 'Method', 'Resolution (Å)', 'Ligand + G protein/G protein memetic')	1
('GPCR', 'PDB code', 'Ligand', 'Ligand type', 'Na+ mimic group in ligand', 'Occupying Na+ pocket')	1
('Location of binding site', 'Receptor', 'Ligand', 'Ligand type', 'PDB code')	1
('Receptor', 'PDB code', 'Method', 'Resolution (Å)', 'Ligand + G protein/G protein memetic', 'States')	1
('Thresholds (Log2ratio values)', 'CNA level', 'Copy number', 'Weights (A)')	1
('% chromosome-arm coverage', 'Coverage punctuation (L)')	1
('Unnamed: 0', 'Unnamed: 1', 'Parametric', 'Non-parametric')	1
('Unnamed: 0', 'All outbreaks', 'Outbreaks responded to with\xa0≥\xa01 complete CATI', 'Class of response promptness (time to the first complete CATI)', 'Comparison between classes of promptness', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Unnamed: 0', 'No. of complete CATIs per week', 'Comparison between classes of CATIs per week', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Unnamed: 0', 'Unnamed: 1', 'No. of cases from the 4th day of outbreak', 'Crude estimate of CATI effectiveness (cCE1)†', 'Adjusted estimate of CATI effectiveness (aCE1)‡', 'Unnamed: 5', 'Unnamed: 6')	1
('Unnamed: 0', 'Unnamed: 1', 'Duration of outbreak', 'Crude estimate of CATI effectiveness (cCE2)†', 'Adjusted estimate of CATI effectiveness (aCE2)‡', 'Unnamed: 5', 'Unnamed: 6')	1
('Unnamed: 0', 'Unnamed: 1', 'No. of cases after the 4th day of outbreak', 'Crude estimate of CATI effectiveness (cCE3)†', 'Adjusted estimate of CATI effectiveness (aCE3)‡', 'Unnamed: 5', 'Unnamed: 6')	1
('Unnamed: 0', 'Unnamed: 1', 'Duration of outbreak', 'Crude estimate of CATI effectiveness (cCE4)†', 'Adjusted estimate of CATI effectiveness (aCE4)‡', 'Unnamed: 5', 'Unnamed: 6')	1
('Outbreak subgroup', 'All outbreaks responded to by any complete CATIs (Tables 3–6)', 'Unnamed: 2', 'Outbreaks only responded to by complete CATIs with ATB', 'Outbreaks only responded to by complete CATIs without ATB', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('Suspected cholera cases', 'Unnamed: 1')	1
('Unnamed: 0', 'All outbreaks', 'Outbreaks with no complete CATI', 'Outbreaks with\xa0≥\xa01 complete CATI', 'Odds radio† (95% CI)', 'p-value†')	1
('Unnamed: 0', 'Unnamed: 1', 'No. of cases from the 4th day of outbreak', 'Crude estimate of CATI effectiveness (cCE5)†', 'Adjusted estimate of CATI effectiveness (aCE5)‡', 'Unnamed: 5', 'Unnamed: 6')	1
('Unnamed: 0', 'Unnamed: 1', 'Duration of outbreak', 'Crude estimate of response effectiveness (cCE6)†', 'Adjusted estimate of response effectiveness (aCE6)‡', 'Unnamed: 5', 'Unnamed: 6')	1
('Cholera outbreak', 'Definition', 'Remark', 'No. of outbreaks')	1
('Scenario', '1', '2', '3', '4', '5', '6', '7', '8', '9', '10')	1
('Cholera outbreak', 'Definition', 'Remark', 'No. of CATIs', 'No. of CATIs during outbreaks (%)')	1
('Scenario', '1', '11', '12', '13', '14')	1
('Unnamed: 0', 'Crude estimates', 'Estimates adjusted for covariates selected by p-values†', 'Estimates adjusted for all covariates', 'Estimates adjusted for covariates selected by AIC*', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Adonis', 'T2D', 'IBD', 'CRC', 'Polyps', 'Cirrhosis', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12', 'Unnamed: 13', 'Unnamed: 14', 'Unnamed: 15')	1
('Experiment #', 'Montage (EEG Coordinates)', 'Intensity + duration', 'Notes', 'Significant')	1
('Exclusion', 'Explanation')	1
('Exclusion criteria', 'Exp 1', 'Exp 2', 'Exp 3', 'Exp 4', 'Exp 5', 'Exp 6', 'Total')	1
('Data collection/processing', 'EDTA-hsTRPM2', 'ADPR-hsTRPM2', 'ADPR/Ca2+-hsTRPM2', '8-Br-cADPR/Ca2+-hsTRPM2')	1
('Unnamed: 0', 'Native T2R-TTL-AlF3 (PDB 6s9e)', 'Native T2R-TTL-BeF3- (PDB 6gze)')	1
('Unnamed: 0', 'Curved conformation', 'Straight conformation', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10')	1
('Unnamed: 0', 'GDP', 'GDP-Tx', 'GDP-BeF3-', 'GTP-BeF3-', 'GDP- AlFx', 'GTP-AlFx', 'GMPCPP', 'GMPPCP', 'GMPCP')	1
('Unnamed: 0', 'GDP', 'BeF3-', 'GMPCPP', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Unnamed: 0', 'GDP-BeF3-', 'GTP-BeF3-', 'GDP- AlFx', 'GTP-AlFx')	1
('Unnamed: 0', 'Without perineal stimulation', 'With perineal stimulation', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Peptide sequence', 'Peptide score', 'High-scoring phosphorylated site', 'Additional sites mutated')	1
('Peptide sequence', 'Phospho sites', 'Other phospho sites', 'Ref.', 'Also')	1
('Protein', 'Fitting boundaries (ms)', 'α', 'AR', 'Model')	1
('A: DUHi, permissive model', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3')	1
('Unnamed: 0', 'Original data in manuscript', 'Data in independent replicate', 'Modifications made in the manuscript')	1
('Gene', 'RNAi Line', 'Driver', 'n', '% of Rhythmic Flies', 'Period Average ±SEM', 'Power Average ±SEM')	1
('Gene', 'Molecular function (based on information from Flybase) (Thurmond et al., 2019)')	1
('Genotype', 'Period ±SEM', 'Power ±SEM', 'n', '% of Rhythmic Flies')	1
('Unnamed: 0', 'Model with age-specific VE, age ≥6 months (MLE, 95% CI)', 'Model with age-specific VE, age ≥15 years (MLE, 95% CI)', 'Model with age-specific VE, age\xa0<\xa065 years (MLE, 95% CI)', 'Model with age-specific VE, age 15–64 years (MLE, 95% CI)', 'Model with birth-cohort- specific VE, age ≥15 years (MLE, 95% CI)')	1
('Unnamed: 0', 'Model with age-specific VE, age ≥6 months (MLE, 95% CI)', 'Model with age-specific VE, age ≥15 years (MLE, 95% CI)', 'Model with age-specific VE, age\xa0<\xa065 years (MLE, 95% CI)', 'Model with age-specific VE, age 15–64 years (MLE, 95% CI)')	1
('Dataset', 'Best-fitting model', 'H1 imprinting protection (%, 95% CI)', 'H3 imprinting protection (%, 95% CI)')	1
('Age groups (years)', 'Best-fitting model', 'H1 imprinting protection (%, 95% CI)', 'H3 imprinting protection (%, 95% CI)')	1
('Birth cohort', 'H1N1 VE (%, MLE, 95% CI)', 'H3N2 VE (%, MLE, 95% CI)')	1
('Expt.', 'Experimental Conditions', 'Treatment of DONOR Female', 'DONOR pregnancy', 'Infection status of MALE BREEDER', 'Infection status of RECIPIENT female', 'RECIPIENT pregnancy (# if\xa0>\xa01)', '# Positive CVL (total # of CVLs) in RECIPIENT Female')	1
('Reagent type (species) or resource', 'Designation', 'Source or Reference', 'Identifier', 'Additional information')	1
('a His6CidB* Interactome', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Tracer', 'Size (nm)', 'Charge*', 'Oral ecto.', 'Oral endo.', 'Aboral endo.', 'Calico', 'Para-cellular')	1
('Fluo', 'Laser ex (nm)', 'Em max (nm)', 'Detection range (nm)')	1
('Data set', 'E1', 'E2', 'E3', 'Refinement')	1
('Unnamed: 0', 'pAP2-NECAP ‘unclamped’ PDB ID: 6OWO EMDB ID: EMD-20215', 'pAP2-NECAP ‘clamped’ PDB ID: 6OXL EMDB ID: EMD-20220')	1
('Miniscope', 'Weight (g)', '3D printed', 'Cross platform?', 'Two scopes?', 'Opto-remote', 'Opto -in field', 'Microphone', 'IMU', 'eFocus')	1
('Year', '2000', '2015', 'Change in %')	1
('Year', 'US', 'UK', 'Canada', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('Unnamed: 0', 'Among smokers, % avoided at non-smoking death rates', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('STUDY', 'AGE (years)', 'Relative risk')	1
('Unnamed: 0', 'Reduction in excess risk', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Sex and alcohol drinking status', 'Smokers', 'Non-smokers')	1
('Factor or class of factors', 'Percent of all cancer deaths', 'Unnamed: 2')	1
('Unnamed: 0', 'Current smokers (years of age)', 'Former smokers (years of age)', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Unnamed: 0', 'US', 'UK', 'Canada', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12')	1
('Figure', 'N', 'S', 'J', 'j', 'V0.5', 'k', 'τ', 'Vm', 'σ', 'gcoop', 'Ecoop')	1
('Jαβ(μA.ms.cm\u2005−\u20052)', 'Feedforward', 'PC', 'PV')	1
('ταβ(ms)', 'E', 'I')	1
('ταβ\xa0(ms)', 'PC', 'PV', 'SOM', 'VIP')	1
('ταβ (ms)', 'PC', 'PV', 'SOM', 'X')	1
('Jαβ\xa0(µA\xa0ms.cm-2)', 'Feedforward', 'PC', 'PV', 'SOM', 'VIP')	1
('Unnamed: 0', 'Achievement age 7', 'Achievement 16')	1
('Protein', 'Rank', 'Mean', 'SEM (n\xa0=\xa03)')	1
('Antigen and antibody name', 'Immunogen', 'Manufacturer information', 'Concentration used', 'Figures')	1
('Correlation between', 'Cluster-based ROI', 'Hemisphere', 'Rmcorr', '65 dph', '200 dph', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Correlation between', 'Cluster', 'Hemisphere', 'Cluster.1', 'Peak', 'Unnamed: 5', 'Unnamed: 6')	1
('Correlation between', 'Cluster', 'Hemisphere', 'Between- subject correlation', 'Within-subject correlation', 'Unnamed: 5', 'Unnamed: 6')	1
('MRI parameter', 'Cluster-based ROI', 'Hemisphere', 'p value', 'rank', '(i/m)Q')	1
('ROI', 'Hemisphere', 'Between- subject correlation', 'Within-subject correlation', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Unnamed: 0', 'Start', 'End')	1
('Fraction of TCR sequences with incidence >', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4')	1
('Unnamed: 0', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Discovery meta-analysis', 'Replication', 'Unnamed: 8', 'Unnamed: 9')	1
('Reagent type (species) or resource', 'Designation', 'Source or Reference', 'Identifiers', 'Additional Information')	1
('Parameter', 'Proximal', 'Distal', 'Units')	1
('Parameter', 'FS PV+', 'Pyramidal', 'Units')	1
('Propeller Blades in protomer', 'Molecular mass protomer calculated', 'Molecular mass SLS measured', 'Assembly state based on SLS', 'CD melting temperature Tm', 'Tryptophan fluorescence λmax')	1
('Construct', 'Protein solution', 'Reservoir solution (RS)', 'Cryo solution')	1
('Construct (PDB ID)', '2-blades (6R5X)', '3-blades (6R5Z)', '4-blades (6R5Y)', '5-blades (6R60)')	1
('Community-level trait', 'Variance', 'Ratio of variances', "Bonett's test p-value", 'Unnamed: 4')	1
('Unnamed: 0', 'Average Binding', 'Std Dev', 'Average Branching', 'Std Dev.1')	1
('Unnamed: 0', 'Individual branching measurements', 'Individual branching measurements divided by the average binding', 'Average of the individual branching/ binding ratios')	1
('Unnamed: 0', 'Normalized Branching / Binding', 'Std Dev', 'Unnamed: 3', 'Unnamed: 4')	1
('Unnamed: 0', 'a1', 'a2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Strain', 'Sequence type', 'Adk', 'fumC', 'gyrB', 'Icd', 'Mdh', 'purA', 'recA')	1
('Strain', 'H_type', 'O_type')	1
('Sample:', 'Total reads', 'Mapped reads', '% Mapped', '% Mapped to CDS', '% Mapped to misc_RNA', '% Mapped to rRNA', '% Mapped to tRNA', '% Mapped to sRNA', '% Mapped to tmRNA')	1
('Sample:', 'CDS', 'misc_RNA', 'rRNA', 'tRNA', 'sRNA', 'tmRNA')	1
('Go id', 'Annotated', 'Significant', 'Expected', 'P value', 'Term')	1
('Sample:', 'Total', 'Mapped reads', '% Mapped', 'Mapped to CDS', 'Mapped to misc_RNA', 'Mapped to rRNA', 'Mapped to tRNA', 'Mapped to tmRNA')	1
('Sample', 'CDS', 'misc_RNA', 'rRNA', 'tRNA', 'tmRNA')	1
('Sample', 'Total reads', 'Mapped reads', '% Mapped', 'Mapped to CDS', 'Mapped to misc_RNA', 'Mapped to rRNA', 'Mapped to tRNA', 'Mapped to sRNA', 'Mapped to tmRNA')	1
('Sample', 'CDS', 'misc_RNA', 'rRNA', 'tRNA', 'sRNA', 'tmRNA')	1
('Unnamed: 0', 'Function', 'Expression (higher in)', 'Regulon size', 'Matched size', 'NES', 'FDR')	1
('Table 1a', 'Unnamed: 1', 'Unnamed: 2')	1
('Table 1b', 'Unnamed: 1', 'Unnamed: 2')	1
('Reagent type', 'Description', 'Reference', 'Identifiers', 'Additional information')	1
('Unnamed: 0', '3-way', '1-way', 'Unnamed: 3', 'Unnamed: 4')	1
('Unnamed: 0', 'Variable', 'Definition')	1
('Unnamed: 0', 'MAZTER seq', 'EpiNano p >= 0.0', 'EpiNano p >= 0.5', 'EpiNano p >= 0.9', 'Nanopore error sites', 'Nanopore error site motifs')	1
('Unnamed: 0', 'Me-RIP seq', 'Me-RIP seq motifs', 'Me-RIP seq motifs (ACA)', 'EpiNano p >= 0.5', 'Nanopore error sites', 'Nanopore error site motifs', 'Nanopore error site motifs (ACA)')	1
('Gene ID', 'Gene Name', 'Alternative splicing class')	1
('Unnamed: 0', 'Unnamed: 1', 'Accuracy', 'Omissions', 'Premature Responses', 'Perseverative Responses', 'Touch Latency', 'Reward Latency', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12', 'Unnamed: 13', 'Unnamed: 14', 'Unnamed: 15', 'Unnamed: 16', 'Unnamed: 17', 'Unnamed: 18', 'Unnamed: 19')	1
('Unnamed: 0', 'Unnamed: 1', 'Unnamed: 2', 'Accuracy', 'Correction Trials', 'Touch Latency', 'Reward Latency', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12', 'Unnamed: 13', 'Unnamed: 14')	1
('Unnamed: 0', 'Unnamed: 1', '3xTG-AD', '5xFAD', 'APP/PS1', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('Reagent type (species) or Resource', 'Designation', 'Source or reference', 'Identifiers', 'Additional Information')	1
('Unnamed: 0', 'Advantages', 'Disadvantages')	1
('MAGIC Probe Target', 'Sequence', 'Target site')	1
('Unnamed: 0', 'atrial', 'ventricular', 'Unnamed: 3', 'Unnamed: 4')	1
('CrPW number', 'Cell line name', 'Short description', 'Reference')	1
('Plasmid name (nickname/official name)', 'Used for', 'Reference')	1
('Primer name', "5'-->3' sequence")	1
('Observed product pattern', 'Type of reaction variability', 'Enzymatic cause', 'Unnamed: 3', 'Unnamed: 4')	1
('Unnamed: 0', 'ZINC9155420-Bound TRPV5 in nanodiscs (PDB: 6PBF, EMB-20292)', 'ZINC17988990-bound TRPV5 in nanodiscs (PDB: 6PBE, EMB-20291)')	1
('Rv #', 'Gene', 'Annotation', 'Sum total spectrum count')	1
('Gene symbol', 'Gene name', 'ENSEMBL gene ID', 'Relationship to MSC chondrogenesis', 'Relationship to SOX9')	1
('Transcription factor', 'Cis-BP motif*', 'Number of genes with enriched motifs/number of upregulated genes')	1
('Unnamed: 0', 'Total, N (%)', 'Uavcw', 'Nhanes i', 'Stride')	1
('Unnamed: 0', 'no Ska', '+ 100 nM Ska')	1
('Unnamed: 0', 'GPSTN (N\xa0=\xa0108)', 'GPCPu (N\xa0=\xa065)', 'p-value')	1
('Cortical area', 'GP', 'Striatum', 'STN')	1
('Antibody', 'Raised in', 'Company/catalogue#', 'Dilution used')	1
('Risk factors', 'Asthma cases N\xa0=\xa0555', 'Non-asthma controls N\xa0=\xa01115', 'Adj. OR (95% CI)*')	1
('Current features', 'Asthma cases N\xa0=\xa0555', 'Non-asthma controls N\xa0=\xa01115', 'Adj. OR (95% CI)*')	1
('Atopy characteristics', 'Asthma cases N\xa0=\xa0546', 'Non-asthma controls N\xa0=\xa01089', 'Adj. OR (95% CI)‡')	1
('Child’s residence in early life', 'Asthma cases N\xa0=\xa0555', 'Non-asthma controls N\xa0=\xa01115', 'Adj. OR (95% CI)*')	1
('Child’s residence at birth', 'Parental history of allergy', 'Asthma cases N\xa0=\xa0526', 'Non-asthmatic controls N\xa0=\xa01006', 'Adj. OR (95% CI)*')	1
('Child’s residence at birth', 'Atopy (SPT to any of 7 allergens)', 'Asthma cases N\xa0=\xa0546', 'Non-asthmatic controls N\xa0=\xa01089', 'Adj. OR (95% CI)*')	1
('Father’s education level', 'Child’s residence at birth', 'Asthma cases N\xa0=\xa0555', 'Non-asthma controls N\xa0=\xa01115', 'Adj. OR (95% CI)*')	1
('Mitochondria length (µm)', 'Summed length of actin patches present on mitochondrion at the time of fission (µm)', 'Proportion of mitochondria length occupied by actin patches (B/A)')	1
('Line', 'Temperature', 'Sperm length', 'N', 'Egg length', 'N.1')	1
('Unnamed: 0', 'Unnamed: 1', 'Unnamed: 2', 'Sperm', 'Eggs', 'Unnamed: 5', 'Unnamed: 6')	1
('Reagent type (species) or resource', 'Designation', 'Source or reference', 'Identifiers', 'Additional information', 'RRID')	1
('Reagent type (species) or resource', 'Designation', 'Source or reference', 'Ident-ifiers', 'Additional information')	1
('Unnamed: 0', 'MOR [3H]DAMGO', 'DOR [3H]DPDPE', 'KOR [3H]diprenorphine')	1
('Rat ID', '# Dopamine Neurons')	1
('Arabidopsis core model', 'Observation', 'one-cell model', 'Reference')	1
('Molecular\xa0Species', 'Flux\xa0[µmol/(m2/s)]', 'Physiological\xa0Range\xa0[µmol/(m2/s)]', 'Reference')	1
('Input (Reaction ID)', 'Flux [μmol/(m2s)]', 'Unnamed: 2')	1
('Compartment', 'Flux [μmol/(m2s)]')	1
('Topological descriptor', 'Network metrics', 'AD', 'PPMS', 'HA')	1
('Topological descriptors', 'Network metrics', 'AD', 'PPMS', 'HA')	1
('Unnamed: 0', 'AD', 'PPMS', 'HA')	1
('Resource type', 'Designation', 'Source/Reference', 'Identifier')	1
('Reagent type (species) or resource', 'Designation', 'Source or ref.', 'Identifiers', 'Additional information')	1
('Complex', '<ΔGPMF> (kcal/mol)')	1
('Complex', '<FMax\xa0>\xa0(pN)', '<Work\xa0>\xa0(kcal mol−1)')	1
('Unnamed: 0', 'Unnamed: 1', '10 mM NaCl', '100 mM NaCl', 'Unnamed: 4', 'Unnamed: 5')	1
('Unnamed: 0', 'Association Trajectories* (%)', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4')	1
('Number of participating hospitals', '3 (Serbia, Italy, Romania)')	1
('Antibiotic', 'Number of treated patients (total n=133)', 'Route')	1
('Neuron type', 'Input', 'n', 'Latency (ms)', 'Amplitude (pA)', 'Rise time (ms)', 'Half-width (ms)', 'Charge (pA.ms)')	1
('Cell line', 'Clone', 'sgRNA sequence', 'Genetic modification', 'Protein modification', 'Figures')	1
('Variable', 'N assessed (younger/older adults)', 'Mean (SD) younger adults', 'Mean (SD) older adults', 'Bayes Factor*')	1
('Variant*', 'Steady-state level (% of WT)', 'FoldX ΔΔG (kcal/mol)', 'ClinVar annotation¤', 'DME#')	1
('Unnamed: 0', 'YA FC (n\xa0=\xa055)', 'OA FC (n\xa0=\xa087)', 'OA PET (n\xa0=\xa0123)', 'OA FC vs. OA PET', 'Unnamed: 5')	1
('Unnamed: 0', 'roi', 'tEF', 'pEF', 'tAge', 'tECTnum', 'BHEFFDR')	1
('Table 2A\xa0Overall Summary', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('Unnamed: 0', 'State I', 'State II')	1
('Sample', 'Theoretical Mwt (kDa)', 'SAXS Mwt (kDa)', 'MALS Mwt (kDa)', 'Rg (Å)', 'Dmax\xa0(Å)', 'Px', 'Fit χ2')	1
('Response class', 'Criteria (non-exclusive)')	1
('Name', 'Accession no.', 'Forward', 'Reverse')	1
('Biological parameters (unit)', 'Median estimate (95% CI)', 'Estimates in the literature')	1
('Parameter', 'Unit', 'Description', 'Prior distribution')	1
('PK parameter (unit)', 'kT(h-1)', 'qc(L/h)', 'Vc(L)', 'q1(L/h)', 'V1(L)', 'q2(L/h)', 'v2(L)')	1
('Variable number', 'Variable name', 'Allowed sign of coeffiecient')	1
('Species', 'Muller\xa0A', 'Muller D', 'Muller A-AD', 'Muller B', 'Muller C', 'Muller E', 'Muller F', 'Total', 'Unnamed: 9')	1
('Unnamed: 0', 'Tandem Repeat Finder', 'k-Seek', 'TideHunter')	1
('Species', 'TE', 'Total bp masked', '% of genome masked')	1
('Unnamed: 0', 'Canu/WTDBG2 only', 'Canu/WTDBG2 + Racon (3x)', 'Canu/WTDBG2 + Racon (3x) + Pilon (1x)', 'Canu/WTDBG2 + Racon (3x) + Pilon (2x)', 'Final Hi-C scaffolded Dsub_1.0')	1
('Unnamed: 0', 'Canu + bandage', 'Canu + Quiver (2x)', 'Canu + Quiver (2x) + Pilon (2x)', 'Final Hi-C scaffolded Dath_EB_1.0', 'Final Hi-C scaffolded Dath_EB_hybrid')	1
('Unnamed: 0', 'Canu + bandage', 'Canu + Quiver (2x) + Pilon (2x)', 'Final Hi-C scaffolded Dath_EA_1.0')	1
('Unnamed: 0', 'Canu/WTDBG2 only', 'Canu/WTDBG2 + Racon (3x)', 'Canu/WTDBG2 + Racon (3x) + Pilon (1x)', 'Canu/WTDBG2 + Racon (3x) + Pilon (2x)', 'Final Hi-C scaffolded Dlow_1.0')	1
('Unnamed: 0', 'Canu + Racon (3x)', 'Canu + Racon (3x) + Pilon (1x)', 'Canu + Racon (3x) + Pilon (2x)', 'Final Hi-C scaffolded Dpse_1.0')	1
('PDs/pit', 'Rpit', 'APD/Apit', 'Rpit.1')	1
('Brain region', 'Peak MNI coordinate', 'T value', 'Unnamed: 3', 'Unnamed: 4')	1
('Contact localization', 'Subject no.', 'Df', 'T', 'Corrected P', 'Cohen’s d')	1
('Resolution range', '39.7–2.1 (2.174–2.1)')	1
('RNA', '87654\xa0321\xa0rpt C-UGUGA-AUG\xa0(8) C-UGUGCCAUA\xa0(9)  12345 pos2', 'FBF-2, Kd (nM)', 'Krel2', 'FBF-2/LST-1, Kd (nM)', 'Krel3')	1
('Protein', 'Pattern', 'Base +4', 'Terminal AU position', 'Count', 'Ratio compact/')	1
('GAL4 RNAi driver', 'Expression location (Demarco et al., 2014)', '% fertile', '+\xa0/-\xa0stdev.', 'Minimum number of males per set')	1
('Repeat or region', 'Oligo with T3 antisense promoter')	1
('Antibody', 'Supplier; Cat. number', 'Working concentration')	1
('Chr', 'e0-2hr', 'e2-4hr', 'e4-8hr', 'e8-12hr', 'e12-14hr', 'e14-16hr', 'e16-20hr', 'e20-24hr')	1
('Description', 'Sequence 5’−3’')	1
('Stock name or genotype', 'Obtained from: stock number', 'Description', 'Unnamed: 3')	1
('Unnamed: 0', 'N', 'Normal bundle', 'Lagging bundle', 'Kinked', 'Knotted', 'Needle eyed', 'Decondensed')	1
('Unnamed: 0', 'N', 'Normal canoe', 'Abnormal canoe')	1
('mRNA target', 'Sequence 5’−3’')	1
('Genotype', 'Source')	1
('Figures', 'Short genotype', 'Complete genotype')	1
('Supplementary figures', 'Short genotype', 'Complete genotype')	1
('Unnamed: 0', 'Literature', 'BigBrain', 'Post mortem', 'In vivo (thr=3)', 'In vivo (thr=4)', 'In vivo (thr=5)')	1
('Study', 'Buffer composition', 'pH', 'Temp–erature', 'Time', 'Concen–tration', 'Method', 'α-Syn type', 'Poly–morph', 'PDB')	1
('Unnamed: 0', 'E46K mutant', 'Phosphorylated', 'N-terminal acetylated', 'α-Syn polymorph 2a', 'α-Syn polymorph 2b')	1
('Unnamed: 0', 'α-Syn polymorph 2a', 'α-Syn polymorph 2b')	1
('Primer', 'Primer sequence (5´−3´)', 'Fragment size (bp)', 'GenBank accession no.')	1
('Unnamed: 0', 'Unnamed: 1', 'CD4+ central memory', 'Unnamed: 3', 'CD4+ effector memory', 'Unnamed: 5')	1
('Unnamed: 0', 'Unnamed: 1', 'Unnamed: 2', 'CD4+ TCM', 'CD4+ TEM', 'Unnamed: 5', 'Unnamed: 6')	1
('Calibration', 'Unnamed: 1')	1
('Model', 'ORd AP clamps', 'ToR-ORd AP clamps')	1
('Basic cycle length', "Experimental data (O'Hara et al., 2011)", 'Simulated 90% IK1 block', 'Simulated 90% IK1 + 15% IKr block', 'Simulated 90% IK1 + 30% IKr block')	1
('F0', 'α', 'γ', 'Fm', 'd0', 'c', 'N', 'dt')	1
('Γ', 'ϵ', 'DA', 'αA', 'DE', 'αE', 'Unnamed: 6', 'Unnamed: 7')	1
('Nucleus', 'RE', 'VM', 'MD', 'Rh/CM', 'PT/AM', 'No histology', 'Total')	1
('Age', 'Bmp7+/+', 'Bmp7Flag/+', 'Bmp7Flag/Flag', 'Total')	1
('Age', 'Bmp7+/+', 'Bmp7-/+', 'Bmp7-/-', 'Total')	1
('Age', 'Bmp7+/+', 'Bmp7R-GFlag/+', 'Bmp7R-GFlag/R-GFlag', 'Total')	1
('Age', 'Wildtype', 'Bmp2-/+', 'Bmp7R-GFlag/+', 'Bmp2-/+;Bmp7R-GFlag/+', 'Total')	1
('Age', 'Wildtype', 'Bmp4-/+', 'Bmp7R-GFlag/+', 'Bmp4-/+;Bmp7R-GFlag/+', 'Total')	1
('Age', 'Wildtype', 'Bmp7-/+', 'Bmp7R-GFlag/+', 'Bmp7R-GFlag/-', 'Total')	1
('Gene-edited/cell line', 'Indel(s) introduced', 'Predicted protein impact', 'Frequency/depth')	1
('Antibody', 'Company', 'Catalogue number')	1
('Unnamed: 0', 'Fitting group averages', 'Fitting individuals’ Data', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9')	1
('Unnamed: 0', 'Post-win', 'Post-loss', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Unnamed: 0', 'Unnamed: 1', 'Post-win', 'Post-loss', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('Unnamed: 0', 'TRPV2APO_1 (EMD-20677, PDB 6U84)', 'TRPV2APO_2 (EMD-20678, PDB 6U85)', 'TRPV2CBD_1 (EMD-20686, PDB 6U8A)', 'TRPV2CBD_2 (EMB-20682, PDB 6U88)')	1
('Anaphase', 'Symbol', 'Value', 'Notes')	1
('Name', 'Genotype', 'Notes')	1
('Part', 'Links to online resources')	1
('Part', 'Description (link)', 'Company')	1
('Population', 'Outcome', 'Year(s)', 'Citation')	1
('Unnamed: 0', 'Total no. of publications N\xa0=\xa01282', 'No. of first-author publications N\xa0=\xa01282', 'First-author publication rate N\xa0=\xa01270', 'Highest impact factor N\xa0=\xa01275', 'Total')	1
('Unnamed: 0', 'First-author publications', 'First-author publication rate', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Unnamed: 0', 'Experiment 1', 'Experiment 2', 'Experiment 3', 'Experiment 4', 'Unnamed: 5')	1
('Unnamed: 0', 'Experiment 1', 'Experiment 2', 'Experiment 3', 'Experiment 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Unnamed: 0', 'Primary selection and validation', 'Validation as intrabodies', 'Validation as immunolabels', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Unnamed: 0', 'Unnamed: 1', 'lHG- rHG', 'lHG- lSTG', 'lHG- rSTG', 'rHG- lSTG', 'rHG- rSTG', 'lSTG- rSTG', 'Digit Span')	1
('T statistic', 'MNI peak activation coordinates', 'Number of active voxels in the cluster', 'Anatomical region', 'Probabilistic atlas1')	1
('Unnamed: 0', 'Emissions', 'Gene/transcript*', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12', 'Unnamed: 13')	1
('Name', 'Unit', 'In vitro', 'In vivo')	1
('Name', 'Sequence')	1
('Unnamed: 0', 'IR-insulin complex')	1
('Insulin residues', 'IR residues')	1
('Sample', 'N (skulls)', 'N (teeth)', '% individuals w/≥\xa01 brkn tooth', '% broken teeth', '% broken teeth with canine teeth excluded')	1
('Methods', 'Mouse (JAX #)', 'Reagents', 'Wavelength', 'Brain region')	1
('Unnamed: 0', 'Model 1: continuous parity measure', 'Model 2: categorical parity measure', 'Unnamed: 3', 'Unnamed: 4')	1
('Unnamed: 0', 'Model 1', 'Model 2', 'Model 3', 'Model 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Unnamed: 0', 'Model 1', 'Model 2', 'Model 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Unnamed: 0', 'Model 1', 'Model 2', 'Unnamed: 3', 'Unnamed: 4')	1
('Age category (years)', 'Women', 'Men', 'Total', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9')	1
('Parameter', 'Model one outcome: grade 0.5 fracture (borderline)', 'Model two outcome:\xa0grade one fracture (mild)', 'Model three outcome:\xa0grade two fracture (moderate)', 'Model four outcome:\xa0grade three fracture (severe)')	1
('Unnamed: 0', 'A) Fracture (n=47a)', 'B) No fracture (n=198a)', 'A vs. Bb', 'Unnamed: 4', 'Unnamed: 5')	1
('Unnamed: 0', 'Model 1: controlling for age and anthropometrics', 'Model 2: + mean IBI', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Parameter', 'Model one outcome: grade 0.5 fracture (borderline)', 'Model two outcome: grade one fracture (mild)', 'Model three outcome: grade two fracture (moderate)')	1
('Unnamed: 0', 'A) Fracture (n=95a)', 'B) No fracture (n=166a)', 'A vs. Bb', 'Unnamed: 4', 'Unnamed: 5')	1
('Parameter', 'Exp(β)', '95% CI', 'p')	1
('Variable', 'N', 'Mean', 'SD', 'Min', 'Max')	1
('Unnamed: 0', 'n oocytes processed by MST', 'In vitro development for up 96 hr post-ICSI', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9')	1
('Unnamed: 0', 'n\xa0oocytes processed by MST', 'In vitro development for up 96 hr post-ICSI', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Unnamed: 0', 'In vivo development', 'Unnamed: 2', 'Unnamed: 3')	1
('Unnamed: 0', 'Unnamed: 1', 'Average weight', 'Unnamed: 3')	1
('Unnamed: 0', 'Orc1', 'Cdc6', 'Cdt1')	1
('Unnamed: 0', 'orc14739/Cyo; tg/tg', 'orc14739/Cyo; tg/TM3', 'orc14739/orc14739; tg/tg', 'orc14739/orc14739; tg/TM3')	1
('Controls', 'All targets', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('Genus', 'Species', 'Strain', 'Gram +/-', 'Major habitat', 'Aggregation', 'Survival at 24 hr', 'Gifted from')	1
('Feature', 'Axolotl', 'Xenopus', 'Chicken', 'Mouse', 'References')	1
('Experiment/figure number', 'Statistics')	1
('Unnamed: 0', 'Experiment', 'Time required', 'Timeline')	1
('Parameter', 'Description', 'Value')	1
('Date', 'Country', 'Population and assay used', 'Age range (median)', 'Total no. seropositive/total no. tested', 'Seroprevalence % [95% CI]')	1
('Virus', '2014 seroprevalence (95% CI)', '2014 age-adjusted seroprevalence (95% CI)', '2015 seroprevalence (95% CI)', '2015 age-adjusted (95% CI)')	1
('2015', '2017', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Variable', '2014 (n\xa0=\xa049)', '2015 (n\xa0=\xa0700)')	1
('Virus', '2014 seroprevalence (95% CI) (n\xa0=\xa049)', '2014 bootstrap estimates of seroprevalence (95% CI)', '2015 seroprevalence (95% CI) (n\xa0=\xa0700)', 'p-value*')	1
('Virus', '2013–2015 change, Mean [95% CI]', 'p-value*', '2015–2017 change, Mean [95% CI]', 'p-value*.1')	1
('Age range', 'Population estimate (2017)', 'Samples in 2014 study', 'Samples in 2015 study')	1
('Unnamed: 0', 'Neutrophils', 'Basophils', 'Unnamed: 3', 'Infl. Monos.', 'Mast Cells', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Experiment', 'Condition', 'Start\xa0Reward', 'Depletion\xa0Rate', 'Pre-Reward\xa0Delay', 'Harvest\xa0Time', 'Travel\xa0Time')	1
('Unnamed: 0', 'Hypothesis', 'Experimental predictions')	1
('Term', 'Definition')	1
('Possible survey responses', 'Respondents that selected this as an answer (%)', 'Interpretation of response', 'Respondents that selected at least one of the answers in this group (n, %)')	1
('Statement', 'ECR Mean Score', 'PI Mean Score', 'p value', '% ECRs with no opinion', '% PIs with no opinion')	1
('Reasons given by PIs for not naming co-reviewers', 'Number of Respondents')	1
('Theme', 'Example write-in responses')	1
('Theme', 'Example write-in response')	1
('Age at surgery', 'Gender', 'Resected brain area', 'Number and type of cells included in this study')	1
('Anatomical region', 'Cluster p-value', 'Cluster size', 'Local maxima', 'BA', 'Peak MNI-coordinates (x,y,z)')	1
('Freq. band', 'SMA', 'Left A2', 'Right A2', 'Left M1', 'Right M1', 'L cerebellum', 'R cerebellum')	1
('Connection', 'Modulation peak in theta band', 'Modulation peak in alpha band')	1
('Cell line', 'Virus', 'Immune assumption', 'AIC reduction from\xa0next-best\xa0model', 'Antiviral rate', 'ε [lci – uci] *', 'ρ [lci – uci] *', 'β [lci – uci] *', 'Mean field R0', 'Spatial β')	1
('SecA variant', 'KD Ribosomes*', 'KD VipB†', 'Basal ATPase activity‡', 'TM§')	1
('Gene', 'Uninfected', 'Day 2 p.i.', 'Day 7 p.i.')	1
('Criteria', 'Grade 0', 'Grade 1', 'Grade 2', 'Grade 3')	1
('Trait', 'Description', 'UKB data field')	1
('Trait/characteristic', 'Pair of strata', 'Genetic correlation (s.e.)')	1
('Trait', 'Siblings (pairs)', 'Unrelated-n*', 'Unrelated- discovery', 'Unrelated- prediction')	1
('Qualifications (UKB data field 6138)', 'Years of schooling')	1
('*Patients', 'Hu_1 ♀', 'Hu_2 ♀', 'Hu_3 ♀', 'Average ±SD ♀', 'Hu_4 ♂', 'Hu_5 ♂', 'Hu_6 ♂', 'Average ±SD ♂', 'Total average ±SD')	1
('Unnamed: 0', 'Unnamed: 1', 'Mean\xa0±\xa0SD', 'Median', 'IQR', 'CV', 'Skewness', 'Variance')	1
('Patient identity', 'Gender', 'Age (years)', 'Age at epilepsy onset (years)', 'Histopathological result', 'Antiepileptic drugs (pre-op)', 'Reconstructed SBs')	1
('Mouse ID', 'Sex', 'Group', 'Numbers of cells')	1
('Unnamed: 0', 'Unscored', 'AW-ON', 'REMS-ON REMS/AW-ON', 'NREMS-ON SC-ON', 'EC-ON', 'HAW-ON')	1
('Subject ID', 'Day of sampling&', 'Hemoglobin (g/dl)*', 'Hemoglobin (g/dl)**', 'Thrombocyte count (1000/µl)*', 'Parasite count/µl **, #', 'Red blood cell (RBC) count (million/µl)**', 'Sex', 'Age', 'Type of patient$', 'Country of infection')	1
('GAL4 line used', 'Number of flies', 'Change compared to GAL4 control', 'Change compared to UAS control')	1
('TCR chain', 'Original sequence', 'Modified sequence')	1
('TCR chain', 'Sequence alignment', 'Unnamed: 2', 'Unnamed: 3')	1
('Figure', 'Condition', 'Avg. speed [μm/min]\xa0±\xa0S.D')	1
('SNP', 'EMMA -log(p)', 'N2 allele', 'Variant allele')	1
('position', 'Ref/Alt', 'Wild isolates with alt variant (used in this study)')	1
('Protein', 'Chain ID', 'HOMOLOGS (Human; pombe)', 'Chain length (Total; Modeled)', 'Template', 'Procedure', 'Modelled residues')	1
('Strain number', 'Genotype', 'Reference')	1
('Plasmid number', 'Genotype', 'Reference')	1
('Unnamed: 0', 'CTF3c (EMDB-20200) (PDB 6OUA)')	1
(0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16)	1
('AA', 'εGhavami', 'εnative', 'εcarbonylated', 'qnativetocarbonylated')	1
('Force field', '+ve Charged AA', '-ve Charged AA', 'Net charge', 'Net hydrophobicity')	1
('Yeast strains', 'Source')	1
('Reagent type', 'Designation', 'Source (publication)', 'Identifier', 'Additional information')	1
('Hardware', 'Manufacturer', 'Model')	1
('#', 'Electronic parts', 'Amount/pieces', 'Supplier/producer*', 'Part number*', 'Unit cost €*', 'Total cost €*')	1
('#', 'Pneumatic parts', 'Amount', 'Supplier/ Producer*', 'Part number*', 'Unit cost €*', 'Total cost €*')	1
('Unnamed: 0', '# reads', '#reads containing no Ns', 'Overall alignment rate')	1
('Unnamed: 0', '#low threshold peaks', '#merged peaks', '#peaks passing IDR cutoff of 0.05', '%peaks passing IDR cutoff of 0.05')	1
('Unnamed: 0', 'SLC1A5_cKM4012 EMD-9187, PDB: 6MP6', 'SLC1A5_cKM4012_L_Gln EMD-9188, PDB: 6MPB')	1
('Name', 'Evidence', 'Size', 'Conservedc', 'Predicted biological role in C. elegansd', 'Other names', 'Unnamed: 6', 'Unnamed: 7')	1
('Isoform', 'kah90', 'kah91', 'kah106', 'kah142', 'kah93', 'kah96', 'kah99', 'kah11', 'kah68', 'Length')	1
('Unnamed: 0', 'Unnamed: 1', 'nurf-1–1 or nurf-1.b', 'nurf-1–2 or nurf-1.d', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('Species', 'CtBP motif', 'Gro motif', 'Source')	1
('Antibody', 'Clone', 'Source', 'Final concentration', 'Use')	1
('Inhibitor', 'Target', 'Source', 'Final concentration')	1
('Guide', 'Forward oligonucleotide', 'Reverse oligonucleotide')	1
('hEMX1 gRNA purification', 'tbx5a I2 gRNA purification', 'Ratio of fluorescence- positive F0 embryos')	1
('Division-centric', 'Replication-centric', 'Unnamed: 2', 'Unnamed: 3')	1
('Experiment', 'Discarded %', '# cell cycles', '1/λ[min]', 'Adder r', 'λm\u2005−\u2005d r', 'Lbm\u2005−\u2005d r')	1
('Case', 'Tissue block (anatomical location)', 'Lesion type', 'Region of interest')	1
('Functional cell type', 'Antibody panel')	1
('Unnamed: 0', 'DIV', 'PKC-', 'PKCN', 'PKC+', 'unit')	1
('Unnamed: 0', 'DIV', 'PKC−', 'PKCN', 'PKC+')	1
('Name', 'Species', 'Resolution', '#\xa0Images', '# Keypoints', 'Individuals', 'Source')	1
('Biomarker or parameter', 'Sampling frequency before rhinovirus challenge', 'Sampling frequency after rhinovirus challenge')	1
('Sub-cluster number \\ characteristic', 'Size (%)', 'Number of pre-challenge series (%)', 'p-value')	1
('Biomarker name', '% Healthy responders (distributional changes)', '% Asthmatic responders (distributional changes)', '% Healthy responders (relative change within 10 days)', '% Asthmatic responders (relative change within 10 days)')	1
('Demographic features', 'Healthy', 'Asthmatic')	1
('Healthy', 'Asthmatics')	1
('Measurements of biomarkers', 'Frequency before rhinovirus challenge', 'Frequency after rhinovirus challenge')	1
('Study volunteers', 'Responders by seroconversion', 'Responders by RVPCR', 'Description of symptoms')	1
('Biomarker', 'Lag', 'P-values asthmatic vs. healthy participants prechallenge', 'P-values asthmatic vs. healthy participants postchallenge', 'P-values prechallenge vs. postchallenge in healthy participants', 'P-values prechallenge vs. postchallenge in asthmatics', 'P-values interaction (2-way ANOVA)')	1
('Patient ID', 'Infection Status', '1 Day Lag FEV1 Autocorrelation', 'p-value')	1
('Patient ID', 'Infection Status', '1 Day Lag FEV1/FVC Autocorrelation', 'p-value')	1
('Patient ID', 'Infection Status', '1 Day Lag FVC Autocorrelation', 'p-value')	1
('Patient ID', 'Infection Status', '1 Day Lag PEF (% pred.) Autocorrelation', 'p-value')	1
('Patient ID', 'Infection Status', '2 Days Lag FeNO Autocorrelation', 'p-value')	1
('Unnamed: 0', 'Min', '1st QU', 'Median', 'Mean', '3rd QU', 'Max')	1
('Peptide', 'Variant', 'Sequence and secondary structure', 'Pore†')	1
('Peptide', 'Variant', 'Sequence')	1
('Unnamed: 0', 'Hydrophobic sector [°]', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12')	1
('Unnamed: 0', 'Unnamed: 1', 'Unnamed: 2', 'Simulations', 'Unnamed: 4', 'Unnamed: 5')	1
('Peptide', 'Variant', 'Membrane', 'Mean', 'Standard deviation')	1
('A. Lesions associated with decreased CT pleasantness sensitivity on the contralesional left forearm, in all patients (N\xa0=\xa035)', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Unnamed: 0', 'Stroke Patients –RH (N\xa0=\xa059; 31 females)', 'Healthy Controls - HC (N\xa0=\xa020, 11 females)', 'Mann-Whitney Test', 'NRH/NHC', 'Unnamed: 5', 'Unnamed: 6')	1
('NPP Gene', 'Peak FPKM', 'pFPKM Percentile', 'pFPKM Rank', '% Cells', 'Predicted Neuropeptides', 'Cognate NP-GPCR Genes', 'Unnamed: 7')	1
('NP-GPCR Gene', 'Peak FPKM', 'pFPKM Percentile', '% Cells', 'Neuropeptide Receptor', 'GPCR Class', 'Primary Gα\xa0Family', 'Cognate NPP Genes')	1
('#', 'Cognate Pair Symbol', 'NPP Gene', 'NP-GPCR Gene', 'Primary Gα Family', 'Fraction of Type Pairs', '#.1', 'Cognate Pair Symbol.1', 'NPP Gene.1', 'NP-GPCR Gene.1', 'Primary Gα Family.1', 'Fraction of Type Pairs.1')	1
('Enriched at time point', 'AGI', 'Gene name', 'Functional annotation', 'Subcellular localization', 'Unnamed: 5', 'Unnamed: 6')	1
('iPSC name', 'Additional information', 'Reference')	1
('Unnamed: 0', 'Mean Telomere Length', 'Unnamed: 2')	1
('Transgenic line', 'Completeness (%)', 'Sd', 'Accuracy (%)', 'Sd.1')	1
('Reaction step', 'Rate constant (min−1)*,†', 'Reaction step.1', 'Unnamed: 3')	1
('Strain', 'Genotype', 'Reference/source')	1
('Plasmid', 'Description', 'Type', 'Reference/source')	1
('Gene', 'Sequence 5’−3’', 'Reference/source')	1
('Name', 'Sequence 5’−3’', 'Reference/source')	1
('Unnamed: 0', 'TRPV3K169A (EMD-20192) (PDB 6OT2)', 'TRPV3K169A 2-APB (EMD-20194) (PDB 6OT5)')	1
('P. tricornutum strain', 'Flow cytometry dynamic range', 'Microfluidics imaging dynamic range')	1
('Unnamed: 0', 'PikpNK-KE–AVR-PikD', 'PikpNK-KE–AVR-PikE')	1
('Unnamed: 0', 'Y799W(K+)E2-MgFx', 'Y799W(Rb+)E2-MgFx', 'Y799W(Rb+)E2-AlFx', 'WT(Rb+)E2-MgFx')	1
('Structure', 'Rb+·(SCH)E2BeFx', 'Y799W(K+)E2-MgFx', 'Y799W(Rb+)E2-MgFx', 'Y799W(Rb+)E2-AlFx', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Unnamed: 0', 'Tyr799Trp', 'WT', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9')	1
('Predicted specialized metabolic gene cluster# (characterized product)', '1st gene', 'Last gene', 'Number of upregulated genes (q-value\xa0<\xa00.01; >4 fold change)', '% of upregulated genes in each cluster', 'Number of Lsr2- associated sites (q-value\xa0<\xa00.01)')	1
('Unnamed: 0', 'GDF15/GFRAL /RET', 'GDNF/GFRα1/RET', 'NRTN/GFRα2/RET', 'ARTN/GFRα3/RET')	1
('Genotype', 'Mice', 'Venules', 'Diameter (μm)', 'Leukocyte counts (106 cells/ml)', 'Mean blood velocity (mm/s)', 'Newtonian wall shear rate (s−1)')	1
('c', 'L', 'Maximum Hill value (nHmax)')	1
('Animal', 'P50 (mmHg)', 'nH')	1
('Treatment and Populations', 'MIC (mg/L)', 'Fold MIC increase')	1
('Treatment and Populations', 'MIC measured in biofilms (mg/L)', 'Fold MIC increase')	1
('Unnamed: 0', 'Increasing concentrations', 'Subinhibitory concentrations', 'Unnamed: 3', 'Unnamed: 4')	1
('Transporter Family', 'Regulator', 'Efflux pump', 'Substratesa')	1
('Sample', 'FishID', 'Light organ', 'Accession #', 'E. escacola ANI', 'E. luxaltus ANI', 'Length (Mb)', 'GC content (%)', 'Complete (%)', 'Ave coverage')	1
('Transmission', 'Description', 'Symbiont and function', 'Host', 'Genome', 'References')	1
('Unnamed: 0', 'Matunggong', 'Limbuak', 'Unnamed: 3', 'Unnamed: 4')	1
('Unnamed: 0', 'Area of 99% UD for all movement (hectares) Median (IQR)', 'Area of 99% UD from 6pm – 6am (hectares) Median (IQR)')	1
('Unnamed: 0', 'Matunggong', 'Limbuak', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Model', 'DIC*', 'Marginal likelihood', 'Model complexity*', 'RMSE*', 'Mean log-score (CPO)', 'Unnamed: 6')	1
('Covariate', '95% BCI Rate Ratio', 'Unnamed: 2', 'Unnamed: 3')	1
('Unnamed: 0', 'Predicted infectious bites per night (median [IQR])')	1
('Index', 'Δτ31\xa0(16\xa0ms)', 'Δτ21\xa0(16\xa0ms)', '(nP\u2004=\u20041,\u2006nP\u2004= −\u20051)', '(pP\u2004=\u20041,\u2006pP\u2004= −\u20051)')	1
('Index of dataset', 'Imposed mean', 'Imposed variance', 'Imposed skewness', 'Contrast range', 'Discrete levels')	1
('Unnamed: 0', 'Image dataset (FWHMlocal-mean/τlocal-mean)', 'Velocity distribution\xa0(σvel, or discrete values,\xa0°/s)', 'Number of trials', 'Motion Detector')	1
('Opening angle', 'Tm2/Tm1', 'D (μm)', 'P (μm)', 'T (ms)', 'Vt (μm/s)')	1
('Flagellar opening angle', 'Diameter (μm)', 'Pitch (μm)', 'Period (ms)', 'Vz (μm/s)', 'Vt (μm/s)')	1
('Motor torque (Tm/Tm-Ecoli)', 'D (μm)', 'P (μm)', 'T (ms)', 'Vt (μm/s)')	1
('Unnamed: 0', 'Aesthetascs', 'Olfactory neuropils (ON)', 'References', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Name', 'Sequence (5’→3’ direction)', 'Used for')	1
('Name', 'Strain number', 'Description', 'Plasmid', 'Resistance', 'Reference')	1
('Name', 'Description', 'Origin/ Marker', 'Reference')	1
('Name', 'Description/genotype', 'Plasmid', 'Resistance', 'Reference')	1
('Organism', 'Relative activityd', 'Kd (pppGpp) (μM)', 'IC50 (pppGpp) (μM)', 'Unnamed: 4')	1
('Sample', 'RHa (nm)', 'Polydb', '% Polyd', 'Est. MW (kDa)')	1
('HPRT', 'Km (guanine) (μM)', 'Km (PRPP) (μM)', 'kcat (s−1)')	1
('Unnamed: 0', 'Mean ± standard deviation', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12')	1
('Conservative settings', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Partitioning schemea', 'Marginal likelihoodb', 'Unnamed: 2')	1
('Sample', 'Country', 'Estimated coverage of razorbill genome', 'Estimated coverage of targeted genes')	1
('Sample', 'Country', 'Coverage range of captured markers')	1
('Gene name', 'Protein name', 'Log2 AD/Ctrl', 'Previous involvement in AD', 'Reference')	1
('Patient ID', 'Gender', 'Age', 'Disease duration (years)', 'Braak stages (AD)', 'Postmortem delays [hours]', 'Unnamed: 6')	1
('Unnamed: 0', 'Room', 'Building', 'Neighborhood', 'City', 'Country', 'Continent')	1
('Unnamed: 0', 'Condition', 'Spatial', 'Sound', 'Clip-art', 'Aggregated', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Symbol', 'Definition', 'Unnamed: 2')	1
('Adverse Condition*', 'Criterion', 'Frequency', 'Unnamed: 3')	1
('Generation', 'Parameter*', 'Coefficient', 'Hazard ratio (95% CI)', 'P value', 'Interpretation')	1
('Unnamed: 0', 'N (M, F)', 'Mean age at eye tracking in months (SD)', 'Mean age at rsfMRI scan in months (SD)', 'Age range at rsfMRI scan in months', 'Mean framewise displacement (SD)')	1
('Unnamed: 0', 'Ctf43−CMG1 (EMD-20471) (PDB 6PTJ)', 'Ctf43−CMG2 (EMD-20472) (PDB 6PTN)', 'Ctf43−CMG3 (EMD-20473) (PDB 6PTO)')	1
('Unnamed: 0', 'Ctf43–Polα- primase (EMD-20744)')	1
('Unnamed: 0', 'Relevant properties or genotype', 'Source or reference')	1
('Motifs', 'Examples', 'Self-nonself theory', 'Discontinuity theory')	1
('Name', 'Sequence', 'Reference')	1
('Unnamed: 0', 'Number in category', 'Number sampled', 'Percent sampled', 'Number with documents')	1
('Unnamed: 0', 'Unnamed: 1', 'All', 'R-type', 'M-type', 'B-type')	1
('Murine Cytoband', 'Human Cytoband', 'Gain/ Loss', 'Genes in common murine-human loci', 'Pathway/Role')	1
('Kb', 'Budding rate per patches of membrane in a compartment')	1
('ϕi', 'Fraction of a given species i (cis, medial or trans) in a compartment')	1
('cn', 'Size distribution of compartments in the system')	1
('Cell type', 'IPHH', 'IPHH.1', 'IPHH.2', 'IPHH.3', 'IPHH.4', 'APHH', 'APHH.1', 'APHH.2', 'APHH.3', 'APHH.4')	1
('Unnamed: 0', 'Original data', 'Filtered data', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Significance (FDR\xa0<\xa00.05)', 'n. genes', 'Unnamed: 2', 'Unnamed: 3')	1
('Sex', 'Contrast', 'UP', 'Ns', 'DOWN', 'Total')	1
('A. Dietary Restriction', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4')	1
('Gene', 'Family', 'Subject', 'Diagnosis', 'Sex', 'Inheritance', 'Puberty', 'Associated phenotypes', 'dbSNP number', 'Nucleotide change', 'Amino acid change', 'MAF (%) gnomAD MaxPop', 'In vitro studies', 'Unnamed: 13', 'Unnamed: 14')	1
('Mouse', 'Probe option', 'Recordable channels', 'M\xa0±\xa0SD Isolated units', 'Silicone on shank', 'Outcome')	1
('Reagent type/resource', 'Designation', 'Source or reference', 'Identifiers', 'Additional information')	1
('Sample ID', 'Tissue diagnosis', 'Location', '1p/19q co-deletion', 'IDH1 mutation', 'GPIHBP1')	1
('Unnamed: 0', 'Volume (mm3)', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5')	1
('Unnamed: 0', 'Early', 'Mid', 'Late')	1
('Unnamed: 0', 'Ndufs4-LS patients', 'Ndufs4KO mouse', 'Vglut2:Ndufs4cKO mouse*', 'Gad2:Ndufs4cKO mouse*')	1
('Unnamed: 0', 'Unnamed: 1', 'Unnamed: 2', 'Cilia in channel', 'Wing', 'Unnamed: 5', 'Unnamed: 6')	1
('P. pacificus neuron', 'Axon termination site in nerve ring', 'Dye filling', 'Feature(s) supporting homology', 'Likely C. elegans homolog', 'Main difference compared to C. elegans')	1
('Amphid Homologs', 'P. pacificus', 'C. elegans', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5')	1
('Author', 'Refractive error range of myopic cohort [D]', 'Functional tests', 'Results for myopes at foveal center', 'Suggested cause')	1
('Subject ID', 'Eye', 'Gender', 'Age', 'Ethnicity', 'Spherical equivalent refraction (D)', 'Axial length (mm)', 'Corneal curvature (mm)', 'Anterior chamber depth (mm)', 'Retinal magnification factor (microns/deg)', 'Angular cone density (cones/deg2)', 'Linear cone density (cones/mm2)', 'PRL distance from fovea (minutes)', 'PRL distance from fovea (microns)', 'PRL angular cone density (cones/deg2)', 'PRL linear cone density (cones/mm2)')	1
('Subject', 'Eye', 'RMF (2-surface lens)', 'RMF (4-surface lens)', 'RMF (Bennett et.al., 1994)')	1
('Unnamed: 0', 'SRS-DYNC1H13260-3427', 'DYNC1H11230-4646', 'SRS+-DNAH72758-2896')	1
('Unnamed: 0', 'SRS-DYNC1H13260-3427', 'SRS+-DNAH72758-2896')	1
('Strains', 'No peptide', 'sComS', 'sBI7')	1
('Versus:', 'Ribosomal protein genes', 'Segregating de novo genes', 'Fixed de novo genes', 'DNA repair genes', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Pattern', 'Fixed de novo proportion', 'Parental duplicate proportion', 'melanogaster-specific child duplicate proportion')	1
('Ligands', '5a')	1
('Ligands', '1')	1
('Table 1', 'Genome Size (bp)', 'Genome Copy number‡', 'Total DNA (bp)', 'Percent of Total DNA‡', 'Concentration (bp/μm3 )§', 'ATAC-seq read percentage¶', 'Fold enrichment over expected**')	1
('Unnamed: 0', 'Model', 'Unnamed: 2', 'Unnamed: 3')	1
('Antibiotic name', 'Abbreviation', 'Antibiotic class', 'Molecular target', 'Effect', 'Number of T0 lines displaying significant fitness cost')	1
('Data', 'Model', 'Unnamed: 2', 'Unnamed: 3')	1
('Description', 'Unnamed: 1', 'Value', 'Std.error', 't-value', 'p-value', 'Unnamed: 6')	1
('NLME weight', 'Unnamed: 1', 'Value', 'Std.error', 't-value', 'p-value', 'Unnamed: 6')	1
('Reagent type', 'Designation', 'Source', 'Identifier')	1
('Meanings', 'Definitions')	1
('Papers', 'Countries', 'Model Organisms')	1
('Reference', 'Instance of function usage', 'Consensus meanings')	1
('Regressor', 'Post-stim. time (ms)', 'Anatomical labels', 'MNI coord. (peak) Brodmann Area', 'β t-value (tsum)')	1
('VE\xa0~\xa01\xa0+\xa0LDAA_AV\xa0+\xa0LDAV_AV', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4')	1
('Model', 'VAE\xa0~\xa01\xa0+\xa0β*LDAA_AV + β*LDAV_AV', 'VE\xa0~\xa01\xa0+\xa0β*LDAA_AV + β*LDAV_AV', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5')	1
('Common names', 'Scientific name')	1
('Unnamed: 0', 'Dataset 1 Slc26a9T in detergent (EMD-4997) (PDB 6RTC)', 'Dataset 2 Slc26a9T in nanodiscs (EMD-4998) (PDB 6RTF)')	1
('Unnamed: 0', 'Unnamed: 1', 'WT*', 'Q88A', 'F92A', 'T127A', 'F128A', 'L391A', 'S392A', 'N441A')	1
('Reagent type (species) or resource', 'Degignation', 'Source or reference', 'Identifiers', 'Additional information')	1
('Figure', 'Panel', 'Session name', 'Time points', 'Mask', 'Direct online viewer link')	1
('Unnamed: 0', 'Unnamed: 1', 'Younger (Y)', 'Older (O)', 'Unnamed: 4', 'Unnamed: 5')	1
('Unnamed: 0', 'Unnamed: 1', 'Younger (Y)', 'Unnamed: 3', 'Older (O)', 'Unnamed: 5')	1
('Unnamed: 0', 'Logistic regression', 'Linear regression', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10')	1
('Unnamed: 0', 'Unnamed: 1', 'MMN', 'LDN', 'Unnamed: 4', 'Unnamed: 5')	1
('Prey', 'Lobi Bay', 'Boi Yai Island')	1
('Use Wear Grade (numerical)', 'Use Wear Grade (descriptive)', 'Pitting', 'Crushing', 'Fracture')	1
('Unnamed: 0', 'KLVFFAENVGS')	1
('Unnamed: 0', 'Mixtures', 'Steps', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Unnamed: 0', 'Protocol', 'Protocol/Reference', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Taxon', 'Genome size (Mbp)', 'Copy number')	1
('Term (independent variable)', 'DoF', 'Deviance', 'Resid. DoF', 'Resid. Deviance', 'Pr(>Chi)')	1
('Reagent type (species) or resource', 'Designation', 'Source or reference', 'Identi-fiers', 'Additional information')	1
('ID', 'Annotations (Positive proteins in cluster/Total proteins in cluster)', 'Corrected P <=')	1
('ID', 'Name', 'Description', '% Disorder', 'Cluster ID')	1
('Unnamed: 0', 'Unnamed: 1', 'Linear or constant', 'Unnamed: 3', 'Constant', 'Linear', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Unnamed: 0', 'I', 'II', 'III', 'IV', 'V')	1
('STRUCTURE', 'I', 'II', 'III', 'IV', 'V')	1
('Subtype', 'CA', 'Unnamed: 2', 'IS', 'p-value', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('Strain no.', 'Unnamed: 1', 'Genotype', 'Source or reference')	1
('Figure', 'Simulation code', 'Processing code', 'Parameters')	1
('Accession number', 'Name', 'Peptides', 'Protein score', 'Protein score negative control', 'FE')	1
('X-ray diffraction data', 'Unnamed: 1')	1
('Immobilized G6b-B receptor (standard configuration)', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4')	1
('Unnamed: 0', 'L [μm]', 'Diam [μm]', 'Area [μm2]', 'Ri [MΩ]', 'Cm [pF]', 'gpas [nS]')	1
('Index', 'Location (lobule)', 'Side', 'SUIT coordinates/mm', 'Cluster size/mm3', 'pFWE', 'TFCE', 'Unnamed: 7', 'Unnamed: 8')	1
('Index', 'Location', 'Side', 'SUIT coordinates/mm', 'Cluster size/mm3', 'pFWE', 'TFCE', 'Unnamed: 7', 'Unnamed: 8')	1
('Unnamed: 0', 'Horizontal mean ± SEM (median)', 'Vertical mean ± SEM (median)', 'p-values (corrected α\xa0=\xa00.0045)')	1
('Parameter name', 'Parameter value', 'Parameter description')	1
('Substrate', 'Variable tail sequence', 'Fraction degraded in vivo')	1
('Substrate', 'Vmax (min−1 hex−1)', 'KM (μM)')	1
('Sample characteristic', 'LA (\xa0=\xa017)', 'HA (\xa0=\xa017)', 'pa', 'Unnamed: 4', 'Unnamed: 5')	1
('VOI', 'LA (\xa0=\xa017)', 'HA (\xa0=\xa017)', 'Group comparisonsa', 'Effect size', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('Gene', 'Oncogene/tumour suppressor', 'Combinatorial/single agent', 'Available drug treatments', 'Cancer association summary', 'Reference')	1
('Gene category', 'Gene name', 'Function/pathway Summary', 'Cancer association summary', 'References')	1
('Unnamed: 0', 'Speed during first 10s', 'Speed within 30s', 'N Subjects', 'N Trials', 'Unnamed: 5', 'Unnamed: 6')	1
('Plasmid name', 'Purpose', 'Brief description', 'Backbone vector', 'Promoter')	1
('Nucleotides', 'Formula', 'Parent/Product (positive polarity)', 'Comment (for 15N experiment)')	1
('Strain/genotype', 'Information', 'Source/reference')	1
('Parameter', 'Notation', 'Value')	1
('Unnamed: 0', 'Genotype frequency', 'Subphenotype vs. controls', 'Unnamed: 3', 'Unnamed: 4')	1
('Reagent type (species) or resource', 'Designation', 'Source or reference', 'Identifiers', 'Additionnal information')	1
('Gene ontology term (Associated with cell envelope)', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5')	1
('Gene', 'Protospacer')	1
('PRE term', 'RMS dimer A', 'RMS dimer B')	1
('PRE term', 'Hexamer 1 RMS (Å)', 'Hexamer 2(i) RMS (Å)', 'Hexamer 2(ii) RMS (Å)', 'Hexamer 2(iii) RMS (Å)')	1
('Unnamed: 0', 'ΔN6\xa0dimer A', 'ΔN6\xa0hexamer')	1
('Module', 'Variant', 'Reaction scheme', 'Rate equations', 'Rate constants')	1
('Condition', 'Test stimulus', 'Comparison stimulus', 'Comparison frequencies')	1
('Substrate', 'Uniprot Acc #', 'Target site(s)', 'PHD isoform', 'Reference')	1
('Unnamed: 0', 'Non-HIF substrate', 'HIF-1α control', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12', 'Unnamed: 13')	1
('Unnamed: 0', 'Unnamed: 1', 'Unnamed: 2', '# Spectra filtered by confidence of modification site', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Characteristic', 'KDM', 'NDM', 'P value', 'Unnamed: 4')	1
('Unnamed: 0', 'Brazil', 'India', 'P value')	1
('Characteristics', 'TB', 'Unnamed: 2', 'TBDM', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Taar1/Oprm1 genotype combination', 'MA intake', 'MA-induced change in body temperature')	1
('Sample', 'Site of origin', 'Spore killer*', 'Sequenced', 'Technology', 'Mycelium', 'Spok genes†', 'Spok block location‡', 'Flanking genes§')	1
('Unnamed: 0', 'SPOK4', 'SPOK3', 'SPOK2', 'SPOK1')	1
('Solvent', 'S (mol/L)')	1
('Scheme', '3', '4')	1
('Data collection', 'Rpg/ATP', 'Cbz/ATP', 'Gbc/ATP', 'ATP only', 'Apo')	1
('Strains', 'Source')	1
('Unnamed: 0', 'Genotype', 'Source', 'Experiment', 'Figure')	1
('Canonical gait', 'Phase template (cycles)')	1
('Limb', 'V-statistic', 'p-Value', '95% CI for p-value')	1
('Colonisation A', 'Colonisation B', 'Number of A to B transitions\xa095 % HPD', 'Tips in descendant B subgraphs (median)', 'Nucleotide diversity transmitted to B (median)', 'Number of B to A transitions\xa095% HPD', 'Tips in descendant A subgraphs (median)', 'Nucleotide diversity transmitted to A (median)', 'Direction', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12')	1
('Subject', 'Number of Sequences', 'p-value', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Uniprot', 'Protein.names', 'Gene.names', 'Peptides', 'Log ratio AS/WT', 'Unnamed: 5')	1
('Lum', 'μbσbρbμGOaffσGOaffμCUEaffσCUEaffμERIσERIgERIΔERIaEXdENDaENDλ', 'σb', 'ρb', 'μGOaff', 'σGOaff', 'μCUEaff', 'σCUEaff', 'μERI', 'σERI', 'gERI', 'ΔERI', 'aEX', 'dEND', 'aEND', 'λ')	1
('Outer stroma (1)', 'Myometrium (2)', 'Inner stroma (3)', 'Inhibited Progenitor (4)', 'Epithelium (5)', 'Proliferating cells (6)', 'Vascular endothelium (7)', 'Dividing epithelium (8)', 'Mesothelium (9)', 'Myeloid (10)', 'Erythroid (11)', 'Pericyte (12)', 'Lymphatic endothelium (13)', 'Neuronal (14)')	1
('Estimation method', 'Included', 'Excluded')	1
('Parameters of go distribution', 'Control', 'Experimental 1', 'Experimental 2', 'Experimental 3')	1
('Label', 'Description', 'Common alternative labels')	1
('Unnamed: 0', 'Age at imaging', 'sex', 'Days enriched', 'Days expressing GcaMP6s', 'N mice', 'N imaging fields')	1
('Reagent type (species) or resource', 'Designation', 'Source or reference', 'Identifiers', 'Additonal information')	1
('H3K27me3', 'Ab first', 'BSA', 'Human', 'Yeast', 'E. coli', 'Corr (Sc:Ec)')	1
('Substratea', 'Dissociation constant Kd (nM)b')	1
('Unnamed: 0', 'Copy number', 'Unnamed: 2')	1
('Protein', 'Peptide sequence')	1
('Unnamed: 0', 'G1', 'Unnamed: 2', 'G2', 'Unnamed: 4', 'Prometaphase', 'Unnamed: 6')	1
('Unnamed: 0', 'G1', 'G2', 'Prometaphase')	1
('Protein', 'Number of ChIP-seq peaks')	1
('Overlap', 'Number of ChIP-seq peaks')	1
('Unnamed: 0', 'MIC (µg/ml)*', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4')	1
('Unnamed: 0', 'Unnamed: 1', 'Unnamed: 2', 'Growth inhibitory α-LptD mAbs*', 'Unnamed: 4', 'Unnamed: 5')	1
('Treatment type', 'Treatment name', 'Treatment buffer', 'Buffer pH', 'Protease concentration', 'Duration (triple numbers, times at 37oC-70oC-95oC, in hr)')	1
('Reagent type (species) or resource', 'Designation', 'Source/reference', 'Identifiers', 'Additional Information')	1
('Sample', '% mass after HCl demineralization', 'C % (organic fraction)', 'F14C (organic fraction)')	1
('Sample', 'Average DNA concentration (ng/μL)', 'Total DNA (ng)', 'DNA per 1 g of bone or mudstone (ng/g)')	1
('Substance', '% of body mass', 'Average adult body mass (kg)', 'Mass of substance (kg)', 'Mass of substance (Da)', 'Typical amino acid (Da)', 'Number of amino acids', 'Maximum\xa0number of peptide bonds', 'Number of bonds surviving')	1
('Sample bag #', 'Originally sent to', 'HPLC ID', 'Py-GC/MS ID', 'DNA extraction, fluorescence microscopy, 16S rRNA amplicon ID', 'Location', 'Type', 'Details')	1
('Taxon', 'Details', 'Location', 'Approximate age', 'Notes', '[Asx]', '[Glx]', '[Ser]', '[L-Thr]', '[L-His]', '[Gly]', '[L-Arg]', '[Ala]', '[Tyr]', '[Val]', '[Phe]', '[Leu]', '[Ile]', '[Total]')	1
('Taxon', 'Details', 'Location', 'Approximate age', 'Notes', 'Asx D/L', 'Glx D/L', 'Ser D/L', 'Arg D/L', 'Ala D/L', 'Val D/L', 'Phe D/L', 'Leu D/L', 'Ile D/L', 'Tyr D/L')	1
('Species', 'Details', 'Location', 'Approximate age', 'Notes', '[Asx]', '[Glx]', '[Ser]', '[L-Thr]', '[L-His]', '[Gly]', '[L-Arg]', '[Ala]', '[Tyr]', '[Val]', '[Phe]', '[Leu]', '[Ile]', '[Total]')	1
('Species', 'Details', 'Location', 'Approximate\xa0age', 'Notes', 'Asx D/L', 'Glx D/L', 'Ser D/L', 'Arg D/L', 'Ala D/L', 'Val D/L', 'Phe D/L', 'Leu D/L', 'Ile D/L', 'Tyr D/L')	1
('Sample ID', '[Asx]', '[Glx]', '[Ser]', '[L-Thr]', '[L-His]', '[Gly]', '[L-Arg]', '[Ala]', '[Tyr]', '[Val]', '[Phe]', '[Leu]', '[Ile]', '[Total]')	1
('Sample ID', 'Asx D/L', 'Glx D/L', 'Ser D/L', 'Arg D/L', 'Ala D/L', 'Val D/L', 'Phe D/L', 'Leu D/L', 'Ile D/L', 'Tyr D/L')	1
('Unnamed: 0', 'PC1 (55.04%)', 'PC2 (22.66%)')	1
('Unnamed: 0', 'PC1 (31.64%)', 'PC2 (25.42%)')	1
('Unnamed: 0', 'PC1 (30.01%)', 'PC2 (15.97%)')	1
('Unnamed: 0', 'PC1 (62.09%)', 'PC2 (24.49%)')	1
('Sample', 'Mass analysed (mg)', 'C %')	1
('Sample', 'Mass (mg) bulk powder before demineralisation', 'Mass (mg) after demineralisation', '% mass surviving demineralisation', 'Mass (mg) analysed', 'C %', '% change in [C] from bulk powder')	1
('Bag number', 'Type', 'Replicate', 'Sample ID', 'Kit', 'Ng of DNA / μL', 'Concentration', 'Concentrated ng of DNA / μL', 'Unnamed: 8', 'Unnamed: 9')	1
('Amino acids', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3')	1
('Unnamed: 0', 'Mudstone', 'Bone surface scrapings', 'Bone core', 'EDTA demineralized bone core')	1
('Unnamed: 0', 'Pneumonia1 n (%3)', 'Diarrhea2 n (%3)')	1
('Unnamed: 0', 'Pneumonia1 n (%2)')	1
('Etiology', 'Source of estimation', 'Etiologic fraction (%) (uncertainty range)', 'Estimated deaths (uncertainty range)')	1
('Region', 'Pneumonia mortality rate (per 1000 live births)1', 'Etiologic fraction (%), (uncertainty range)2', 'Diarrhea mortality rate (per 1000 live births)1', 'Etiologic fraction (%), (uncertainty range)2.1', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Epoch', 'Age', 'Laser condition', 'Mean', 'SEM', 'Statistical comparisons')	1
('Epoch', 'Age', 'Lever', 'Laser condition', 'Mean (sec)', 'Std. error', 'Statistical analysis')	1
('Domain', 'Test', 'Subtest', 'Controls', 'Patients', 'Controls vs patients', "‘Impaired' range", 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12', 'Unnamed: 13')	1
('Code', 'Age (years)', 'Sex', 'Antibody type', 'Acute T2 scan notes', 'Unnamed: 5', 'Unnamed: 6')	1
('Structure', 'Controls', 'Patients', 'Mean % reduction', 'F', 'Partial η2', 'p-corr', 'Unnamed: 7', 'Unnamed: 8')	1
('kE', 'Peak', 'Center of mass', 'Structure', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9')	1
('Memory composite score', 'Effects of HPC atrophy', 'Unnamed: 2')	1
('Vaccine/TLR', 'Components', 'Abbreviation', 'Manufacturer')	1
('Construct', 'TM [°C] at pH 7.4', 'TM [°C] at pH 5')	1
('Mutated locus', 'Function or product', '# Spontaneous Mutants w/this mutation', 'Mutations recovered')	1
('Patient #', 'Diagnosis', 'Gender', 'Age', 'Edu', 'WAIS-III', 'WMS-III', 'BNT', 'FAS', 'L-N sequence', 'Years since onset', 'Unnamed: 11', 'Unnamed: 12', 'Unnamed: 13')	1
('Unnamed: 0', 'Ahp (N\xa0=\xa095)', 'Hp (N\xa0=\xa079)')	1
('Unnamed: 0', 'Fast anterograde', 'Slow anterograde', 'Fast retrograde', 'Slow retrograde', 'Stationary')	1
('Lateral velocity', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3')	1
('Dataset', 'Single-bound SNF2h-nucleosome complex at SHL\xa0+\xa02', 'Doubly-bound SNF2h-nucleosome at SHL\xa0±\xa02')	1
('Dataset', 'Single-bound SNF2h-nucleosome complex: SHL-2/SHL\xa0+\xa02', 'Single-bound SNF2h-nucleosome complex, SHL-2', 'Core nucleosome')	1
('Single guide RNAs used to generate exon 6b deletions in Robo1/2 (also see Figure 4—figure supplement 1A).', 'Unnamed: 1', 'Unnamed: 2')	1
('Reagent type (species) or resource', 'Designation', 'Source or reference', 'Identifier', 'Addition information')	1
('Reagent type (species) or resource', 'Designation', 'Source or reference', 'Identifiers', 'Add. inform.')	1
('Reagent type(species) or resource', 'Designation', 'Source or reference', 'Identifiers', 'Additional information')	1
('Gene name', 'Forward', 'Reverse')	1
('Mouse ID', 'Genotype', 'Sex', 'Hair cycle stage')	1
('Gene abbreviation', 'Full gene name', 'Known function', 'Fold change bu Runx1 TG/WT', 'Fold change in WT HG vs bu')	1
('Name', 'Sequence (5’ to 3’)', 'Function')	1
('Reagent type (species)or resource', 'Designation', 'Source/reference', 'Identifiers', 'Additional information')	1
('Name', 'Brand', 'Catalog number', 'Sequence')	1
('Primer', 'Forward sequence', 'Reverse sequence')	1
('Unnamed: 0', 'pH50a', 'N', 'Unnamed: 3', 'pH50ssd', 'N.1')	1
('Variable', 'Unit', '4dpf', '1wpf', '2wpf', '3wpf')	1
('Variable', 'Unit', 'Otog-/-', 'Control')	1
('Variable', 'Unit', 'Otog-/-, no utricle', 'Utricle control', 'Aldoca::KR lesioned', 'Aldoca::KR control')	1
('Epidemiological metrics', 'Badger-Badger', 'Cattle-Cattle', 'Badger-Cattle')	1
('Isolate ID', 'Outlier - Random Forest', 'Outlier - Boosted Regression', 'Phylogenetic-Spoligotype mismatch')	1
('Unnamed: 0', '2 demes', '3 demes – outer is both', '3 demes – outer is cattle', '3 demes – outer is badgers', '4 demes', '6 demes – north and south', '6 demes – east and west', '8 demes – north and south', '8 demes – east and west')	1
('Target', 'LIPS result')	1
('Reagent type or resource', 'Designation', 'Source', 'Identifiers')	1
('Data collection and processing', 'TRPV2RTx-ND', 'TRPV2RTx-APOL 1', 'TRPV2RTx-APOL 2', 'TRPV2RTx-APOL 3')	1
('Unnamed: 0', 'RA', 'AreaX', 'Avalanche')	1
('Dataset', 'Section number', 'Anatomical region', 'Tracer', 'Injection site', 'Primary antibody', 'Secondary antibody', 'EM size (μm x μm)', 'EM dwell time (ns)', 'Pixel size (nm)')	1
('Antigen', 'Alexa 488 LT #D-22910', 'FITC LT #D-1820', 'Texas Red LT #D-3328', 'BDA LT #D-1956')	1
('Animal number', 'Age at surgery', 'Age at expt.', 'Data', 'Notes')	1
('Sample type', 'Site', 'Cultural group', 'Time span', 'Taxonomic determination before this study', 'Other molluscan fauna present at the site')	1
('Proteins present in database from', 'Identified proteins', 'Double-buttons', 'Freshwater', 'Marine', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12', 'Unnamed: 13', 'Unnamed: 14', 'Unnamed: 15')	1
('Hic74 [Hyriopsis cumingii]', 'A', 'A.1', 'A.2', 'A.3', 'A.4', 'A.5', 'A.6', 'G', 'D', 'G.1', 'S', 'E', 'G.2', 'A.7', 'A.8', 'L', 'V', 'G.3', 'L.1', 'I', 'A.9', 'G.4', 'A.10', 'Q', 'R', 'E.1')	1
('Sample', 'δ13C (‰)', 'δ18O (‰)')	1
('Unnamed: 0', '[Asx]', '[Glx]', '[Ser]', '[Gly]', '[Ala]', '[Val]', '[Phe]', '[Ile]', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12', 'Unnamed: 13', 'Unnamed: 14', 'Unnamed: 15', 'Unnamed: 16')	1
('Unnamed: 0', 'Asx D/L', 'Glx D/L', 'Ser D/L', 'Ala D/L', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Unnamed: 0', 'Sample', 'Powder mass (mg)')	1
('Unnamed: 0', 'Hav A', 'Hav B', 'Hav C', 'Hor A', 'Hor B', 'Hor C', 'Pes B', 'U. pict orum', 'U. cras sus', 'M. marga ritifera', 'P. auricu larius')	1
('Unnamed: 0', 'Unnamed: 1', 'Unnamed: 2', 'Seropositivity cutoff, log10 IgG (MFI-bg) *', 'Unnamed: 4', 'Unnamed: 5')	1
('Unnamed: 0', 'Seropositivity cutoff *', '4-Fold change in IgG levels †', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Feature', 'Memory success', 'Memory precision')	1
('Genotype', 'Sample freq', 'Base model', 'Model + geo effects', 'Effect in cell culture')	1
('Antibody', 'Source', 'Application', 'Concentration')	1
('Name', 'Sequence (5’ – 3’)')	1
('Country', 'Years of data available', 'Type of report available', 'Type of report used', 'No. admin units analyzed*', 'Source of dengue data', 'Source of census data')	1
('Variable', 'Unadjusted', 'Adjusted', 'Unnamed: 3', 'Unnamed: 4')	1
('Variable', 'Unadjusted', 'Adjusted*', 'Unnamed: 3', 'Unnamed: 4')	1
('Line', 'Condition', '10', '100', '1000', '5000')	1
('Reagent Type', 'Designation', 'Reference', 'RRID', 'Catalogue number')	1
('Unnamed: 0', 'BC-Inh1', 'BC-Inh2', 'BC-SAM', 'APO')	1
('Unnamed: 0', 'Male', 'Female †††', 'Unnamed: 3', 'Unnamed: 4')	1
('Unnamed: 0', 'Unnamed: 1', 'Temperature (°C)', 'PaO2 (mmHg)', 'PaCO2 (mmHg)', 'pH', 'MAP (mmHg)', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11')	1
('Overall', 'f_w', 'f_first', 'f_last', 'f_both')	1
('Unnamed: 0', 'Unnamed: 1', '$\\overline{X}$\xa0case (σ)', '$\\overline{X}$\xa0control (σ)', '$\\overset{\\sim}{X}$ case', '$\\overset{\\sim}{X}$ control', 'd', '∆')	1
('Experimental restraints', 'Unnamed: 1', 'Unnamed: 2')	1
('Gene', 'Unnamed: 1', "Sequence (5'-\xa0>\xa03')", 'Reference')	1
('Unnamed: 0', 'Growth phase', '8-oxodG/106 dG')	1
('Unnamed: 0', 'Zheng et al., 2013; El Hage et al., 2018', 'Kovalevsky et al., 2010', 'Unnamed: 3', 'Zheng et al., 2013; El Hage et al., 2018.1', 'Kovalevsky et al., 2010.1', 'Unnamed: 6', 'Unnamed: 7')	1
('Unnamed: 0', 'No. of cells', 'No. of tracks', 'F1 (%)', 'F2 (%)', 'F3 (%)', 'D1 (µm2s−1)', 'D2 (µm2s−1)', 'D3 (µm2s−1)')	1
('Strain number/plasmid', 'Description/genotype', 'Reference/Source')	1
('Germplasm', 'Hypocotyl Length (mm)', 'Apical hook', 'Cotyledon', '% PLB (-D15)', '% PLB (+D15)', 'cis-carotenes', 'Unnamed: 7')	1
('Gene id', 'GENE', 'PhANG', 'Protein encoding description', 'Etiolated seedlings', 'Young leaves', 'det1-1', 'NF-1', 'NF-2', 'Unnamed: 9', 'Unnamed: 10')	1
('Target genes', 'Forward primer 5’-\xa0>\xa03’', 'Reverse primer 5’-\xa0>\xa03’')	1
('Target genes', 'Sequence-sense', 'Sequence-anti-sense')	1
('Experiment', 'Rupture disk (p.s.i.)', 'Atrazine concentration (µg ml−1)', 'Survival untransformed (days)', 'Mean survival pAmpPSBA (days)')	1
('Experiment', 'Rupture disk (p.s.i.)', 'Chloramphenicol concentration (µg ml−1)', 'Survival untransformed (days)', 'Mean survival pAmpChl (days)')	1
('Substrate/ Na+', 'Kd (µM)', 'ΔH (cal mol−1)', 'ΔS (cal mol−1 K−1)')	1
('Unnamed: 0', 'GltTk D-Asp')	1
('Unnamed: 0', 'WT', 'Het-F', 'Het-U', 'Hom-F')	1
('Unnamed: 0', 'Het-U', 'Hom-P')	1
('Variant filters', 'Number')	1
('GO Category ID', 'GO Category Name', 'p-value', 'q-value Bonferroni', 'q-value FDR B&H', 'q-value FDR B&Y', 'Hit Count in Query List', 'Hit Count in Genome', 'Hit in Query List')	1
('MO name', 'Sequence', 'References', 'Amounts injected for knockdown', 'Amounts injected for DFC targeted knockdown')	1
('Construct', 'Ligand', 'Kd (µM)', 'Km (µM)', 'Vmax (nmol/mol mCST/min)', 'Unnamed: 5', 'Unnamed: 6')	1
('Unnamed: 0', 'HDVD mCST-CMP', 'LCP mCST∆C', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5')	1
('Gene', 'Disease', 'Mutation', 'mCST residue', 'Biochemical phenotype', 'Possible mechanism based on the structure', 'Ref.*')	1
('Sample name', 'Provenance', 'Dated material', 'Description', 'Lab. code', 'F14C\xa0±\xa01σ', '14C Age (yr BP) ±1σ', 'Calibrated* dating result (95.4 probability)', '%C', '%N', 'δ13C (in ‰;±1σ)', 'δ15N (in ‰;±1σ)', 'C/N ratio')	1
('ID', 'Left (L) or right (R) foot', 'General appearance', 'Relative length of toes', 'Toes region general appearance length - width', 'Toe one position', 'Ball region, general appearance length-width', 'Arch region', 'Heel region, general appearance', 'Hell posterior margin', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12')	1
('Unnamed: 0', 'Unnamed: 1', 'LENGTHS', 'WIDTHS', 'ANGLES', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12', 'Unnamed: 13', 'Unnamed: 14', 'Unnamed: 15', 'Unnamed: 16', 'Unnamed: 17', 'Unnamed: 18', 'Unnamed: 19', 'Unnamed: 20', 'Unnamed: 21', 'Unnamed: 22', 'Unnamed: 23', 'Unnamed: 24')	1
('Footprints', 'Lengths', 'Widths', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11')	1
('ID', 'PC 1', 'PC 2', 'PC 3', 'PC 4', 'PC 5', 'PC 6', 'PC 7', 'PC 8', 'PC 9')	1
('Unnamed: 0', 'PC 1', 'PC 2', 'PC 3', 'PC 4', 'PC 5', 'PC 6', 'PC 7', 'PC 8', 'PC 9')	1
('Genera', 'Species', 'Distribution', '#of POGs', 'MAL of POGs (bp)', 'MIL of POGs (bp)', 'AL of POGs (bp)', 'NSP of POGs', 'NAP of POGs')	1
('Genera', 'Total', 'With blast (without hits)', 'With blast hits', 'With mapping', 'With GO annotation')	1
('Genera', 'Integral component of membrane')	1
('Unnamed: 0', 'Structure of the 5’ ETS RNP PDB 6ND4 EMD-0441')	1
('Unnamed: 0', 'JAMA (n\xa0=\xa0154)', 'Lancet (n\xa0=\xa0113)', 'NEJM (n\xa0=\xa0129)', 'Total (N\xa0=\xa0396)')	1
('RCT and medical discipline', 'Reversal summary', 'Systematic review conclusion')	1
('Year', 'New authors', 'Total authors')	1
('Posted', 'Published', 'Unpublished')	1
('Figure', 'Unnamed: 1')	1
('Genotype', 'Name')	1
('LCL', 'SNP', 'Genotype')	1
('Unnamed: 0', 'Reference', 'Unnamed: 2')	1
('Study', 'Technique', 'Species', 'Class', 'Nm', 'Nv', 'D (µm)', 'Vm (mm s–1)', 'Fm per vessel (µL min–1)', 'TRBF (µL min−1retina−1)')	1
('Flock', 'Species', 'N birds', 'N frames', '†, ‡Nearest\xa0neighbor distance (m).', '§Nearest neighbor power', '†Ground speed (m·s−1)', '†Airspeed (m·s−1)', 'Wind speed (m·s−1)', '¶Wind direction (deg.)', '†Z-speed (m·s−1)', '†Turnrate (° s−1)')	1
('Variable', 'Test', 'N', 'R2', 't/F', 'P')	1
('Wingbeat frequency predictors', 'Estimate', 'S.E.', 'T', 'd.f.', 'P')	1
('Titrated ligand', 'Constant ligand', 'KDapparent')	1
('Metabolite', 'Media condition', 'Cell line', '[Metabolite]ic (µM)', 'Fractional saturation')	1
('PKM2ligand', 'KMPEP (mM)', 'kcat (s−1)', 'kcat/KMPEP (s−1 mM−1)')	1
('Molecule', 'Mass (Da)')	1
('Protein/ligand mixture', 'Cone voltage (V)', 'Number of tetramer peaks', 'Mass species (Da)')	1
('Liganded state simulated', 'PDB ID of starting structure', 'Number of protein atoms', 'Number of water atoms', 'Simulation time', 'Number of replicas')	1
('AlloHubM', 'KDFBP')	1
('AlloHubM', 'Ligand', 'KMPEP (mM)', 'kcat (s−1)', 'kcat/KMPEP (s−1 mM−1)')	1
('Hub', 'Intra', 'Inter')	1
('Phosphodiester bond', 'Steady-state synthesis rate', 'Steady-state degradation rate')	1
('Steady-state quantity', 'Value')	1
('Unnamed: 0', 'Peak', 'MNI coordinates (mm)', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5')	1
('Strain', 'Genome features', 'Gene and OG counts', 'HGTs', 'HGT vs native gene subsets', 'Annotations', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12', 'Unnamed: 13', 'Unnamed: 14', 'Unnamed: 15', 'Unnamed: 16', 'Unnamed: 17', 'Unnamed: 18')	1
('Kingdom', 'Phylogeny', 'Natural habitat of closest non-eukaryotic ortholog', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Species', 'Raw reads', 'Raw reads N50', 'Raw reads GC', 'Raw reads (bp)', 'Raw reads coverage', 'Unitigging (bp)', 'Unitigging coverage', 'Genome size (bp)', 'Genome GC', 'Contigs', 'Contig N50', 'Genes', 'Busco (C)', 'Busco (C\xa0+\xa0F)', 'Busco (D)', 'Busco (M)')	1
('Unnamed: 0', 'HGT genes', 'Avg. %GC Native', 'Avg. %GC HGT', 'p-Val (T-test)', 'Delta')	1
('Unnamed: 0', 'HGT genes', 'Single exon (HGT)', 'Multi exon (HGT)', 'Single exon (Native)', 'Multi exon (Native)', "Fisher's p", 'Single exon % (HGT)', 'Single exon % (Native)', 'Multi exon % (HGT)', 'Multi exon % (Native)')	1
('Unnamed: 0', 'HGT genes', 'Mean exon per transcript (HGT)', 'Mean exon per transcript (Native)', 'Wilcox (p)', 'Delta')	1
('Unnamed: 0', 'Normoxia 0.21 FiO2', 'Moderate hypoxia 0.105 FiO2', 'Severe hypoxia 0.07 FiO2')	1
('Species', 'Days', 'Counts', 'Trate (daily)', 'Trate sd', 'Trate max')	1
('Unnamed: 0', 'Roe deer', 'Wild boar', 'Red deer female', 'Red deer male', 'Moose', 'European bison')	1
('One Ca2+-site per α-subunit', 'Unnamed: 1', 'Two Ca2+-sites per α-subunit', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9')	1
('Gene', 'Channel', 'Color', 'Position', 'Accession', 'Catalog number')	1
('Unnamed: 0', 'Unnamed: 1', 'REM', 'Cataplexy', 'NREM', 'Wake', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9')	1
('Zebrafish specimen', 'Age (dpf)', 'Segments', '12-bit projections (GB)', '32-bit reconstructions (GB)')	1
('Major brain divisions', 'Brain region cell nuclei (Counts)', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5')	1
('Major brain divisions', 'Brain region volumes (µm3)', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5')	1
('#', 'Plate', 'Well', 'Compound name', 'Known activity', 'vcanb score', 'mbp score', 'fr24 score')	1
('Model', 'Description', 'Both animals', 'Animal A', 'Animal B', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('Mask', 'COM (MNI coordinates mm)', 'Volume (mm³)')	1
('Reagent type', 'Designation', 'Source of reference', 'Identifiers', 'Additional Information')	1
('Unnamed: 0', 'W144/C199-Atto moPrP', 'W171/C225-Atto moPrP', 'Unnamed: 3', 'Unnamed: 4')	1
('Unnamed: 0', '(K1\xa0+\xa0K2) calculated from fluorescence spectra', '(K1\xa0+\xa0K2) obtained from ACFs of PET-FCS')	1
('Unnamed: 0', 'W144/C199-Atto moPrP', 'Unnamed: 2')	1
('1RLW', 'Ca1', 'Ca4', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Protein', 'Kd (M)', 'Fold increase*')	1
('Protein', 'KsA\xa0(μM)', 'Vmax (nmol/min/mg)')	1
('Protein', 'K0.5 (mole fraction)', 'Vmax (nmol/min/mg)')	1
('Unnamed: 0', 'Native')	1
('Reagent type (Species) or resource', 'Designation', 'Source Or reference', 'Identifiers', 'Additional information')	1
('Virus', 'Residue', 'AAVR construct', 'Residue.1', 'Location', 'Distance', 'Measured from:')	1
('AAVR residues close to AAV2:', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11')	1
('Data collection:', 'Unnamed: 1')	1
('Dopant protein', 'Characteristic time of fluorescence change (h)', 'Characteristic time of FRET change (h)')	1
('Sequence segment', 'FRET efficiency (M)', 'FRET efficiency (OL)', 'FRET efficiency (OS)')	1
('Target location', 'ID', 'sgRNA target sequence')	1
('Off-target sequences', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Males', 'Organ', 'Wt weight (mg)', 'St error', 'F/f Weight (g)', 'St error.1', 'T-test', 'P value')	1
('Unnamed: 0', 'Unnamed: 1', 'KD (µM)', 'Unnamed: 3', 'Unnamed: 4')	1
('Unnamed: 0', 'Anisotropy', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4')	1
('Tract', 'Type', 'Profiles', 'Est. LHNs', 'Range', 'Recorded')	1
('Locus', 'Protein name', 'Total spectral counts', 'Unnamed: 3')	1
('Parameter', 'Values')	1
('Patient ID', 'Sex', 'Anti-AChR titer (nM)')	1
('#', 'Name', 'Details')	1
('#', 'Antibody', 'Species', 'Dilution', 'Source')	1
('GENE', 'Species', 'Forward 5’−3’', 'Reverse 3’−5’')	1
('Characteristic', 'Patients', 'Control subjects', 'Unnamed: 3')	1
('Model description (reference)', 'Original language', 'Original num lines', 'NetPyNE num lines')	1
('Unnamed: 0', 'Number of variants in Blumeria graminis f. sp.', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5')	1
('Song trait', 'Song-stable', 'Song-plastic', 'F-Value', 'Corrected α', 'p-value')	1
('Song trait', 'Early', 'Delayed', 'Plastic', 'F-Value', 'Corrected α', 'p-value')	1
('Song trait', 'State 1', 'State 2', 'T-Value', 'p-value')	1
('Song trait', 'Slope', 'Std error', 'λ', 'T-Value', 'Corrected α', 'p-value')	1
('Song trait', 'One rate', 'Three rates', 'p-value')	1
('Primer ID', 'Nucleotide sequence (5’−3’)')	1
('Unnamed: 0', 'PC1', 'PC2', 'PC3')	1
('Parameter', 'WT', 'Ubiad1Ki/Ki')	1
('Unnamed: 0', 'Q1', 'Q3', 'DP', 'CE', 'Source')	1
('Gene ID', 'Gene name', 'Base meana', 'Fold change', 'Adjusted P-Value')	1
('Unnamed: 0', 'mTMEM16F dig, +Ca2+ (EMDB 4611, PDBID 6QP6)', 'mTMEM16F dig, -Ca2+ (EMDB 4612, PDBID 6QPB)', 'mTMEM16F 2N2, +Ca2+ (EMDB 4613, PDBID 6QPC)', 'mTMEM16F 2N2, -Ca2+ (EMDB 4614, PDBID 6QPI)')	1
('Unnamed: 0', 'nhTMEM16, DDM, +Ca2+ (EMDB-4588, PDB 6QM5)', 'nhTMEM16, DDM, -Ca2+ (EMDB-4589, PDB 6QM6)', 'nhTMEM16, 2N2, -Ca2+ (EMDB-4587, PDB 6QM4)')	1
('Unnamed: 0', 'nhTMEM16, 2N2, +Ca2+open (EMDB-4592, PDB 6QM9)', 'nhTMEM16, 2N2, +Ca2+intermediate closed (EMDB-4593, PDB 6QMA)', 'nhTMEM16, 2N2, +Ca2+closed (EMDB-4594, PDB 6QMB)')	1
('Experiment 1 (Figure 2—figure supplement 5)', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12', 'Unnamed: 13', 'Unnamed: 14')	1
('Exponent', 'KPZ', 'This study (ρ\u2004=\u20040)', 'qEW', 'This study (ρ\u2004=\u2004ρc)')	1
('Unnamed: 0', 'Wake (n\xa0=\xa071 recordings)', 'REM (n\xa0=\xa064 recordings)', 'Unnamed: 3', 'Unnamed: 4')	1
('Characteristics', 'Groups', 'Patients', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('Regrouping factors', 'Group', 'Sample size', 'Kaplan–Meier P-value', 'AUC', '95% CI of AUC')	1
('Unnamed: 0', 'MCL1 copy number', 'Mcl1:BclxL protein ratio', 'MCL1i GI50 (μM)', 'MCL1i caspase EC50 (μM)', 'CDK9i caspase EC50 (μM)')	1
('Evans blue drainage', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5')	1
('Mixed model ANOVA vehicle vs. ZnSO4 treated', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Sequence (5ʹ → 3ʹ)', 'Description')	1
('Complex', 'H. sapiens', 'S. cerevisiae', 'S. pombe')	1
('Symbol', 'Definition', 'Typical values for influenza', 'Range in simulations')	1
('Datasets:', 'High-resolution (remote)', 'Se SAD phasing (peak)')	1
('Unnamed: 0', 'Unnamed: 1', '[FAD•− TrpH•+]', '[FAD•−Z•]')	1
('Resource type', 'Designation', 'Source or reference', 'Identifiers')	1
('Peptide', 'HPLC column', 'Flow rate', 'Gradient')	1
('Unnamed: 0', 'Baseline n**\xa0=\xa01794 (100%)', 'Follow-up 1 n\xa0=\xa01439 (100%)', 'Follow-up 2 n\xa0=\xa01284 (100%)')	1
('Unnamed: 0', 'Intercept', 'Slope', 'Unnamed: 3', 'Unnamed: 4')	1
('Parameter', 'Figure', 'Factor 1', 'Factor 2', 'Interaction')	1
('Parameter', 'Figure', 'T or U, df')	1
('sgRNA', '*Specificity\xa0score', '& mismatches (MMs) between sgRNA and gene locus', 'Gene', 'Unnamed: 4', '# Off-target score', 'Locus')	1
('IDT prime time qPCR probe assay', 'Transcript', "Forward 5'−3'", "Reverse 5'−3'", "Probe 5'−3'", 'Amplicon (bp)', 'Accession no.', 'Location')	1
('Figure 1a, b', 'Control', 'KERKO', 'Unnamed: 3')	1
('Covariates', 'Unnamed: 1', 'Mean/percent', 'Standard deviation/ count')	1
('Reagent type (species)', 'Designation', 'Source/reference', 'Identifiers', 'Additional information')	1
('Region', 'X', 'Y', 'Z', 't-value', 'K')	1
('Unnamed: 0', 'Non-cooperative', 'Cooperative')	1
('Unnamed: 0', 'T4Lys-Gmet_1914', 'T4Lys-Gmet_1914 (S Anomalous)')	1
('Unnamed: 0', 'Fusion plates identified', 'Unnamed: 2', 'Unnamed: 3')	1
('HH stage', 'Mean total OFM length (mm)', '± SD', 'Mean length of fused seam (mm)', '± SD.1')	1
('ENSEMBL\xa0ID', 'HGNC\xa0ID', 'LogFC: Fissure vs whole (HH.St25-27)~E5', 'FDR adjusted P value', 'LogFC: Fissure vs whole (HH.St27-28)~E6', 'FDR adjusted P value.1', 'LogFC: Fissure vs whole (HH.St28-30)~E7', 'FDR adjusted P value.2')	1
('Parameter', 'Df', 'Estimate\xa0±\xa0SE', 'p-value', 'F value', 'Deviance explained')	1
('Name', 'Description', 'Vector-Promoter', 'Addgene')	1
('Bodyweight (BW)', 'Offered water [ml]')	1
('Primer for', "Sequence 5'−3’ sense", 'Sequence 5’−3’ antisense')	1
('Strain name', 'Genotype')	1
('Element', 'Length', 'Element.1', 'Length.1')	1
('Specimen', 'PI-1/Ulna', 'Piii-1/PI-1', 'Pii-1/PI-1', 'Pii-2/PI-1', 'Digit I/Digit II', 'UI/Ulna', 'Uii/PII-1', 'PIII-2/Ulna', 'Piii-2/PIII-1')	1
('Protein:RNA', 'PUF-8: PBE', 'FBF-2 SS/Y: PBE', 'FBF-2 AS/Y: PBE', 'FBF-2 AQ/Y: PBE', 'Unnamed: 5')	1
('Protein', 'RNA', 'RNA sequence', 'Kd (nM)', 'Krel*')	1
('Genotype', 'RNAi', 'Wild-type', 'Complete tumorous', 'N')	1
('Animal', 'Slice #', '# tdTomato+', '# GAD67+', '# co-labeled', '% tdTomato+co-labeled')	1
('ICc', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4')	1
('Location', 'X\xa0coordinate\xa0(caudal)', 'Y\xa0coordinate\xa0(lateral)', 'Z\xa0coordinates\xa0(depth)')	1
('FP', 'vmPFC', 'dmPFC', 'OFC', 'vlPFC', 'dlPFC', 'FEF', 'Premotor')	1
('Site', '# areas contributing 50% inputs', 'Regions contributing 50% inputs', '# areas contributing 75% inputs', 'Regions contributing additional 25% inputs')	1
('Petri dish', 'Bee with egg', 'Bee without egg', 'Control')	1
('Comparison', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3')	1
('Line', 'Neuroblast', 'Lineages')	1
('Unnamed: 0', 'GIN\xa0+\xa0X94', 'GIN\xa0+\xa0X94+classified SST-TdT', 'All SST-TdT', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('Unnamed: 0', 'SST-TdT', 'GIN', 'X94', 'X98')	1
('β-actin peptide', 'SETD3 (aa\xa02–502)', 'Stoichiometric coefficient (N)', 'Kd (µM)')	1
('Unnamed: 0', 'SETD3–β-actin', 'SETD3-methylated β-actin')	1
('SETD3', 'Substrate', 'Unnamed: 2', 'Kinetic parameters', 'Unnamed: 4', 'Unnamed: 5')	1
('Reagent type (species) or resource', 'Designation', 'Souce or reference', 'Identifiers', 'Additional information')	1
('Cell type', 'Antibody', 'Fluorophore', 'Clone', 'Vendor', 'Dilution')	1
('Binding species', 'KD(nM)*', 'ΔH (kCal/mol)', 'ΔS (Cal/mol.K)', 'ΔG (kCal/mol)', 'Imp9 concentration correction factor')	1
('Petiole*', '1', '2', '3', '4', '5', '7', '9', '10', '11', '12', '13', '14', '15', '16', '18', '40', '41', '42', '43')	1
('Reagent type or resource', 'Designation', 'Source/reference', 'Identifiers', 'Additional information')	1
('Marker', 'Gene name', 'Gene ID', 'Length', 'M-rpkm', 'P-rpkm', 'Log2ratio(P/M)', 'Regulation(P/M)', 'p-value')	1
('Gene name', 'Gene ID', 'Length', 'M-rpkm', 'P-rpkm', 'Log2ratio (M/P)', 'Regulation (M/P)', 'p-value')	1
('Unnamed: 0', '4 R-s', '4 R-t', '4 R-j', '3R')	1
('Line', 'TM (%)', 'TF', 'WM (%)', 'WF (%)', 'Total progeny', 'Unnamed: 6')	1
('Transgenic line', 'Genotype', '42 hr PO', '50 hr PO', '58 hr PO', '66 hr PO', '70 hr PO', '82 hr PO', 'Adults (%)')	1
('Sample*', 'Chromosome X', 'Autosomes', 'P value†')	1
('Primers', 'Unnamed: 1', "Sequence 5'−3'")	1
('Unnamed: 0', 'CDMD', 'Phenix', 'Rosetta', 'Refmac', 'CDMD (TM domain)')	1
('Unnamed: 0', 'CDMD', 'MDFF (restraints)', 'MDFF (no restraints)')	1
('System', 'Resolution, Å', 'EMDB', 'Deposited PDB', 'Method', 'Citation')	1
('System', 'D (×106)', 'N (×106)', 'W (ns/d)', 'S (ns/d)', 'TS\xa0(days, short)', 'TS (days, long)')	1
('Term', 'Definition', 'Context', 'Number of PubMed records', 'Year of first appearance')	1
('Preposition', 'Term', 'Possible definition/interpretation')	1
('Marker', 'Liu', 'Klein', 'ATCC', 'Van bokhoven', 'DSMZ')	1
('A08a inputs (hemisegment)', 'Pre-synapse number', 'A08a arbor targeted', 'Unnamed: 3')	1
('Genotypes', 'Figure')	1
('Primary antibody (concentration)', 'Source', 'Figure')	1
('Secondary antibody (concentration)', 'Source', 'Figure')	1
('Voxel size', 'Excitation wavelength (laser power)', 'Detection wavelength', 'Pinhole size (AU)', 'Figure')	1
('Unnamed: 0', 'Parents with loss', 'Parents without loss', 'P for difference')	1
('Unnamed: 0', 'Overall', 'Women', 'Men', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Healthy cohort', 'n_discovery\xa0=\xa070% n_total', 'n_discovery\xa0=\xa050% n_total', 'n_discovery\xa0=\xa030% n_total', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Name', 'Estimated MW (KD)', 'Periodicity', 'Location')	1
('A. Measurement of Twist Angle at A-C Linker', 'Unnamed: 1')	1
('B. Measurement of Twist Angle at A-C Linker', 'Unnamed: 1')	1
('Structure', 'Number of subtomogram', 'Resolution (Å)', 'Description', 'EMDB ID #')	1
('Cluster size', 'Region', 'Peak MNI (x,y,z)', 'Peak EP', 'Beta', 'BF10', 'Unnamed: 6', 'Unnamed: 7')	1
('Unnamed: 0', 'Cortex', 'Liver', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Unnamed: 0', 'WT', 'KO', 'Statistics (Two-way ANOVA)', 'Unnamed: 4', 'Unnamed: 5')	1
('Unnamed: 0', 'WT', 'KO', 't-test, df\xa0=\xa034')	1
('TPF during BL', 'WT', 'KO')	1
('GeneName', 'FwdPrimer', 'RevPrimer', 'Probe')	1
('Racine score', 'N', '0', '1', '2', '3', '4', '5', 'Behavioral arrest')	1
('Genotype', 'N', 'Weight', 'Induced seizure (%)')	1
('Reagent type', 'Designation', 'Source or reference', 'Identifiers', 'Adtl. info')	1
('Gene name', 'Probe cat no.', 'Target region')	1
('Gene', 'Expression', 'Method', 'Functional Assay', 'References')	1
('Gene', 'Log2 FC', 'P value')	1
('mAb', 'Number of clones sequenced', 'Number of clones with aberrant chain', '% with aberrant chain')	1
('Antibody', 'Immunogen', 'Manufacturer information', 'Concentration/dilution used', 'Figures')	1
('Unnamed: 0', 'Edagtliazone (+\xa0C9)')	1
('Unnamed: 0', 'GW9662 (+\xa0C9)', 'SR16832 (+\xa0C9)')	1
('Unnamed: 0', 'Arachidonic acid', 'Oleic acid', 'GW9662 +\xa0Arachidonic acid', 'GW9662 +\xa0Oleic acid', 'Rosiglitazone +\xa0Oleic acid')	1
('Ligand', 'log Ka', 'Kd (μM)', 'ΔG (kcal mol−1)', 'ΔH (kcal mol−1)', 'TΔs (kcal mol−1)', 'n (from two replicates)')	1
('Child Characteristics', 'Campaign States (n\xa0=\xa01,195)', 'Non-campaign States (n\xa0=\xa0443)', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Big States in India', 'AARR (95% CI)')	1
('Unnamed: 0', 'Change in slope before campaign launch', 'Change in slope after campaign launch', 'Adjusted change in level', 'Adjusted change in slope', 'P-value of adjusted change in slope')	1
('Unnamed: 0', 'Expected 2013 rate per 1,000 live births', 'Observed 2013 rate per 1,000 live births', 'Deaths without intervention, 2010–2013 (000 s)', 'Deaths averted, 2010- 2013 (000s)', 'Percent averted (%)')	1
('Disease', 'ICD-10 code range')	1
('N\xa0=\xa026,505', 'Model 1', 'Model 2', 'Model 3', 'Model 4', 'Model 5', 'Model 6')	1
('Ratio\xa0vs.\xa0Col-0', 'P-value', 'Unique peptides', 'Gene', 'Name', 'Stickiness')	1
('Gene', 'Description')	1
('Unnamed: 0', 'Pol I (core) EC\xa0+\xa0GMPCPP', 'Pol I EC\xa0+\xa0GMPCPP', 'Pol I* EC\xa0+\xa0GMPCPP', 'Apo Pol I*')	1
('Treatment', 'T levels (pg/ml)', 'Significance*')	1
('Transgenic line', 'Total number of embryos', 'Transgenic embryos phenotypically wild type', 'Non-transgenic embryos phenotypically wild type', 'Embryos phenotypically cdh1 mutant')	1
('FP-Tagged protein', 'Promoter expressing zGrad', 'Percent reduction', 'Degradation half-life in min', 'Time for onset of degradation in min')	1
('Label', 'Size (voxels)', 'T', 'X', 'Y', 'Z')	1
('Name', 'Genotype', 'Figures', 'Reference')	1
('Name', 'Flycircuit ID', 'Figure in Lin et al., 2013')	1
('Target', 'Oligonucleotide (5’ to 3’)')	1
('Gene', 'Plasmid ID', 'Construct')	1
('#', 'Sex', 'Age', 'Tumor stage and grade', 'Tissue source', 'Intravesical therapy', 'Neoadjuvant chemotheraphy', 'Recurrence')	1
('#', 'Sex', 'Age', 'Tumor stage and grade', 'Tissue source', 'Intravesical therapy', 'Neoadjuvant chemotheraphy', 'Recurrence', 'Death')	1
('Target species', 'Primer name', 'Forward sequence (5’-3’)', 'Reverse sequence (5’-3)')	1
('Target species', 'shRNA', 'Target sequence', 'Sense', 'Antisense')	1
('Gene name', 'Peak score', 'Distance to TSS', 'Annotation', 'BH.Q', 'Adj.p', 'Phase', 'AMP')	1
('Unnamed: 0', '25th percentile', '50th percentile (median)', '75th percentile')	1
('Patient', 'UPDRS score', 'PD subtype', 'Demographics', 'Burrhole placement (cm)', 'Selected bipolar contact (1-3)', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10')	1
('Reagent, type (species) or resource', 'Designation', 'Source or reference', 'Identifiers', 'Additional Information')	1
('Unnamed: 0', 'Unnamed: 1', 'Truth', 'MSV', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12', 'Unnamed: 13', 'Unnamed: 14', 'Unnamed: 15', 'Unnamed: 16')	1
('Parameter', 'R191H phenotype', 'Effect of 2BAct')	1
('Antibodies', 'Host', 'Dilution', 'Source/Catalog number/RRID number')	1
('Unnamed: 0', 'NLuc\xa0intensity', 'Basal BRET\xa0ratio', 'ΔBRET ratio')	1
('Reaction', 'Forward-rate', 'Backward-rate', 'Note')	1
('Algorithm', 'Statistics', 'Unnamed: 2', 'Partial occlusion angles', 'Unnamed: 4', 'Unnamed: 5')	1
('Combination', 'Difference in location', '95% CI')	1
('Protein', 'W', 'Difference in location', '95% CI', 'p-value')	1
('Model', 'Slope (β)', 'Std.error (σβ̂2)', 't-value', 'p-value', 'RSE', '% Error', 'R2')	1
('Model', 'Slope (β )', 'Std.error\xa0(σβ̂2)', 't-value', 'p-value', 'RSE', 'R-squared')	1
('Protein', 'W', 'Difference in location', '95%', 'p-value')	1
('Model', 'Slope (β)', 'Std.error(σβ̂2)', 't-value', 'p-value', 'RSE', 'R-squared')	1
('PSE comparisons', 'Original p – value', 'Corrected p-value')	1
('PSE comparisons for [100 ms, 0 ms]', 'Original p – value', 'Corrected p-value')	1
('Comparisons', 'Estimate', 'Inferior CI', 'Superior CI')	1
('Reagent type (species) or resource', 'Designation', 'Source or reference', 'Identifiers', 'Additional information/ reagent source')	1
('Unnamed: 0', 'Serum obtained (N\xa0=\xa05,866)', 'Seropositive (N\xa0=\xa01,403)', 'Seronegative (N\xa0=\xa04,463)')	1
('Unnamed: 0', 'Unadjusted', 'Multivariable')	1
('Purpose', 'Primer name', "Sequence (5'−3')")	1
('Chr', 'First coordinate', 'Last coordinate', 'Potential oligo sequences', 'Potential oligo sequences/kb', 'Oligo sequences chosen', 'Oligo sequences chosen/kb', 'Average distance between oligos (bp)', 'Standard deviation of distance between oligos (bp)')	1
('Total Sleep Time (%)', 'Wild Type', 'Shank3ΔC', 'p-value')	1
('Shank3ΔC vs. Wild Type', 'Unnamed: 1')	1
('Unnamed: 0', 'Wild Type', 'Unnamed: 2', 'Shank3∆C')	1
('Antigen', 'Species', 'Concentration', 'Supplier')	1
('Unnamed: 0', 'gNa', 'gCaT', 'gCaS', 'gA', 'gKCa', 'gKd', 'gH', 'gL', 'τCa', 'E(g)')	1
('LHE pattern', 'Lead SNP', 'Chromosome', 'Position (hg19)', 'EAF', 'Effect allele', 'P value meta', 'Effect meta', 'SE effect meta')	1
('GWAS', 'SNP', 'CHR', 'POS', 'Tissue', 'GENE')	1
('Unnamed: 0', 'Variables', 'Swarms', 'Biofilms')	1
('Variable', 'Description', 'Numerical value')	1
('No', 'Reference', '$V = \\frac{dR}{dt}$ μms-1 (exp)', 'W μm (exp)', 'α2 (model)', 'g0 s-1 (model)', 'L μm (model)', 'Ca ×\xa010-7 (model)')	1
('Construct', 'Sequence', 'Notes')	1
('Experiment', 'His8-pLAT', 'His10- Ezrin (ABD)', 'Grb2', 'Sos1', 'pSLP-76', 'Nck', 'N-wasp', 'WASP', 'Actin', 'Myosin II', 'KCl', 'ATP')	1
('Unnamed: 0', 'All lines (n\xa0=\xa0264)', 'Unnamed: 2', 'Mapped (n\xa0=\xa0171)', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('Set', 'Clone', 'Status', 'Burkholderia', 'Location collected', 'Date collected', 'GPS coordinates')	1
('NR', 'neural retina')	1
('Description', 'Parameter', 'Value', 'Reference/Explanation')	1
('Unnamed: 0', 'LRRC8A-MSP1E3D1\xa0+\xa0DCPIB', 'LRRC8A-MSP2N2', 'Unnamed: 3')	1
('Data collection', 'Digitonin 70 mM KCl', 'Digitonin 150 mM KCl', 'Digitonin 600 mM KCl')	1
('Unnamed: 0', 'Pkd2fl/fl', 'Pkd2 smKO')	1
('Unnamed: 0', 'Heel samples (n\xa0=\xa0487)', 'Cord samples (n\xa0=\xa01036)', 'Paired heel and cord samples (n\xa0=\xa0454 pairs)')	1
('Unnamed: 0', 'Unnamed: 1', 'Heel prick samples', 'Cord blood samples', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9')	1
('Unnamed: 0', 'AUC\xa0(lower, upper 95% confidence limits),', 'Unnamed: 2', 'Unnamed: 3')	1
('Symbol', 'Definition', 'Value', 'Units', 'References')	1
('Reagent type (species) or resource', 'Designation', 'Source or reference', 'RRID identifiers')	1
('HCV genotype', 'All', '1a', '1b', '2a', '2b', '3a', '4a', 'Others')	1
('HCV gene', 'Position (amino acid)', 'Genotype 1a N\xa0=\xa03548', 'Genotype 1b N\xa0=\xa01924', 'Genotype 2a N\xa0=\xa0304', 'Genotype 2b N\xa0=\xa0472', 'Genotype 3a N\xa0=\xa01839', 'Genotype 4a N\xa0=\xa0193')	1
('Unnamed: 0', 'RT', 'RTcv', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Species', '‘Candidatus Finniella inopinata’', 'Stachyamoeba-associated rickettsialean', 'Peranema-associated rickettsialean')	1
('Unnamed: 0', 'β0', 'β1', 'β2', 'β3')	1
('Gene ontology categories', 'Growth dependent', 'Growth independent')	1
('Protein complex', 'Molecules per cell', 'Method', 'Stoichiometry', 'Reference')	1
('Plasmid', 'Expressed protein', 'Backbone', 'Description')	1
('Resolution', 'Fitness model', 'Waning', 'RMSE', 'Pearson R2', 'Accuracy')	1
('Model', 'Antigenic resolution', 'vaAnd pb', 'RMSE', 'Pearson R2')	1
('Parameter', 'Input value', 'Optimized value')	1
('Parameter', 'Unit', 'Description')	1
('Parameter [unit]', 'Best-fit value', 'Lower bound', 'Upper bound')	1
('Unnamed: 0', 'Net displacement (μm)', 'Travel displacement (μm)', 'Straightness', 'Mean speed (μm/min)', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9')	1
('Unnamed: 0', 'Volume (μm3)', 'Surface (μm2)', 'Long/short axis', 'Unnamed: 4', 'Filopodia/cell', 'Filopodia length (μm)', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12')	1
('Reagent type (species) or resource', 'Designation', 'Source or reference', 'Identifiers', 'Protocol')	1
('Variables & parameters', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3')	1
('Unnamed: 0', 'Unnamed: 1', '# stimulus sig.', '# choice sig.', 'Total #')	1
('Complex', 'Se-DinG-DNA', 'DinG-DNA', 'DinG-DNA-ADPBeF3', 'Unnamed: 4')	1
('MicroCT femur, P14', 'Bmp2Flox/Flox', 'Bmp2Flox/Flox; Col1a1-Cre')	1
('MicroCT femur, P14', 'Bmp2Flox/Flox', 'Bmp2Flox/Flox; Prx1-Cre')	1
('MicroCT femur, four wk', 'Bmp2Flox/Flox', 'Bmp2Flox/Flox; Prx1-Cre', 'Unnamed: 3', 'Unnamed: 4')	1
('MicroCT Femur, 10 wk', 'Bmp2Flox/Flox', 'Bmp2Flox/Flox; Prx1-Cre', 'Unnamed: 3', 'Unnamed: 4')	1
('Variant', 'Gene', 'Functional Prediction', 'HGVS amino acid', 'Phenotype', 'Odds Ratio (CI)', 'P- Value', 'MAF')	1
('[M\xa0+\xa0H]+', 'WT', 'V-4K', 'V-4T', 'V-4D', 'E-6A', 'E-6K', 'E-6D')	1
('Unnamed: 0', 'LahT-inhibitor 1 complex', 'PCMBS')	1
('Primer Name', 'Sequence\xa05’−3’')	1
('Primer name', "Sequence 5'−3'")	1
('Primer or synthetic gene name', 'Sequence (5’−3’)')	1
('Selection window size', 'InterRBC-PO2 (mmHg)', 'EATs (mmHg)')	1
('Parameters', 'Depth', 'Numbers of samples/mice', 'Unnamed: 3', 'Unnamed: 4')	1
('Resource', 'Designation.', 'Source.', 'Identifiers.', 'Additional information')	1
('Surface modification', 'Size [nm]\xa0±\xa0SD', 'PDI\xa0±\xa0SD', 'Zeta potential [mV]\xa0±\xa0SD')	1
('1H nuclei†', 'preacinetobactin‡', 'Acinetobactin')	1
('Unnamed: 0', 'Semet 6H7V', 'Apo 6HCP', 'Complex 6H7F')	1
('Unnamed: 0', 'Unnamed: 1', 'First sample', 'Second sample', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('Unnamed: 0', 'Unnamed: 1', 'Relative accuracy', 'Subjective difficulty', 'BPQ', 'Positive PANAS', 'HAMA', 'BDI')	1
('Unnamed: 0', 'Unnamed: 1', 'Accuracy', 'dʹ', 'Unnamed: 4', 'Unnamed: 5')	1
('Unnamed: 0', 'Lesion laterality', 'Lesion size (ml)', 'Chronicity (months)', 'Age (years)', 'Gender', 'Education (years)', 'MMSE', 'BDI')	1
('Name', 'Size (nt)', 'Visual summary', 'Description')	1
('Oligonucleotide name', 'Oligonucleotide sequence (5′→3′)')	1
('Strain ID', 'Genotype', 'Source')	1
('Unnamed: 0', 'Typically developing (TD)', 'Autism spectrum disorder (ASD)', 'P value')	1
('Unnamed: 0', 'Unnamed: 1', 'Coordinates', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Unnamed: 0', 'Unnamed: 1', 'Number in category', 'Number sampled', 'Percent sampled', 'Number with documents')	1
('Isotropic scaling', 'Unnamed: 1')	1
('Resolution Å (last shell)', '37.54 Å - 2.13 Å (2.16 Å - 2.13 Å)')	1
('Unnamed: 0', 'MMS (0%)', 'MMS (0.04%)', 'MMS (0.08%)', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Strain name', 'Genotype', 'Relevant DNA on array or single copy transgene')	1
('Gene', 'Gene coordinates', 'Variant position', 'Variant type', 'Allelic variants', 'Amino acid exchange', 'Effect of sequence variant', 'PROVEAN score', 'Unnamed: 8', 'Unnamed: 9')	1
('Strain', 'Presence of deletion', 'Strain.1', 'Presence of deletion.1')	1
('Gene', 'Start (bp position)', 'End (bp position)', 'ID', 'P(DeSeq2)', 'P(Cuffdiff)', 'Straina')	1
('Patient-specific features', 'Values‡')	1
('Gene locus', 'Annotation', 'hapR merodiploid/haploid')	1
('Rk', 'Chr', 'Span (Mbp)', 'Peak', 'Core (kbp)', 'TAD (kbp)', 'Genes', '∆q', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11')	1
('Tissue', 'Peak SNP', 'MT gene', 'Missense mutation', 'Mediation (Mitochondrial Gene)', 'Mediation (other nuclear gene)')	1
('Tissue', 'Peak nuclear SNP', 'Chr', 'Position', 'A1', 'MAF', 'MT gene', 'P value', 'P value (FDR corrected)', 'P value (Point-wise Permutation)', 'Beta', 'Replication P value', 'Replication beta', 'Nuclear gene annotation', 'Nuclear SNP annotation')	1
('Parameter', 'Baseline', 'Sensitivity Analysis')	1
('Compound', 'Hive 1', 'Hive 2', 'SCC 1 week', 'SCC 3 weeks', 'Undertaker', '‘Big-back’')	1
('Gene', 'Function', 'BLAST E-value (D. melanogaster gene)', 'Forward primer', 'Reverse primer', 'Previously published')	1
('Gene', 'Day 1', 'Day 7', 'Day 14', 'Forager', 'FDR adjusted p-value Age', 'Fostered', 'FDR adjusted p-value Hive')	1
('Behavior', 'β (SE)', 'T value', 'Adjusted P', 'Classification')	1
('Gene', 'Whole-cell/Poke', 'Cell-attached/Stretch', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
(0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11)	1
('Expt.', 'Age', '#\xa0of\xa0Animals', 'Mean\xa0Weight\xa0(g)', '#\xa0of\xa0Neurons', 'Neuronal Classification', 'Unnamed: 6', 'Mean # of Twitches', 'Mean # of Wake Movements', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12')	1
('Unnamed: 0', 'Mean total subfield volumes (mm3), SEM and SD', 'Unnamed: 2')	1
('Model', 'Model description', 'Parameters')	1
('Dataset', 'N genes', 'm1a vs m2a', 'm2a vs m2a_fixed', 'm7 vs m8', 'm8 vs m8a', 'All PAML', 'Busted', 'All PAML\xa0+\xa0BUSTED')	1
('Pathogen', 'Transcriptional response', 'N genes diff. expressed in both lineages', 'N genes expected by chance', 'p-value', 'Odds ratio (95% conf. intervals)')	1
('Pathogen', 'Transcriptional response', 'N genes', 'Predictor variable', 'Estimate', 'Standard error', 'Z score', 'p-value')	1
('Gene', 'F primer', 'R primer')	1
('Residues', 'Sequence', 'Name', 'Strategy')	1
('Q-PCR primer', "Sequence (5' -->3')")	1
('SNARE or SM', 'Mutation or truncation', 'Unfolding energy (kBT)', 'Equilibrium force* (pN)', 'Folding rate (s−1)', 'Unfolding rate (s−1)', 'Partially closed syntaxin†', 'Template formation', 'Unnamed: 8', 'SNAP-25 binding', 'Unnamed: 10', 'Unnamed: 11')	1
('Primer pair', 'Plasmid', 'Method', 'FORWARD 5’ sequence', 'REVERSE 3’ sequence')	1
('Antigen', 'Species', 'Designation/clone', 'Catalogue number', 'Supplier/Source', 'Application')	1
('PDB\xa0ID', '6EDQ')	1
('Amplitude vs. Distance', 'Apparent Erev vs. Distance', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9')	1
('Neuron', 'Sites', 'Branches', 'Mean Erev (mV)', 'SD (mV)', 'CV')	1
('Lobe', 'Region at peak', 'ALC vs. NC', 'ALCW vs. NCW', 'ALCM vs. NCM', 'Interaction')	1
('Measure', 'ALCW N\xa0=\xa025', 'ALCM N\xa0=\xa017', 'NCW N\xa0=\xa024', 'NCM N\xa0=\xa022', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12')	1
('Measure', 'ALCW N\xa0=\xa025', 'Unnamed: 2', 'Unnamed: 3', 'ALCM N\xa0=\xa017', 'Unnamed: 5', 'Unnamed: 6', 'NCW N\xa0=\xa024', 'Unnamed: 8', 'Unnamed: 9', 'NCM N\xa0=\xa022', 'Unnamed: 11', 'Unnamed: 12')	1
('Structure', 'Max', 'VtxMax', 'Size (mm2)', 'X', 'Y', 'Z', 'CWP', 'CWPLow', 'CWPHi', 'NVtxs', 'Contrast', 'Comparison')	1
('Structure', 'Max', 'VtxMax', 'Size (mm2)', 'X', 'Y', 'Z', 'CWP', 'CWPLow', 'CWPHi', 'NVtxs', 'Contrast')	1
('Structure', 'Size (mm3)', 'X', 'Y', 'Z', 'CWP', 'Max', 'Comparison', 'Contrast')	1
('Structure', 'Max', 'VtxMax', 'Size (mm2)', 'X', 'Y', 'Z', 'CWP', 'CWPLow', 'CWPHi', 'NVtxs', 'Comparison', 'Contrast')	1
('Patient number', 'IQ', 'Age', 'Diagnosis', 'Gender', 'Antiepileptic drugs')	1
('Reagent or Resource', 'Designation', 'Source of Reference', 'Identifiers', 'Additional Information')	1
('Dimensionality', 'One-Dimensional', 'Ten-Dimensional', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Testing Pairs/Methods', 'Mgc', 'Dcorr', 'Mcorr', 'Hhg', 'Hsic')	1
('Unnamed: 0', 'Testing pairs / Methods', 'Mgc', 'Mantel', 'Dcorr', 'Mcorr', 'Hhg')	1
('method', 'Top four identified peptides', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4')	1
('Data', 'Personality', 'Creativity', 'Screening')	1
('Simulation ID', 'Bilayer composition', 'Duration', 'Initial position (nm) / orientation*', 'Time fraction (%) showing PD-bilayer binding†', 'Time fraction (%) showing C2-bilayer binding†', 'Time fraction (%) showing the productive orientation†,‡')	1
('G214C-TMRM', 'Ratio (%)', 'V1/2 (mV)', 'N', 'Unnamed: 4')	1
('K555Anap', 'A (%)', 'V1/2 (mV)', 'N', 'Unnamed: 4')	1
('Primer name (for RNA)', 'Primer sequence')	1
('Primer name (for ChIP)', 'Primer sequence')	1
('Unnamed: 0', 'Unnamed: 1', 'Unnamed: 2', 'Control', 'Unnamed: 4', 'Unnamed: 5', 'Dab1-/-', 'Unnamed: 7')	1
('Experiment', 'HiRIEF pH range', 'Depleted plasma (mg)', '# PSM', '# Peptides', '# Proteins')	1
('Unnamed: 0', 'MUP assay EC50 (μM)', 'DHE assay EC50 (μM)', 'Unnamed: 3', 'Unnamed: 4')	1
('Unnamed: 0', 'Fold activation', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Variant', 'kon (s−1 μM−1)', 'koff (s−1)', 'Kd (μM)')	1
('Data collection', '∆N∆C-IDFP·1\xa0Complex (PDB entry 6MVD)')	1
('Unnamed: 0', 'EC50 (μM)', 'Unnamed: 2', 'Unnamed: 3')	1
('Channel', 'Parameters')	1
('Strain', '% cells in rosettes', 'Cell interactions', 'Successful outcross?')	1
('Drive', 'Male drive conversion efficiency', 'Female drive conversion efficiency', 'Embryo r2 resistance rate')	1
('Type', 'Location', 'Timescale', 'Ref/Notes')	1
('Symbol', 'Parameter', 'Value', 'Reference/Notes')	1
('Reagent type (species) or resource', 'Designation', 'Source or reference', 'Catalogue no.', 'Additional information')	1
('Name', 'LQ', 'N', 'SEM')	1
('Target gene name', 'TRiP ID', '# of embryos')	1
('Reporter contructs', '# of embryos')	1
('Species', 'ECV (mL)', 'Sample size', 'Female body mass (kg)', 'Sample size.1')	1
('Brain trait', 'Value', 'Source', 'Notes', 'Dataset')	1
('Model parameter', 'Prior distribution')	1
('Species/Clade', 'Exceptional trait', 'Evidence')	1
('Normal', 'dsCtr', 'dsAgo2', 'dsAgo3', 'dsPiwi4')	1
('Beta', 'dsCtr-B', 'dsAgo2-B', 'dsAgo3-B', 'dsPiwi4-B')	1
(0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17)	1
(0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24)	1
('Candidate STAT3 activators that predicted to be miR-122 targets in CLIP-seq data', 'Unnamed: 1')	1
('Brain region', 'Cue-Evoked responses', 'Non-Evoked', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('Brain region', 'Cue-Evoked responses', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12')	1
('Brain region', 'Non-Evo', 'All', 'Phasic', 'Inactive', 'Active', 'Coh-Inac', 'Coh-Act', 'All-Tonic', 'All-Coh')	1
('Brain region', 'All', 'Phasic', 'Inactive', 'Active', 'Coh-Inac', 'Coh-Act', 'All-Tonic', 'All-Coh')	1
('Peptide', 'Protein 1', 'Residue 1', 'Protein 2', 'Residue 2', 'Consistency with BP EM model')	1
('Sample condition', 'Measured Mass\xa0±\xa0SD (Da)*', 'Assemblies', 'Expected mass (Da)†', '∆ mass (Da)', '% Mass Error', 'Unnamed: 6', 'Unnamed: 7')	1
('Protein', 'Purification step', 'Buffer')	1
('Unnamed: 0', 'Inward-open apo (Patch mutant\xa0+\xa0Fab)', 'Inward-occluded apo (G45R)', 'Outward-open Mn2+-bound (G223W ∆N34)', 'Outward-open apo (G223W ∆N34)')	1
('Unnamed: 0', 'Unexplained between ROI variability in MXF abundance', 'P value')	1
('Construct', 'Nucleotide', 'EC50 (μM)', 'h', 'n')	1
('Construct', 'Nucleotide', 'Emax', 'EC50 (μM)', 'h', 'n')	1
('SUR1 construct', 'Nucleotide', 'Drug', 't0.5 (s)', 'n')	1
('Construct', 'ANAP', 'pANAP', 'peRF1-E55D', 'Nucleotide', 'I/Icontrol', 'n')	1
('Construct', 'Nucleotide', 'IC50(μM)', 'h', 'n')	1
('Region', 'Functional group', 'Sequences in alignment', 'Alignment length (bp)', 'κ', 'δ', 'ν', 'R/θ', 'ρ/θ', 'R/m')	1
('Gene', 'Product', 'Unifrac', 'P-test')	1
('Unnamed: 0', 'Unnamed: 1', 'Unnamed: 2', 'log-likelihood of site models for adaptive evolution', 'likelihood ratio test (LRT) statistic for model pairs (degrees of freedom)', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10')	1
('Unnamed: 0', 'Dpr1 IG1 + DIP-η IG1', 'Dpr11 IG1 + DIP-γ IG1-IG2', 'DIP-γ IG1-IG2')	1
('Unnamed: 0', 'DIP-η IG1 + DIP-η IG1', 'Dpr10 IG1 + DIP-α IG1')	1
('Fly strain', 'Source')	1
('Antibody', 'Concentration', 'Source')	1
('Covariate', 'AOR', 'p-Value')	1
('Village', 'Households', 'Population')	1
('i', '(binding label)\u2005−\u20051', '(unbinding label)\u2005−\u20051', 'κi')	1
('Figure 4 Western blots', 'Unnamed: 1', 'Unnamed: 2')	1
('11-16-2018 upb10∆(109-133) tests (Figure 6—figure supplement 1)', 'Unnamed: 1', 'Unnamed: 2')	1
('Parameter', 'Description', 'Range', 'Unit')	1
('Unnamed: 0', 'Inferred parameters and 95% CIs', 'Unnamed: 2', 'Unnamed: 3')	1
('Algorithm 1. IF–EAKF',)	1
('Unnamed: 0', 'β', 'I0', 'C0')	1
('Models', 'Type‡', 'Algorithm', 'Configuration', 'Use', 'Predictor')	1
('Unnamed: 0', 'Inter-operator percent match', 'Number of detected void space', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('Model', 'Training', 'Test', 'Recall', 'Precision', 'F score', 'Unnamed: 6', 'Unnamed: 7')	1
('Unnamed: 0', 'rc', 'Kc', 'rs', 'Ks')	1
('Unnamed: 0', 'N', 'A', 'D', 'Hs', 'τL', 'τS')	1
('Parameter(s)', 'Value', 'Description', 'Affected components')	1
('Primer (Bid mutant)', 'Sequence')	1
('Name', 'Function', 'Sequence of N-terminus (residues 1–50)')	1
('Country', 'Year', 'Location', 'PfPR', 'ss', '$\\overline{D}$ (s.e.)', '$\\overline{\\rho}$', '$\\overline{K_{e}}$', 'Reference')	1
('Index', 'IBD state', 'Unnamed: 2', 'Unnamed: 3')	1
('Country', 'Discarded', 'Retained', 'Fraction discarded')	1
('COI', 'Retained', 'Discarded', 'Fraction discarded')	1
('Unnamed: 0', 'Pearson correlation coefficient', 'Unnamed: 2')	1
('Trait', 'Effect', 'd.f.', 'Log ratio χ2', 'P')	1
('Trait', 'Genotype', 'Effect', '-log(P)', 'ω2')	1
('Gene', 'AA changing', 'Silent', 'ka/ks')	1
('Unnamed: 0', 'Unnamed: 1', '% Yeast', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('lncRNA mutant, deletion type', 'Ribosome Profiling, class', 'lncRNA transcript ID', 'Deletion size', 'Percent reduction', 'Embryonic phenotype', 'Viability and fertility', 'Neighboring genes', 'Selection criteria', 'Unnamed: 9')	1
('Site', 'P14 (n\xa0=\xa010)', 'P28 (n\xa0=\xa011)', 'P42 (n\xa0=\xa06)')	1
('Site', 'Vehicle (n\xa0=\xa07)', '0.735 mg/kg PVO (n\xa0=\xa04)', '1.47 mg/kg PVO (n\xa0=\xa05)')	1
('Reagent type (species) or recourse', 'Designation', 'Source or reference', 'Identifier', 'Additional information')	1
('Unnamed: 0', 'Proposed primary ACS (Nieduszynski et al., 2006)', 'Putative secondary ACS (this study)', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12', 'Unnamed: 13')	1
('Comparison', 'N', 'M', 'SEM', '95%', 'T', 'Df', 'P')	1
('Basic information', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('TF (% of indels)', 'Motifs')	1
('Protein', 'Designation', 'Source', 'Species', 'Dilution', 'synapto-somes', 'hipp. tissue')	1
('Reagent type', 'Designation', 'Source/ Reference', 'Identifiers', 'Additional information')	1
('Gene', 'Nucleotides', 'Sequence ID')	1
('Role', 'Participant', 'Initial endowment (MU)', 'Individual contribution (Ii)', 'Group pool (G)', 'Payment', 'Unnamed: 6', 'Unnamed: 7')	1
('Tissue type', 'Reported precision, R2', 'Age range of training set, months', 'Number of CpG sites in the model', 'Publication')	1
('(A)', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('(B)', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Name', 'Sequence', 'Experiment')	1
('Species', '# Recordings', '# Individuals', '# Displays (±1 SEM) per individual')	1
('Quantile (τ)', 'Golden-collared manakin', 'White-collared manakin', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Stimulation hz', 'Golden-collared manakin', 'White-collared manakin', 'Species comparison', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Position (bp)', 'n', 'Outliers', 'ΔGα (kcal/mol)', 'α', 't+/t− (Gaston)', 't+/t− (Ushida)')	1
('Unnamed: 0', 'Tonic release', 'Evoked EPSC', 'RRP', 'Pvr', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12')	1
('Genotype', 'Disorder', 'HWE proportions', 'Inclusion of population coefficient of consanguinity (F)')	1
('Unnamed: 0', 'Allele frequency data', 'Genetic diversity data', 'Overall')	1
('Country', 'Allele frequency range (%)', 'Unnamed: 2', 'Unnamed: 3')	1
('Group', 'Day 1', 'Day 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Group', 'Pre', 'Post', 'Post_DePo')	1
('Experiment', 'Species', 'Time to first binding measurement', 'Dwell time distribution fit parameters†', 'KD (nM)', 'Unnamed: 5', 'Unnamed: 6')	1
('Conditions', 'Active fraction', 'N†', 'kbkgnd (10−5 s−1)', 'kinit (10−4 s−1)', 'Avg kinit (10−4 s−1) (Fold inhibition)‡')	1
('Experimental conditions', 'Time to first binding measurement', 'Dwell time measurement', 'Unnamed: 3', 'Unnamed: 4')	1
('Unnamed: 0', 'k1 or k1′ (M−1s−1)†', 'k-1 or k-1′ (s−1)‡', 'k2 or k2′ (s−1)‡', 'k-2 or k-2′ (s−1) ‡')	1
('Simulation parameters', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Protein', 'Species', 'Dilution', 'Catalog no.', 'Vendor')	1
('Ribosomal complex', 'Resolution (Å)', 'Particles', '% of particles', 'EMDB accession code')	1
('Unnamed: 0', '80S • Z • P', '80S • Z • IFRD2', '80S • eEF2 • SERBP1 (head swivel)', '80S • eEF2 • SERBP1 (rotated)')	1
('Reagent type', 'Designation', 'Source of reference', 'Identifiers', 'Additional information')	1
('Unnamed: 0', 'N', 'n\xa0+\xa01', 'n\xa0+\xa01, dATP soak', 'n\xa0+\xa01, dAMPNPP soak', 'n\xa0+\xa02')	1
('Surface modification of PS particles', 'Zeta potential (mV)', 'Nanomoles PEG/mg particles')	1
('Sample', 'Fibersol-2', 'Pectin')	1
('Reagent type (species) or resource', 'Designation', 'Source or reference', 'Identifiers', 'Additional information [RRID]')	1
('Unnamed: 0', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Ascospores (random*/all)', 'Verified tetrads (mtIPO323/mtIPO94269)', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11')	1
('Marker', 'Localization (IPO323)', 'Localization (IPO94269)', 'Primer1', 'Primer 2', 'Product size in IPO323 [bp]', 'Product size in IPO94269 [bp]')	1
('Plasmid', 'PCR/digest', 'Restriction enzymes or primers sequences')	1
('Enhancer/reporter plasmid combinations', 'Abbreviation', 'Structures labelled (Figures) – [# embryos]')	1
('Subject', 'Hemisphere', 'V1 area (mm3)*', 'V1 volume (mm3)*', 'Anatomical RMSD†', 'Retinotopic RMSD†')	1
('Unnamed: 0', 'Term', 'Description', 'Form')	1
('Rab protein', 'Membrane associated', 'Localization', 'In vitro prenylated', 'In/at base of cilia', 'Rescue ciliation in knockout cells', 'Bind RILPL1 strongly')	1
('Pairwise DMS calls (mCG change)', 'MEF to 2d', '2d to 5d', '5d to 22d')	1
('Unnamed: 0', 'Tirf-sim', 'EM')	1
('Step', 'Description', 'Time')	1
('Mef2c/Islet1/Mesp1-derived muscles', 'Mesp1/Pax3-derived muscles', 'Pax3- derived muscles')	1
('Unnamed: 0', 'Tbx1-null', 'Pax3-null')	1
('Name/description', 'Sequence (5’−3’)', 'Experiment')	1
('Proposed measures', 'Biological interpretation', 'Biological application')	1
('Harmonic (N)', 'Predicted slope\xa0=\xa02/N', 'Measured slope', 'Measured intercept (ms)', 'R2', 'P', 'τint\xa0=\xa0Intercept*N/2')	1
('TAPBPR variant', 'Loop sequence')	1
('Primer name', 'Primer sequence 5ʹ−3ʹ')	1
('Primer name', "Primer sequence 5'−3'")	1
('Family ID', 'MSSNG Id', 'Status', 'Primary genetic variant(s)', 'Sex', 'Age at reprogramming (year)', 'Cell of origin', 'Reprogramming method', 'iPSC ID', 'Reference')	1
('Unnamed: 0', 'Data', 'Species', 'Injections', 'Anterograde tracer', 'Retrograde tracer', 'Connectivity matrix', 'Source')	1
('Unnamed: 0', 'Unnamed: 1', 'Whole brain', "'A3b'", "'A4ab'", "'Aua1'", "'V1'", "'V2'", "'Hipf'", "'Cd'", "'Pu'")	1
('Reagent type (species) or resource', 'Designation', 'Source or reference', 'Identifiers or link', 'Additional information')	1
('Primer name', 'Sequence (5’ to 3’)', 'Reference')	1
('Genotype', 'Strain designation', 'Parental strain designation', 'Parental strain reference')	1
('Brain region', 'Motif occurrence', 'Down-Regulated', 'Shuffled', 'p-value', 'q-value')	1
('Species', 'N', 'DF1 hz (SE)', 'DF1 Q-Value (SE)', 'DF2 hz (SE)', 'DF2 Q-Value (SE)', 'DF2/DF1 Ratio (SE)', 'Musical interval')	1
('Unnamed: 0', 'Unnamed: 1', 'Mean', 'Median', 'Sd', 'Span', 'Particles/mL')	1
('Unnamed: 0', 'ASD (n\xa0=\xa021)', 'TD (n\xa0=\xa021)', 'p-value')	1
('Brain region', 'Coordinates')	1
('Basic models', '# of free parameters', 'R-squared', 'AIC')	1
('Experiment 1', 'Baseline SD')	1
('Unnamed: 0', 'Native HSE (PDB ID: 4V0H)')	1
('Oligonucleotide primers used for site directed mutagenesis', 'Unnamed: 1')	1
('At or near', 'rsID', 'Chr', 'Position', 'A1', 'Freq1', 'Years1', 'SE', 'P', 'SSE P', 'Disease')	1
('At or near', 'rsID', 'Chr', 'Position', 'A1', 'Freq1', 'Years1', 'SE', 'CES P', 'Risk', 'BF P')	1
('Sample descriptives', 'Effect of polygenic score', 'Contrast age at death', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9')	1
('Genotype', 'N', 'rhythmicity* (%)', 'Period (hours\xa0±\xa0SEM)', 'Power (FFT\xa0±\xa0SEM)')	1
('Unnamed: 0', 'Rhizophagus irregularis', 'Rhizophagus cerebriforme', 'Rhizophagus diaphanus', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('Unnamed: 0', 'BUSCO analysis', 'K-mer estimation', 'Unnamed: 3')	1
('Decision type', 'Decision difficulty', 'Icongruent', 'Iincongruent', 'K', 'C')	1
('Unnamed: 0', 'Unnamed: 1', 'Unnamed: 2', 'Control', 'EC-FoxO1 KD')	1
('Unnamed: 0', 'Deleted abdominal segments', 'Urogomphi missing', 'Thoracic leg length (µm)', 'Extra legs', 'Cuticle thinning')	1
('Gene', 'Forward primer (5’ - 3’)', 'Reverse primer (3’ - 5’)')	1
('GWAS', 'Approach', 'Signal', 'Reference')	1
('Unnamed: 0', 'Giant', 'R15-sibs', 'UKB-Eur', 'UKB-GB-NoPCs', 'Ukb-gb', 'UKB-sibs')	1
('Strain\xa0Name', 'Description/Genotype')	1
('Unnamed: 0', 'Symbols', 'Time scale (τR)', 'Derivation')	1
('Parameter', 'Symbol', 'Value', 'Notes/Biological Values')	1
('Sequence', 'Source', 'Identifier')	1
('Sleep stage', 'Time (min\xa0±SEM)', 'Percentage (%\xa0±SEM)')	1
('Unnamed: 0', 'Spearman Rank\xa0Correlation', 'Corrected Rank\xa0Correlation', 'Pearson Correlation')	1
('Dropped factor', 'Δdf', 'AIC', 'LR test p')	1
('Comparison', 'log2(Ev.Ratio)')	1
('Unnamed: 0', 'Original model Pearson\xa0Correlation', 'Expanded model Pearson\xa0Correlation', 'Unnamed: 3')	1
('Unnamed: 0', 'Df', 'AIC', 'BIC', 'logLik', 'Deviance', 'Chisq', 'Chi df', 'Pr(>chisq)')	1
('Gene', "Forward 5'−3'", "Reverse 5'−3'")	1
('RNAi transgene', 'Line', 'Transfor-mation replicate', 'Gametophyte phase', 'Sporophyte phase', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11')	1
('Structure PDB code', 'ISC1926-TnpA 6DGC', 'IS1535-TnpA – Native 6DGB', 'IS1535-TnpA – SeMet')	1
('Dataset', 'Number of genes', 'Reference (source)')	1
('Transcription factor family', "p-value (Fisher's exact test)", 'Transcription factors')	1
('Chr', 'caQTL position', 'caQTL rsID', 'GWAS rsID', 'GWAS p-value', 'GWAS trait', 'Candidate gene')	1
('Unnamed: 0', 'Value', 'Description')	1
('Actuator', 'Device used to operate a valve using electric, pneumatic or hydraulic means')	1
('Object', 'Pennation angle', 'Attachment area of muscle [cm2]', 'Muscle strength [mN]', 'Length [mm]', 'Volume [µm3]', 'Mass [µg]')	1
('Unnamed: 0', 'Sample size', 'Average (nm)', 'Standard Deviation', 'Standard Error of Mean(nm)', 'P value campared to WT')	1
('Unnamed: 0', 'Number of tomograms collected')	1
('Task prediction', '0.2', '0.4', '0.5', '0.6', '0.8')	1
('Variable', 'Meaning', 'Definition/range')	1
('Figure number', 'Conditions', 'NSyn', 'NDishes', 'Ncultures', 'mean\xa0±\xa0sem', 'Stastical test', 'P\xa0val')	1
('Pδ,0', 'Baseline disappearance probability')	1
('QTL', 'Chromosome', 'Position', 'QTL effects', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Reagent type.', 'Designation.', 'Source (public).', 'Identifiers.', 'Additional information.')	1
('Unnamed: 0', 'Model with TC in conformation 1', 'Model with TC in conformation 2')	1
('Structures', 'Map 1 (Å)', 'Map A (Å)', 'Map B (Å)', 'Map C1 (Å)', 'Map C2 (Å)')	1
('Structures Number of particles (% of the total) and resolution in Å', 'Map 1', 'Map A', 'Map B', 'Map C1', 'Map C2')	1
('(A) Kinetic parameters for dissociation of eIF1A from 48S PIC in presence of eIF5 Sui- mutants', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('(B) Kinetic parameters for dissociation of eIF1A from 48S PIC in presence of eIF5 Ssu- and Sui3-2 eIF2', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('(A) Kinetic parameters for Pi release from 48S\xa0PIC with eIF5 Sui- mutants.', 'Unnamed: 1', 'Unnamed: 2')	1
('(B) Kinetic parameters for Pi release from 48S\xa0PIC with eIF5 Ssu- mutants in presence of Sui3-2 eIF2', 'Unnamed: 1', 'Unnamed: 2')	1
('Catalogue no.', 'Region', 'Description')	1
('Catalogue no.', 'Locality', 'Anatomical element')	1
('Cranial element', 'Side', 'Catalog. no')	1
('Fossil', 'Locality', 'Node on phylogeny', 'Max. age', 'Min. age', 'Taxonomic refs.', 'Age refs.')	1
('Catalogue no.', 'Taxon', 'Element', 'Voltage (kV)', 'Current (µA)', 'Filter', 'Projections', 'Voxel size (µm)')	1
('Analysis software', 'Genes', 'Model', 'Gamma distribution', 'Invariant')	1
('Unnamed: 0', 'Deactive', 'steady-state turnover')	1
('Subunit', 'human/bovine', 'Chain', 'Total residues/ range built', 'Modelled with side chains', 'Modelled as poly-alanine', '[%] residues modelled', '[%] with side chains', '[%] unknown')	1
('Lipid', 'nmol lipid/nmol complex I')	1
('Oligonucleotides', 'Sequence (5’−3’)')	1
('Ligand', 'EC50 (nM)', 'Bmax (% of max)', 'N', 'Unnamed: 4', 'Unnamed: 5')	1
('PICK1 variant (LKI)', 'EC50 (nM)', 'Bmax (% of max)', 'N', 'Unnamed: 4', 'Unnamed: 5')	1
('PICK1 variants (LKV)', 'EC50 (nM)', 'Bmax (% of max)', 'N', 'Unnamed: 4', 'Unnamed: 5')	1
('Reagent type (species or resource', 'Designation', 'Source or reference', 'Identifiers', 'Additional information')	1
('Data type (Layer 2)', 'Data type (Regulation)', 'Specific to ER stress (tunicamycin)', 'Specific to H2O2 treatment', 'Shared response', 'Function enrichment amongst shared genes', 'Unnamed: 6')	1
('Unnamed: 0', '5’ Untranslated region', '3’ Untranslated region')	1
('Unnamed: 0', 'Unnamed: 1', 'Unnamed: 2', 'Normalized abundance§', 'Ratio vs NS2A#', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('Groups', 'Treatments', 'Assessments', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Unnamed: 0', 'Groups', 'Treatments', 'Assessments (time after demyelination)', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Antigen', 'Host type', 'Working dilution', 'Manufacturer', 'Catalog#', 'Research resource identifiers (RRIDs)')	1
('Reagent type (Species) Or resource', 'Designation', 'Source or reference', 'Identifiers', 'Additional information')	1
('Protein', 'MANT-ATP', 'MANT-ATPγS')	1
('Reagent type (species) or source', 'Designation', 'Source or reference', 'Identifiers', 'Additional information')	1
('Unnamed: 0', 'Crystal 1', 'Crystal 2')	1
('Allele', 'Molecular lesion', 'Defect in PVD', 'Physical Location†')	1
('Genotypes', '% of defective PVDs', 'N', 'Results')	1
('dma-1(∆PDZ [Y600Amber])', 'tiam-1 (T1548F)')	1
('Protein complex', 'Expected Mass (kDa)', 'SEC-MALS Measured Mass (kDa)', 'SEC elution volume (mL)', 'Apparent Mass (kDa)')	1
('Protein Complex (Alp14-monomer concentration 4.43 uM)', 'µM tubulin* bound', 'µM tubulin free', 'TOG1-TOG2 :αβ-tubulin')	1
('Data collection', '1:2:2 sk-Alp14-monomer: αβ-Tubulin:DRP', '1:2:2 sk-Alp14-monomer-SL: αβ-Tubulin:DRP', '1:2:2 sk-Alp14-monomer: αβ-Tubulin:DRPΔN', '1:2:2 sk-Alp14-dimer: αβ-Tubulin:DRPΔN')	1
('Interface', '1:2:2: sk-Alp14-monomer: αβ-Tubulin: DRP(Å2)*', '1:2:2: sk-Alp14-monomer-SL: αβ-Tubulin: DRP (Å2)', '1:2:1: sk-Alp14-monomer: αβ-Tubulin: DRP-ΔN (Å2)')	1
('Unnamed: 0', 'PDB ID', 'Intra dimer (α1β1) angle (°)', 'Inter dimer (β1α2) angle (°)')	1
('slc12a1/stc1', '24 hpf', '36 hpf', '50 hpf')	1
('cdh17/stc1', '24 hpf', '36 hpf', '50 hpf')	1
('cdh17/slc12a1', '24 hpf', '36 hpf', '50 hpf')	1
('Unnamed: 0', 'Model 1', 'Model 2', 'Model 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9')	1
('Unnamed: 0', 'Young adults', 'Older adults')	1
('Example', 'Prompt', 'Response')	1
('Unnamed: 0', 'FL-20S-1', 'FL-20S-2', 'FL-20Sfocus-1', 'FL-20Sfocus-2')	1
('Oldfield plot_ cutoff', 'Oldfield weight_ scale', 'CaBLAM flagged (%)', 'CCmask', 'Clashscore', 'Bonds RMSD (Å)', 'Angles RMSD (º)', 'Ramachandran outliers (%)', 'Ramachandran allowed (%)', 'Ramachandran favored (%)', 'Rotamer outliers (%)', 'cis- general (%)', 'twisted general (%)', 'Chirality RMSD', 'Dihedral RMSD (º)')	1
('Outcomes', 'WT (n\xa0=\xa023 nerves)', 'Egfl6 KO (n\xa0=\xa024 nerves)', 'P value')	1
('Target genes', 'Primer sequences')	1
('Unnamed: 0', 'Raw Read Count', 'Trimmed Read Count', 'rDNA Read Count', 'Multi-Mapped Read Count', 'Uniquely mapped Read Count')	1
('Unnamed: 0', 'NGF Mean\xa0±\xa0SEM', 'N=', 'TRPV1', 'Vehicle')	1
('Akt-PH from', 'NGF Mean\xa0±\xa0SEM', 'N=', 'Control', 'TRPV1')	1
('Parameter', 'Sign', 'Value')	1
('Parameter', 'Minimum', 'Maximum')	1
('Label', 'Connection (rank)', 'Contribution ratio [%]', 'Unnamed: 3')	1
('Diagnosis', 'Site', 'Measure', 'Patients', 'Controls', 'Test', 'P-value')	1
('Unnamed: 0', 'Nanjinganthus', 'Caytonia', 'Bennettitales', 'Corystospermales', 'Ginkgoales', 'Coniferales', 'Iraniales', 'Czekanowskiales', 'Pentoxylales')	1
('Protein', 'Mutation class', 'Proposed molecular effect', 'Proposed reaction rate effect', 'References')	1
('Kinase', 'KM (µM)', '95% confidence interval', 'kcat (min-1)', '95% confidence interval.1')	1
('Construct name', 'Uniprot', 'Sequence range', 'N-terminal tag', 'C-terminal tag')	1
('Unnamed: 0', 'PCDH154EC/LHFPL5 (EMDB-7327) (PDB 6C13)', 'PCDH151EC/LHFPL5 (EMDB-7328) (PDB 6C14)')	1
('Unnamed: 0', 'EC11-EL')	1
('Figure', 'Test', 'Values', 'N')	1
('Construct', 'Genotype injected:', 'No. independent positive lines obtained', 'Lethality', 'Rescue of lethality/failure to complement')	1
('Construct', 'Injected genotype:', 'No. embryos injected', 'No. fertile adults', 'No vials with y- flies', '% of y- flies confirmed positive')	1
('Unnamed: 0', 'hEXO-10cat-hMPP6')	1
('Unnamed: 0', 'Current', 'Prospective', 'Unnamed: 3', 'Unnamed: 4')	1
('Unnamed: 0', 'Current', 'Prospective', 'Irrelevant', 'Unnamed: 4', 'Unnamed: 5')	1
('Unnamed: 0', 'Region/type', 'Transmitter', '#groups', 'Subregions', '#samples')	1
('System', 'Mechanism', 'Social status', 'Target', 'Illustration')	1
('Gbar (S/m2)', 'Soma', 'Prox dend', 'Mid dend', 'Dist dend', 'Spine')	1
('Pumps', 'Km (mM)', 'Kcat Soma (pmol/cm2/s)', 'Kcat Dend (pmol/cm2/s)', 'Kcat Spine (pmol/cm2/s)')	1
('Unnamed: 0', 'Unnamed: 1', 'Experiment 1', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5')	1
('Factor or drug', 'Stock', 'Target', 'Manufacturer', 'Catalog #')	1
('Antibody target', 'Dilution', 'Manufacturer', 'Catalog #')	1
('Motif', 'Sequence')	1
('Unnamed: 0', 'Protein', 'Localization', 'Function')	1
('Unnamed: 0', 'Protein', 'Mobile fraction (%)', 'N')	1
('Unnamed: 0', 'Level of effect', 'Estimate', 'Standard error', 'Wald stat.', 'Lower CL 95%', 'Upper CL 95%', 'p-value')	1
('Unnamed: 0', 'Estimate', 'Standard error', 'Z-value', 'p-value')	1
('Gene symbol', 'log2 Fold change', 'p value', 'Unnamed: 3', 'Gene symbol.1', 'log2 Fold change.1', 'p value.1')	1
('Algorithm 1: SeqNMF (x-ortho algorithm)',)	1
('Starting conformation', 'Width of CV1 (Å)', 'Width of CV2 (Å)', 'Number of conformations selected')	1
('RNA (0.15M NaCl)', 'Kd (nM)', 'Error', 'nH', 'Error.1')	1
('Sample', 'K (μM)', 'Error (μM)', 'N', 'Error')	1
('Unnamed: 0', 'Forward primer', 'Reverse primer', 'PCR frag.')	1
('Unnamed: 0', 'Thalidomide syndrome', 'Duane Radial Ray syndrome', 'Holt-Oram syndrome')	1
('Reagent type (species)\xa0or resource', 'Designation', 'Source or reference', 'Identifiers', 'Additional information')	1
('GST-JIP3LZ2 interactions with', 'N', 'KD (μM)', 'ΔH (kcal/mol)', 'TΔS (kcal/mol)', 'ΔG (kcal/mol)')	1
('Association\xa0p-value', 'Overlap*', 'TCR\xa0Subjects\xa0†', 'HLA\xa0subjects‡', 'Total\xa0subjects§', 'V-family', 'CDR3', 'HLA\xa0allele#', 'Epitope\xa0annotation')	1
('MHC\xa0Class', 'Position*', 'Contact\xa0frequency†', 'Full CDR3', 'Non-germline CDR3‡', 'AAs§', 'Unnamed: 6', 'Unnamed: 7')	1
('Rank', 'HLA allele', 'Allele frequency', 'TCRs', 'Subjects', 'Cluster center', 'Ssize', 'ZCO', 'Annotations', 'ZCOKeck120', 'ZCOBrit86')	1
('PDB ID*', 'HLA allele', 'Vα', 'Jα', 'CDR3α', 'Vβ', 'Jβ', 'CDR3β', 'Peptide')	1
('Unnamed: 0', 'Scc3T/Scc1K native', 'Scc3T/Scc1K SeMet')	1
('Flip-out reaper insertion', 'Genotype', '[ry[+t7.2]=hsFLP]1', '[ry[+t7.2]=hsFLP]12')	1
('Genotype', 'E mm/s', 'A mm/s', "E' mm/s", "A' mm/s", 'E/A', "E/E'", 'HR bpm')	1
('Cell type', 'HAVCR2High', 'HAVCR2mid and HAVCR2low', 'Blasts')	1
('Unnamed: 0', 'k1 (sec−1)', 'k-1 (sec−1)', 'Keq, DNA-free', 'k2(sec−1nM−1)', 'k-2 (sec−1)', 'k3 (sec−1)', 'k-3 (sec−1)', 'Keq, DNA-bound (nM−1)')	1
('Unnamed: 0', 'DNA', 'Salt', 'k-2 (sec−1)', 'k3 (sec−1)', 'k-3 (sec−1)', 'Keq, DNA-bound (nM−1)')	1
('Gene symbol', 'Forward primer', 'Reverse primer', 'Source')	1
('Layer', 'Unit', 'APC r', 'μc', 'σc', 'μa', 'σa', 'TI')	1
('tRNAX', 'A73', 'G73', 'C73', 'U73', 'Total')	1
('Unnamed: 0', 'Cohort 1', 'Cohort 2', 'P value')	1
('Clock model', 'Demographic model', 'Marginal L estimate', 'Mean ESS', 'Δ marginal L estimate', 'Subst rate x 10−7 (95%HPD)', 'MRCA and rpoC N698S mean node age (95%HPD)')	1
('Unnamed: 0', 'Beijing CAO (n\xa0=\xa0173)', 'Other Beijing (n\xa0=\xa064)', 'P-value', 'All (n\xa0=\xa0277)')	1
('Group', 'S', 'E', 'Z', 'Km', 'Am', 'Cm', 'Fq', 'Thio', 'PAS', 'Pre-XDR XDR')	1
('Subst. model', '-lnL', 'AIC', 'Δ AIC', 'BIC', 'Δ BIC')	1
('Light cycle', 'WT [mg]', '2cysprxAB [mg]', 'Ratio WT/2cysprxAB')	1
('Component', 'Start value [µM]', 'Addition t = 100 [µM]', 'Addition t = 200 [µM]')	1
('Parameter', 'Value', 'Reference/comment')	1
('component', 'start value [µM]', 'Reference/comment')	1
('parameter', 'value', 'Reference/comment')	1
('reaction number', 'reaction')	1
('reaction number', 'Reaction')	1
('Unnamed: 0', 'Order', 'Animals', 'Location', 'Label', 'N of animals', 'Typical weight (kg)', 'V (m/s)', 'Fr', 'N of strides', 'Unnamed: 10')	1
('Name # of frames', 'L1', 'L2', 'L3', 'L4', 'CaImAn batch', 'CaImAn online')	1
('Name', 'Area brain', 'Lab', 'Rate (Hz)', 'Size (T×X×Y)', 'Indicator', '#Labelers', '#Neurons CA')	1
('Name', 'L1', 'L2', 'L3', 'L4', 'Mean')	1
('Algorithm 1: ProcessInPatches', 'Unnamed: 1', 'Unnamed: 2')	1
('Algorithm 2 CaImAn batch', 'Unnamed: 1', 'Unnamed: 2')	1
('Algorithm 3: SeededInitialization', 'Unnamed: 1', 'Unnamed: 2')	1
('Algorithm 4 CaImAn online (See Giovannucci et al., 2017 for explanation of routines)', 'Unnamed: 1', 'Unnamed: 2')	1
('Algorithm 5: FindNewComponents', 'Unnamed: 1', 'Unnamed: 2')	1
('Algorithm 6: ShapeUpdateIndeces', 'Unnamed: 1', 'Unnamed: 2')	1
('Algorithm 7: RegisterPair', 'Unnamed: 1', 'Unnamed: 2')	1
('Algorithm 8: RegisterMulti', 'Unnamed: 1', 'Unnamed: 2')	1
('Model parameters for simulations in Figure 4 and Figure 4—figure supplement 1 (S4).', 'Simulation', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('ToxoDB gene ID (http://toxodb.org)', 'Protein annotation', 'Predicted protein mass (kDa)', 'Mitochon-drial proteome (this study)', 'Phenotype score (Sidik et al., 2016)', 'Similarity search (E-value)', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10')	1
('Volunteer', 'Sequence', 'Treatment order')	1
('Unnamed: 0', 'JAK2/EPOR', 'JAK2/LEPR')	1
('Reagent type (species) or resource', 'Designation', 'Source or reference', 'Identification', 'Additional information')	1
('Meg3 in situ hybridization probe primer', 'Unnamed: 1', 'Unnamed: 2')	1
('List of primers for quantitative RT-PCR analyses', 'Unnamed: 1', 'Unnamed: 2')	1
('sgRNA sequences used in this work', 'Unnamed: 1')	1
('List of primers for CRISPR deletion genotyping/sequencing', 'Unnamed: 1', 'Unnamed: 2')	1
('Published ChIP-Seq data summary (related to Figure 2D, G and H, Figure 4—figure supplement 1A,B)', 'Unnamed: 1', 'Unnamed: 2')	1
('Cell line', 'Replicate', 'Read length (bp)', 'Restriction enzyme', 'HiC protocol', 'Source', 'Resolution (kb)')	1
('Name', 'Sequence', 'Gene')	1
('Line', 'Power (W/m3)', 'fmax (Hz)', 'Work (J/m3)', 'fWmax (Hz)', 'Passive Tension', 'Active Tension')	1
('Line', 'Power (W/m3)', 'Net work (J/m3)', 'Work Gen. (J/m3)', 'Work abs. (J/m3)', '% ML Amplitude', 'fPmax (Hz)')	1
('Line', 'A', 'B', '2πb (s -1)', 'C', '2πc (s -1)')	1
('Line', 'Age (days)', 'Flight index 22°C', 'Flight index 15°C', 'WBF 22°C (Hz)', 'WBF 15°C (Hz)')	1
('Unnamed: 0', 'XaxA', 'XaxB', 'Unnamed: 3')	1
('Primer set', 'Forward (5’−3’)', 'Reverse (5’−3’)')	1
('Reagent type (species)\xa0or Resource', 'Designation', 'Source or reference', 'Identifiers', 'AdditionalInformation')	1
('Figure', 'Genotype', '# expts', '# animals', 'animal-hours', '# turns')	1
('Primer\xa0name', 'Primer\xa0sequence')	1
('Fraction', 'Volume', 'Total protein', 'Total activity', 'Specific activity', 'Purification', 'Yield')	1
('Gel band', 'Protein name', 'NCBI Protein accession number', 'PLGS score*', 'mW (Da)', 'Coverage (%)')	1
('Substrate', 'Unnamed: 1', 'Rat SETD3', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Human SETD3', 'Unnamed: 7', 'Unnamed: 8')	1
('Actin', 'Peptide variant', 'Number of identified peptide sequences (PSMs)', 'Unnamed: 3')	1
('Primer', 'Sequence', 'Restriction site', 'Plasmid', 'Protein expressed')	1
('No', 'Gene ID', 'Proteins', 'Recombinant protein bind to ERM', 'Overexpression in Amoeba', 'Localization')	1
('Proteins', 'DNA Binding (EMSA) NAD+ (mM)#', 'NAD+ Binding (Tm) NAD+ (mM)§', 'Nicotinamidase activity (% conversion)¶', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Proteins', 'DNA Binding', 'NAD+ binding', 'Enzymatic activity')	1
('Unnamed: 0', 'RC-FDi(Control-Di)n=15', 'Pet1-Flpe;RC-FDi(Pet1-Di)n=22', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5')	1
('Baseline characteristic', 'Odds ratio', 'Confidence interval', 'p-value*', 'Unnamed: 4')	1
('Unnamed: 0', 'Value', 'Description', 'Reference')	1
('Prediction', 'Explanation')	1
('F', 'α[min\u2005−\u20051]', 'γ[min\u2005−\u20051]', 'Scale factor a', 'Exponent b')	1
('Relative pool size ϕ', 'γ[min\u2005−\u20051]', 'F', 'Scale factor a', 'Exponent b')	1
('Table 1. WT assembled kinetochores', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12')	1
('Table 2. dsn1-2D assembled kinetochores', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12')	1
('Unnamed: 0', 'k1 (nM−1s−1)', 'k-1 (s−1)', 'k2 (nM−1s−1)', 'k-2 (s−1)', 'k3 (s−1)', 'k-3 (nM−1s−1)')	1
('Unnamed: 0', 'Wild-type', 'W589A')	1
('ON MODEL', 'τON', '—', 'τA', 'scaleON', 'RMSE', 'Corr.Coef.')	1
('Navigation model', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3')	1
('Unnamed: 0', 'Induced clone', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12')	1
('Strain inoculated', 'Blinded analysis')	1
('Unnamed: 0', 'Induced clone', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Reagent', 'Designation', 'Source', 'Identifiers', 'Additional information')	1
('Group contrast', 'Labels of significant AAL regions*', 't-values (range)', 'p-values (range)')	1
('RNA name', "RNA sequence (5' to 3')")	1
('Plasmid name', 'Description')	1
('Oligonucleotide name', "Oligonucleotide sequence (5' to 3')")	1
('Program', 'Function', 'Code used')	1
('Antibody', 'Concentration used')	1
('Cell lines Constructs', 'cBcl-XL', 'cBcl-2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Unnamed: 0', '426c core†-VRC01GL')	1
('Mouse', 'Rew', 'nRw', 'Dir', 'Beh- track', '# trials', 'Eye', 'IOS', 'Ca2+ Full', 'Ca2+ Border', '% tuned')	1
('Growth (h)', 'Oxidized (%)', 'Reduced (%)')	1
('Cichlids (df\xa0=\xa028)', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5')	1
('Mantis shrimp (df\xa0=\xa034)', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5')	1
('Sunfish (df\xa0=\xa017)', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5')	1
('Wrasses (df\xa0=\xa099)', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5')	1
('Unnamed: 0', 'Unnamed: 1', 'Control', 'Ablated', 'Reattach')	1
('Bird group', 'Tutoring (dph)', 'Tutoring H/day', 'Sacrifice (dph)')	1
('*Tanaka et al. (2012)', 'Gal four enhancer -trap strain', 'Cell count', 'Va1v cells, this study')	1
('Species', 'Number of Cell Lines (NPCs)', 'Number of clones for each cell line', 'Number of movies', 'Number of cells analyzed')	1
('Approach', 'Method', 'Throughput', 'Output')	1
('Reagent type (species)or resource', 'Designation', 'Source or reference', 'Identifiers', 'Additional')	1
('Protein and locus tag', 'Source organism', 'E. coli GcvH (identity)', 'E. coli GcvH (similarity)')	1
('Locus tag', 'Source organism', 'E. coli LplA (Identity/Similarity)', 'E. coli LipB (Identity/Similarity)', 'B. subtilis LipM (Identity/Similarity)')	1
('Unnamed: 0', 'Patients with colectomy or proctectomy', 'Non-colectomy patients', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10')	1
('Unnamed: 0', 'Patients with colectomy (T2D/total)', 'Non-colectomy patients (T2D/total)', 'Hazard ratio (95% CI)', 'P-value')	1
('Gene symbol', 'Sequence', 'Unnamed: 2')	1
('Formula', 'R2', 'Parameter', 'Median', '2.5%', '97.5%')	1
('Study ID', 'Reference', 'Population ID', 'Primary data?', 'Number of groups*', 'Total number of males†', 'Comments')	1
('Variable', 'Levels', 'Number of studies', 'Order of preference*')	1
('Method to estimate bib size', 'Number of times used', 'Order of preference‡')	1
('Method to infer dominance rank', 'Number of times used', 'Order of preference*')	1
('Reference', 'Comments')	1
('Study ID*', 'Data description')	1
('Added cation', 'Conformation of the triphosphate chain of Mg-ATP*', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Superfamily', 'Family', 'Activating charge', 'Activation mechanism')	1
('Protein', 'PDB entry', 'Bound NTP analog', 'Occupation of the AG site', 'Phosphate chain shape', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('Layer/Cell Type', 'Total probed (Figure 1—figure supplement 1C)', 'Total connected (Figure 1—figure supplement 1C)', 'Total connection probability (%)', 'Strength (Figure 1—figure supplement 1E, Figure 1F)', 'Kinetics (Figure 1—figure supplement 1F, Figure 1F)', 'Connection probability (%) w/in 100 µm (Connected/probed, Figure 1—figure supplement 1D, Figure 4A,C)', 'STP (Figure 1—figure supplement 1G, Figures 5 and 6)')	1
('Unnamed: 0', 'Amp median (mV)', 'Amp mean (mV)', 'Amp SD (mV)', 'Latency median (ms)', 'Latency mean (ms)', 'Latency SD (ms)', 'Rise Time median (ms)', 'Rise Time mean (ms)', 'Rise Time SD (ms)', 'CV median', 'CV mean', 'CV SD')	1
('Unnamed: 0', 'Amp median (mV)', 'Amp mean (mV)', 'Amp SD (mV)', 'Latency median (ms)', 'Latency mean (ms)', 'Latency SD (ms)', 'Rise time median (ms)', 'Rise time mean (ms)', 'Rise time SD (ms)', 'CV median', 'CV mean', 'CV sd')	1
('Unnamed: 0', '8:1 pulse ratio (50 Hz) mean ± SD', 'Recovery (9:1) ratio (250 ms) mean\xa0±\xa0SD', 'Paired-pulse ratio (50 Hz) mean\xa0±\xa0SD')	1
('Connection type/Model Parameter', '𝜏r0 (sec\xa0±\xa0SE)', 'P0 (±SE)', '𝜏FDR (ms\xa0±\xa0SE)', 'αFDR (±SE)', 'r2', 'Rorb Z-score', 'Sim1 Z-score', 'Tlx3 Z-score')	1
('Cdc12 knob helices/Actin barbed end groove', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('FH2 residue', 'FH2 domain', 'Actin residue', 'Actin subunit', '% Formed')	1
('Model', 'HR', '95% CI', 'P-value')	1
('Cohort', 'Model', 'Disease free Time', 'Overall Survival', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9')	1
('Model', 'Overall Survival', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Unnamed: 0', 'FM-GltPhIFS')	1
('Task parameter', 'Total', '↑ MSN', '↓ MSN', '↑ FSI', '↓ FSI')	1
('Unnamed: 0', 'DNA-bound state', 'DNA binding incompetent statea,*', 'DNA binding competent stateb*', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Unnamed: 0', 'Unnamed: 1', 'ZnII', 'Dynamic changes (ZnII) at 600 MHz', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Resource', 'Designation', 'Source', 'Identifiers', 'Additional information')	1
('Reagent type (species) or resource', 'Desig-nation', 'Source or reference', 'Identifiers', 'Additional information')	1
('Unnamed: 0', 'Substrate', 'V/[E] (min−1)', 'Unnamed: 3', 'Unnamed: 4')	1
('AMP', 'Age (years)', 'Sex', 'Amputation', 'Phantom sensations', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11')	1
('tp53wt/wt\xa0+\xa0rag2:kRASG12D ERMS', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4')	1
('Strain', 'Characteristics', 'Ref. or source', 'Manuscript abbreviation')	1
('Data collection', 'Iodide', 'Unnamed: 2', 'Unnamed: 3', 'Native', 'Unnamed: 5', 'Unnamed: 6')	1
('Protein name', 'Symbol', 'Uniprot accession', 'Competition Ratio*', 'Redox?†', 'ER-localization?‡')	1
('Antiestrogen', 'Class', 'Approved clinical indications')	1
('Ligand/Mutant', 'Kd (nM)*', 'Unnamed: 2', 'Unnamed: 3')	1
('Reagent type (species) or resource', 'Designation', 'Source or reference', 'Identifier', 'RRID')	1
('Unnamed: 0', 'ERα LBD-BZA')	1
('Trait', 'Locus', 'Variance explained*')	1
('Locus', 'Effect', 'Effect size', 'SE')	1
('Generation', 'Mother', 'Father', 'Males', 'Females')	1
('Autosome', 'Log10 (L(H1)/L(H2))')	1
('Unnamed: 0', 'Chaetae number', 'Chaetae length', 'Offspring size')	1
('Anatomical description of location of activity', 'Maximum z-statistic within cluster', 'Coordinates of maximum z-statistic in infant template space', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5')	1
('Structure', 'KRASQ61H-3344')	1
('Chr', 'Position', 'rs-code', 'A', 'B', 'B freq', 'OR', 'P', 'Likely disease gene')	1
('Unnamed: 0', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Age at first assessment visit', 'Number of live births', 'BMI', 'Age at hysterectomy', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12')	1
('rs-code', 'Chr', 'Position', 'A', 'B', 'r2 (reference SNP)', 'B freq', 'OR', 'Beta', 'SE', 'χ2', 'P')	1
('Unnamed: 0', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'UKBB cohort', 'Helsinki cohort', 'Meta-analysis (fixed eff.)', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12', 'Unnamed: 13', 'Unnamed: 14')	1
('rs-code', 'Chr', 'Position', 'A', 'B', 'OR', 'Log-odds', 'Stage *')	1
('Predictor', 'Response', 'Model', 'Beta', 'SE', 'Statistic', 'P', 'Q')	1
('GRS *', 'Cohort', 'Variable', 'Test', 'N cases', 'N controls', 'Rate ratio', 'P', 'Q')	1
('rs-code', 'Chr', 'Pos', 'A', 'B', 'AF_AFR', 'AF_AMR', 'AF_ASJ', 'AF_EAS', 'AF_FIN', 'AF_NFE', 'AF_OTH')	1
('Tissue', 'Gene', 'ID', 'N', 'Best SNP', 'Distance', 'Nominal P', 'Permutation P', 'FDR')	1
('Tissue', 'SNP', 'CpG*', 'Beta', 't-stat', 'p-value', 'FDR', 'Gene', 'CpG island', 'Promoter', 'AA', 'AB', 'BB')	1
('Study', 'Population', 'Locus', 'Suggested gene', 'SNP', 'RA', 'Method', 'P (UKBB)')	1
('Pubmed', 'Date', 'Journal', 'Unnamed: 3', 'Gene symbol', 'Risk allele', 'AF', 'OR', 'P')	1
('No.', 'Compound 1', 'Compound 2', 'Compound 3', 'Compound 4', 'Compound 7', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12', 'Unnamed: 13', 'Unnamed: 14', 'Unnamed: 15')	1
('Nr.', 'Compound name', 'RT', 'Q1 [m/z]*, †', 'Q3 [m/z] ‡, § (CE [V])')	1
('Nr.', 'Compound name', 'RT', 'Q1 [m/z]*, †', 'Q3 [m/z]‡, § (CE [V])')	1
('Gene', 'Forward primer', 'Reversed primer')	1
('Strains', 'Number of\xa0biological replicates', 'Added energy source and/or co-substrate', 'Consumption\xa0(-)/production\xa0(+) of metabolites in mM', 'Carbon recovery (%)', 'O/R balance', 'Selected for parame-terization 1', 'RMSE parame-terization 1', 'Selected for parame-terization 2', 'RMSE parame-terization 2', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12', 'Unnamed: 13', 'Unnamed: 14', 'Unnamed: 15')	1
('Experiment', 'E. coli strain(s)', 'Reference')	1
('E. coli\xa0+\xa0H. alvei JB232', 'LB (E. coli\xa0+\xa0H. alvei JB232 CFUs) LB-kanamycin (50 µg/ml) (E. coli CFUs)')	1
('Driver', 'New type name', 'Type description', 'Super type', 'Name in other insects')	1
('Driver', 'New type name', 'Cells per hemisphere', 'Cells per column')	1
('Protein name', 'Functional annotation', 'S. pneumoniae D39 coding sequence', 'IgG binding at day 0', 'Δ0->84 in placebo group', 'Δ0->84 in cohort 1', 'Δ0->84 in cohort 2', 'Δ0->84 in cohort 3', 'Statistical analysis')	1
('Unnamed: 0', 'Gene/protein names', 'Unnamed: 2', 'Unnamed: 3')	1
('Purpose', 'Name', 'Sequence')	1
('Reagent type (species) or resource', 'Designation', 'Source/Reference', 'Identifier', 'Additional information')	1
('Strain #', 'Genotype', 'Figure')	1
('Gene', 'Oligonucleotide 1 (5’→3’)', 'Oligonucleotide 2 (5→3’)', 'Template', 'Concentration (mg/ml)')	1
('Reagent type (species) or resource', 'Designation', 'Source of reference', 'Identifiers/RRIDS', 'Additional information')	1
('Unnamed: 0', 'Healthy controls', 'ALS, all, T0', 'p-value')	1
('REAGENT or RESOURCE', 'Designation', 'Source', 'Identifier', 'Additional information')	1
('Data collection/processing', 'Unnamed: 1')	1
('Reagent type', 'Designation', 'Source/Reference', 'Identifiers')	1
('Unnamed: 0', 'Protein', 'Genes', 'Essentiality', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9')	1
('Locus', 'Reaction', 'EssTn5', 'EssFBA', 'Locus.1', 'Reaction.1', 'EssTn5.1', 'EssFBA.1', 'Locus.2', 'Reaction.2', 'EssTn5.2', 'EssFBA.2')	1
('Category', 'ATP expense [%]')	1
('Unnamed: 0', 'All genes', 'Excluding AA', 'Unnamed: 3', 'Unnamed: 4')	1
('Unnamed: 0', 'Accuracy', 'Sensitivity', 'Specificity', 'MCC')	1
('Gene(s)', 'Description', 'Remark')	1
('Experiment', 'Rationale')	1
('Gene (species)', "Sequences for forward and reverse primers (5'–3')")	1
('Reagent type or resource', 'Designation', 'Source', 'Identifier', 'Additional information')	1
('Unnamed: 0', 'H206A Oraicryst', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4')	1
('Unnamed: 0', 'K163W Oraicryst', 'K163W Oraicryst.1', 'WT Oraicryst', 'Unnamed: 4', 'Unnamed: 5')	1
('Mutant combination', 'Number of tetrads analyzed', 'Number of predicted double or triple mutants', 'Viability of mutants', 'Unnamed: 4')	1
('Unnamed: 0', 'kar9∆', 'scs2/22∆ kar9∆')	1
('Molecule', 'Function', 'Source', 'Cat #', 'Final concentration')	1
('crRNA A26', '3’-GCAACAATTCTTGCTGCAACAATCTTCAACCCATACCAGAAAGUUA')	1
('Strain', 'ICa,\u2006L (pA/pF)', 'n', 'IKur (pA/pF)', 'n.1', 'Ito,\u2006f (pA/pF)', 'n.2', 'IKss (pA/pF)', 'n.3')	1
('Strain', 'Heart mass pre-ISO, mpre (g)', 'Heart mass post-ISO, mpost (g)')	1
('Strain', 'ΔL/L (4 Hz)', 'n')	1
('Parameter', 'Definition', 'Reference value', 'Reference source')	1
('Parameter', 'Definition', 'Value')	1
('Abbreviation', 'Description', 'Reference value')	1
('Motor function', 'Dlx-CKO', 'ChAT-CKO')	1
('Unnamed: 0', 'Cre expression', 'Cell death vulnerability', 'Unnamed: 3', 'Unnamed: 4')	1
('Cholinergic population', 'Neuronal class', 'Firing properties', 'Efferent projections', 'Afferent inputs', 'Birth date/final mitosis', 'Embryonic origin', 'ChAT expression')	1
('Level', 'Antigen', 'Host', 'Conjugated', 'Dilution', 'Source')	1
('Region', 'Marker', 'Counting frame (μm)', 'Grid size (μm)', 'Guard zone (μm)', 'Dissector (μm)', 'Section cut thickness (μm)')	1
('Unnamed: 0', '*Merged reads', 'Length of HBV consensus sequence', 'Mean HBV coverage', 'Gaps in the consensus sequence at nt position', '*Mapped reads HBV', '*Mapped reads human', 'Mean human coverage', 'Human genomes/HBVgenomes')	1
('Unnamed: 0', 'apo-Aurora A (6CPE)', 'Aurora A\xa0+\xa0AMPPCP (6CPF)', 'Aurora A\xa0+\xa0Mb\xa0+\xa0AT9283 (6CPG)')	1
('Unnamed: 0', 'TMD', 'CTD')	1
('Data collection', 'Data set 1 [Data set 2]')	1
('TRP family name', 'Residue', 'Van der waals diameter (Å)', 'Selectivity* PCa: PNa', 'Reference')	1
('Response type', 'Phase 1', 'Phase 2', 'Phase 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('Unnamed: 0', 'Microinjection of muscimol in the superior colliculus', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4')	1
('Unnamed: 0', 'Microinjection of muscimol in the parabrachial nucleus', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4')	1
('Electron microscope', 'Titan Krios')	1
('Library name', 'Source*', 'SRA ID', 'N', 'Sex/stage', 'Tissue', 'Library type')	1
('Liliana Bachrach', 'Doug Fambrough', 'Benjamin Lower', 'Luis Cunha', 'Joshua Guerriero')	1
('Library name', 'Label', 'SRA ID', 'N', 'Sex/ Stage', 'Tissue', 'Library type')	1
('Repeat name', 'Repeat unit length', 'Repeat unit sequence')	1
('Library name', 'SRA ID', 'N', 'Sex', 'Tissue', 'Notes')	1
('Library', 'SRA ID', 'N', 'Date', 'Locality', 'Sex', 'Tissue', 'Type', 'Reads', 'Number', 'Cov', 'Insert size (Ori)', 'Contamination')	1
('Assembly', 'Libraries', 'Assembly scheme', 'Assembly* /measured** genome size (Gbp)', 'Scaffold/ Contig (#)', 'Contig NG50*** (Kbp)', 'Scaffold NG50*** (Kbp)', 'BUSCO statistics')	1
('Hypothesis', 'Site class:', '0', '1', '2a', '2b', 'lnL')	1
('Site numbering', 'MEME2', 'PAML-BEB', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9')	1
('P. pyralis ID (OGS1.1)', 'Predicted function', 'Ppyr expression rank', 'Ppyr BSN-TPM', 'Orthogroup', 'Alat expression rank', 'Alat BSN-TPM', 'A. lateralis ID (OGS1.0)')	1
('Assigned ion identity', 'Ion type', 'Chemical formula', 'Expected M/z', 'Measured M/z', 'M/z error* (ppm)', 'Retention time (mins)', 'Feature area (arb)')	1
('Assigned ion identity', 'Ion type', 'Chemical formula', 'Expected m/z', 'Measured m/z', 'm/z error (ppm)', 'Retention time (mins)', 'Feature area (arb)')	1
('Chemical formula', 'Predicted exact mass', 'Exact mass adjusted to P. pyralis hemolymph data (+0.6 ppm)', 'Exact mass adjusted to P. pyralis partial larval body data (+9.9 ppm)', 'Exact mass adjusted to A. lateralis hemolymph data (+1.6 ppm)', 'Exact mass adjusted to A. lateralis larval body data (+1.1 ppm)', 'Exact mass adjusted to I. luminosus thorax data (+0.6 ppm)')	1
('Assigned identity', 'M/z', 'Chemical formula', 'RT (mins)', 'Similarity score', '# of ions matched', 'A. lateralis feature area (arb)', 'P. pyralis feature area (arb)')	1
('Genome segment', 'Size (nt)', 'Gene product\xa0(aa)', 'Best hit', 'Best hit taxonomy', 'Query cover', 'E\xa0value', 'Identity')	1
('Genome product', 'Annotation', 'Start', 'End', 'Length', 'Database', 'Id', 'InterPro\xa0ID', 'InterPro name')	1
('Unnamed: 0', 'ASD', 'NT', 'Unnamed: 3', 'Unnamed: 4')	1
('Unnamed: 0', 'Day 1', 'Day 2', 'Day 3')	1
('Gene set name', 'Search strategy on ToxoDB', 'Size')	1
('Ensembl gene ID', 'Gene symbol', 'Log2 fold change', 'q-value')	1
('Unnamed: 0', 'Unnamed: 1', 'Mean', 'Standard Deviation')	1
('Epoch', 'Window', 'Δ', 'T', 'P')	1
('Unnamed: 0', 'Mean (n\xa0=\xa013)', 'Standard Deviation')	1
('No stim', 'pre-Choice', 'Change')	1
('Data set', 'Total DMRs', 'Direction', 'DMRs', 'Overlap with ChIP-seq peaks', 'Unnamed: 5')	1
('GO', 'Corrected P-value', 'Number on Chr_04', 'Percent of Chr_04 genes', 'GO term', 'Unnamed: 5')	1
('Unnamed: 0', 'Chromosome', 'Genome', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Unnamed: 0', 'Percent pairwise differences', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Unnamed: 0', 'RNA- dGMP', 'RNA- Gp-AI-pG', 'Time-resolved structures (RNA-2-AIpG)', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9')	1
('Experiment series', 'Strain', 'Stim', 'ATR', 'Number of plates', 'Number of days', 'Interstimulus interval (s)', 'Stimulus duration (s)', 'Total animal- stimulus presentations', 'Cumulative Recording Length (animal-hours)', 'Animals per frame (Mean\xa0± Stdev)', 'Figures')	1
('Unnamed: 0', 'Unnamed: 1', 'Mean bone length (mm\xa0±\xa0SD)', 'Unnamed: 3', 'Mean bone volume (mm3\xa0±\xa0SD)', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('Genotype', 'Period', 'N limb', 'N gene', 'LIMB', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('Unnamed: 0', 'Unnamed: 1', 'EARLY', 'MID', 'LATE', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12', 'Unnamed: 13', 'Unnamed: 14', 'Unnamed: 15', 'Unnamed: 16')	1
('Experimental group', 'Injection site', 'Behavioral assays', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('#', 'Measure', 'Description', 'Quantification', 'Direction\xa0indicating impairment')	1
('Flexible/Social/Learning\xa0metrics', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9')	1
('Movement metrics', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5')	1
('Unnamed: 0', 'Injection site', 'Unnamed: 2')	1
('Unnamed: 0', 'Article statistics', 'Contributed equally\xa0=\xa02', 'Contributed equally\xa0>\xa02', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11')	1
('Unnamed: 0', 'd.f.', 'F', 'P-value', 'Significant contrasts', 'Unnamed: 5')	1
('Unnamed: 0', 'd.f.', 'SS', 'MS', 'PseudoF', 'R2', 'P-value')	1
('Unnamed: 0', 'Behavior', 'dissGCM', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Contrast', 'Regions', 'Peak t-value', 'Peak MNI coordinates (x,y,z)', 'Number of voxels', 'Cluster P')	1
('Figure', 'Parameter', 'Mean', '95% CI')	1
('Dissociation constants for WT and G96A binding to PRPP and ppGpp', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4')	1
('Reagent type', 'Designation', 'Source or reference', 'Identifiers', 'Additional\xa0information')	1
('Name', 'Description', 'Source')	1
('Inhibitor', 'K-5a2*', '25a†', 'ETR‡', 'RPV‡', 'Unnamed: 5')	1
('RT variants', '25a', 'RPV', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Unnamed: 0', 'Overall', 'NNIBP region')	1
('Unnamed: 0', 'Total', 'Individual residue', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10')	1
('Unnamed: 0', 'Torsion angles (°)', 'NNRTI energy* (kcal/mol)', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9')	1
('Unnamed: 0', 'Presentation rate', 'Peak latency (ms)', 'Onset latency (ms)')	1
('Unnamed: 0', 'Unnamed: 1', 'Peak latency (ms)', 'Onset latency (ms)')	1
('Unnamed: 0', 'Unnamed: 1', 'ADR1a', 'Unnamed: 3', 'Unnamed: 4', 'R16', 'Unnamed: 6', 'Unnamed: 7', 'I27', 'Unnamed: 9')	1
('Unnamed: 0', 'WT apo, 100 K', 'WT* apo, 180 K', 'WT* apo, 240 K', 'WT* apo, 278 K', 'WT* with BB3, 278 K', 'K197C apo, 100 K', 'K197C tethered to 2, 100 K')	1
('Unnamed: 0', 'H11', 'H4', 'H6', 'H1')	1
('Unnamed: 0', 'Diversity', 'Composition (mean)', 'Composition (maximum)')	1
('Dataset', 'Epoch', '# bursts', 'Burst rate [Hz]', '# replay bursts', '# bursts w/joint content', 'Mean burst duration [ms]')	1
('Dataset', 'Epoch', 'Sensitivity', 'Specificity', 'False omission rate', 'False discovery rate', 'Informedness', 'Markedness', 'Correlation')	1
('Dataset', 'Epoch', 'Out of burst rate [min−1]', 'Content accuracy', 'Median absolute latency [ms]', 'Median relative latency [%]')	1
('Dataset', 'Epoch', 'Live θmua', 'Live θsharp', 'Optimal θmua', 'Optimal θsharp', 'Optimal correlation', 'ΔCorrelation live test*', 'Out of burst rate[min−1]')	1
('Peptide', 'Peptide Sequence*,†', 'N', 'Kd (μM)', 'ΔH (kcal/mol)', 'TΔS (kcal/mol)', 'ΔG(kcal/mol)')	1
('Reagent type or resource', 'Designation', 'Source or reference', 'Additional information')	1
('Subject', 'Clone(s)')	1
('Behavior', 'Parameter', 'Treatment', 'Sex', 'n', 'Mean', 'SEM', 'P value (Unpaired t test)')	1
('Unnamed: 0', 'MALE', 'Female', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Unnamed: 0', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'p-Value (ANOVA)')	1
('Strain', 'Official name', 'Origin')	1
('Unnamed: 0', 'Transgenic P2X7-EGFP', 'P2X7 reporter (Gensat)', 'Humanized P2X7')	1
('Type', 'Designation', 'Source or reference', 'Identifiers', 'Additional information')	1
('Abbreviation', 'Definition')	1
('Unnamed: 0', 'Beijing_750 (n\xa0=\xa063)', 'Beijing_HDxt (n\xa0=\xa025)', 'Guangzhou_HDxt (n\xa0=\xa024)')	1
('Patient alias', 'Gender', 'Age (years)', 'Diagnose', 'Etiology', 'Structural lesions on MRI', 'Time to MRI (months)', 'Number of CRS-R assessments', 'CRS-R score at T0', 'CRS-R subscore at T0', 'CRS-R score at T1', 'CRS-R subscore at T1', 'Follow-up(months)', 'GOS', 'Predicted score')	1
('Patient alias', 'Gender', 'Age (years)', 'Diagnose', 'Etiology', 'Structural lesions on MRI', 'Time to MRI (months)', 'Number of CRS-R assessments', 'CRS-R score at T0', 'CRS-R subscore at T0', 'CRS-R score at T1', 'CRS-R subscore at T1', 'follow-up(months)', 'GOS', 'Predicted score')	1
('Patient alias', 'Gender', 'Age (years)', 'Diagnose', 'Etiology', 'Time to MRI\xa0(months)', 'CRS-R score at T0', 'CRS-R subscore at T0', 'Follow-up\xa0(months)', 'GOS', 'Predicted score')	1
('Brain network', 'ROI name', 'ROI abbreviation', 'Peak MNI coordinates', 'References')	1
('Unnamed: 0', 'ROI name', "Pearson's correlation coefficient and p value")	1
('Unnamed: 0', 'Functional connectivity', "Pearson's correlation coefficient and p-value")	1
('Unnamed: 0', 'Reported t-statistic', 'Reported exact sample size or degrees of freedom', 'Reported exact p-values')	1
('Reagent type (species) or resource', 'Designation', 'Source and reference', 'Identifiers')	1
('Unnamed: 0', 'UbcH7\xa0~\xa0Ub SidC SNL (PDB ID: 6CP2)', 'UbcH5C-SdcA SNL (PDB ID: 6CP0)')	1
('Unnamed: 0', 'MANOVA and post hoc tests results', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11')	1
('Unnamed: 0', 'Monkey F (26079 trials)', 'Monkey C (37161 trials)', 'Monkey A (21089 trials)', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12')	1
('Unnamed: 0', 'Experimental data', 'Simu: me model', 'Simu: z model', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Unnamed: 0', 'All MEG datasets', 'APOE-ɛ4 carriers', 'APOE-ɛ4 non-carriers', 'P value')	1
('Frequency Range', 'AAL Region 1', 'AAL Region 2', 'E4 carriers versus non-carriers (T-statistic)', 'AD versus elderly controls (T-statistic)')	1
('Problem', 'Performance using all valid features')	1
('Mutation', 'Primers', 'Sequences')	1
('Unnamed: 0', '2010–2011', '2011–2012', '2012–2013', '2013–2014', '2014–2015')	1
('Unnamed: 0', 'Species', 'Accession', 'Common name', '119', '122', '123', '124')	1
('Order', 'Species', 'Accession', 'Common name', '119', '122', '123', '124', 'Ecology notes from FishBase')	1
('Site', 'Distance to site 122 (Å)*', 'Tetrapod M8 dN/dS†', 'Teleost M8 dN/dS†', 'Characiphysi M8 dN/dS†', 'Posterior probability of long-term shift in selection (tetrapod/characiphysi)‡', 'Z-score covariation§', 'Significant correlated evolution?')	1
('Unnamed: 0', '119-122-123-124 motif', 'λMAX (nm)∗,†', 'Half-life of retinal release1,2')	1
('Model', 'lnL', 'Parameters1†', 'Null', 'P [df]†', 'Δ AIC§', 'Unnamed: 6', 'Unnamed: 7')	1
('Model', 'lnL', 'Parameters†', 'Null', 'P [df]‡', 'Δ AIC§', 'Unnamed: 6', 'Unnamed: 7')	1
('Unnamed: 0', 'Unnamed: 1', 'Commd9 HN domain (1–117)', 'Commd9 COMM domain (115–198)')	1
('Unnamed: 0', 'Commd1', 'Commd7', 'Commd9')	1
('Predicted mass (Da)', 'Observed mass (Da)', 'Error\xa0(ppm)', 'xQuest score', 'Unnamed: 4', 'Unnamed: 5')	1
('Predicted mass (Da)', 'Observed mass (Da)', 'Error\xa0(ppm)', 'xQuest score', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Variable', 'Age\xa0(y)', 'Cas1\xa0(N\xa0=\xa088)', 'Cas2\xa0(N\xa0=\xa0107)', 'Cas3\xa0(N\xa0=\xa022)', 'P-value\xa0(unadjusted)', 'Feature?', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9')	1
('Variable', 'Age', 'Cas1 (N\xa0=\xa088)', 'Cas2 (N\xa0=\xa0107)', 'Cas3 (N\xa0=\xa022)', 'P-value (unadjusted)', 'Feature?', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9')	1
('Variable', 'Age (y)', 'Cas1 (N\xa0=\xa088)', 'Cas2 (N\xa0=\xa0107)', 'Cas3 (N\xa0=\xa022)', 'P-value (unadjusted)', 'Feature?', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9')	1
('Selected predictors for age-5 wheeze', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9')	1
('Permeant cation', 'Cell type', 'A1', 'A2', 'x0', 'Dx')	1
('Characteristic', 'Nagongera', 'Kihihi', 'Walukuba')	1
('Unnamed: 0', 'All data', 'aEIR\xa0≥\xa05 (n\xa0=\xa05047)', 'aEIR\xa0<\xa05 (n\xa0=\xa0593)')	1
('Candidate gene', 'Protein information and references', 'Allele(s)', 'Animals with defasciculated amphid bundles (percent, n\xa0=\xa050)')	1
('Unnamed: 0', 'WT', 'emx2 ko major', 'emx2 ko minor', 'emx2 gof major', 'emx2 gof minor')	1
('Strains, reagent type or resource', 'Designation', 'Source or reference', 'Identifiers')	1
('Unnamed: 0', 'Arrhythmia', 'Myocardial infarction', 'Heart failure', 'Combined')	1
('Reagent type species', 'Designation', 'Source or reference', 'Identifiers', 'Additional information')	1
('Parent protein', 'NLS-type', 'Reference(s)', 'Cloning method')	1
('Gene symbol', 'Gene ID')	1
('Reactivity', 'Species', 'Company', 'Catalog number')	1
('Distance restraints*', 'Unnamed: 1')	1
('Data collection and processing', 'UbNucleosome-Chd1 complex', 'Nucleosome-2Chd1 complex')	1
('Knowledge domain', 'Variability across repetitions', 'Average distance from ground truth')	1
('Unnamed: 0', 'Scan 1', 'Scan 2', 'Scan 3', 'Scan 4')	1
('Figure', 'Cells', 'Number of embryos', 'number of cells per time point at [−18, −13.5, −9, −4.5, 0, 4.5, 9, 13.5, 18] min')	1
('Figure', 'Panel', 'Embryo genotypes', 'Number of embryos used for quantitative analysis', 'Unnamed: 4')	1
('pANCOVA', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4')	1
('Resource', 'Designation', 'Source\xa0or\xa0reference', 'Identifiers')	1
('Unnamed: 0', 'Categories', 'Schistosoma japonicum', 'Schistosoma haematobium', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9')	1
('Gene name (encodes for)', 'Accession Number', 'Primer Location (nt)', 'Product Length (bp)', 'Annealing Temp (°C)', 'Efficiency Slope', 'Efficiency r2', 'Efficiency %')	1
('Unnamed: 0', 'Unnamed: 1', 'Raptor', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Unnamed: 0', 'Unnamed: 1', 'Rictor', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Plasmid', 'Backbone', 'Insert', 'Ref')	1
('Data set', 'Unnamed: 1')	1
('Unnamed: 0', 'Corresponding amino acid in MtbFtsZ', 'Complementation on plates', 'Complementation in liquid culture')	1
('Unnamed: 0', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Flies for rescue', 'Unnamed: 6')	1
('Structure', 'Cα-Cα RMSD to 2DN2', 'Cα-Cα RMSD to 2DN3')	1
('Unnamed: 0', 'Chemical fixation', 'Cryofixation', 'CryoChem')	1
('Cause', 'Male', 'Female', 'Total', 'Unnamed: 4', 'Unnamed: 5')	1
('Climate region', 'Constituent states', 'Population (2016)', 'Mean annual temperature (1980–2016) (°C)')	1
('2P interval', 'Left P[w+]*', 'Right P[w+]*', 'Length (Mbp)')	1
('2P interval', 'N tested', 'N sterile*', 'N sub-fertile', 'N fertile†', 'Mean fertility†', '% fertile†', 'Mean SR†')	1
('2P interval', 'Sequenced', 'Min size', 'Mean size', 'Max size')	1
('Inference', 'Statistic*', 'D. simulans', 'D. mauritiana', 'P-value')	1
('Unnamed: 0', '400 ybp', '4000 ybp', '40,000 ybp', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('X/A ratio of Ne', 'Rationale', 'E[D]', 'X/A ratio of D')	1
('Sensor', 'Signal to noise ratio (±\xa0SEM)')	1
('Population*', 'Total sequenced reads', 'Mean read length (bp)', 'Read length N50 (bp)', 'Total sequenced bases (Gbp)', 'Reads containing K3L')	1
('Mutation and context (amino acid change)', 'R7.3', 'R9', 'R9.4')	1
('Unnamed: 0', 'Unnamed: 1', 'Unnamed: 2', 'Breakpoint frequency*', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Gene', 'Protein', '# of alleles', 'Mutations')	1
('NOLC1 CK2 mutant', 'Amino acids mutated to R')	1
('Fragment', 'Amino acids', 'Sequence')	1
('qPCR primer', 'Sequence')	1
('Strain', 'Species', 'Description')	1
('qPCR primers description', 'Sequence')	1
('Processing step', 'Details', 'Time (hours)')	1
('Unnamed: 0', '6ERM', '6ERN', '6ES8')	1
('NCBI allele name', 'DFT1', 'DFT2', 'TD_RV', 'TD_818', 'TD_SN')	1
('Primer list', 'Primer sequence (5′ → 3′)')	1
('G', 'C', 'C.1', 'A', 'U', 'C.2', 'A.1', 'A.2', 'A.3', 'G.1', 'C.3', 'U.1', 'U.2', 'G.2', 'A.4', 'G.3', 'A.5', 'G.4', 'C.4', 'A.6')	1
('Process', 'Gene name', 'Function (summarized from www.genecards.org)')	1
('Intervention arm', 'Efficacy', 'Synergy', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Resource type (species) or resource', 'Designation', 'Reference', 'Identifiers')	1
('Unnamed: 0', 'L', 'v', 'Np\u2005−\u2005ori', 'ρ0', 'Imax', 'Ref.')	1
('Gene', 'Primer', 'Seq 5’→ 3’', 'Tm (°C)', 'Amplicon size (bp)', 'Location')	1
('Mutation', 'Seq 5’→ 3’', 'Tm (°C)')	1
('Pixel binning', '1 × 1', '2 × 2', '3 × 3')	1
('Compound', 'Fold change (Treated/Control)', 'P value')	1
('Probename', 'Fold change', 'Human_BestHit', 'blast2GO_Description', 'Unnamed: 4', 'Unnamed: 5')	1
('Hv_Sym\xa0>\xa0Hv_Apo, Hv_NC64A', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Probename', 'Hv_NC64A/ Hv_Sym', 'Hv_Apo/ Hv_Sym', 'Hv_Sym_sexy/ Hv_Sym', 'Blast2GO description')	1
('Hv_Sym\xa0>\xa0Hv_Apo', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4')	1
('UniProt ID in C169', 'Description')	1
('Conclusion', 'Stimulus/perturbation', 'Pathway', 'Readout', 'Cell type', 'References')	1
('Mouse NS cells (ANS4)', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3')	1
('Cell type', 'Gene', 'Colonies picked', 'V5 positive (ICC)', 'Correctly targeted (PCR)', 'Bi-allelic clones by PCR (% of total V5 positive)')	1
('iRhom1', 'Vector', 'iTAP', 'TNF', 'STING', 'SREBP2')	1
('iRhom2', 'Vector', 'iTAP', 'TNF', 'STING', 'SREBP2')	1
('Developmental stage', 'iTAP +/+', 'iTAP +/-', 'iTAP -/-', 'Total no. of animals')	1
('Unnamed: 0', 'Egg package', 'Individual eggs', 'Planulae', 'Primary polyps', 'Adults (body exposed)', 'Adults burrowed in the substrate')	1
('Prot. ID', 'Protein name', 'Gene', 'p-value', 'Adjusted p-value')	1
('Unnamed: 0', 'PepTSh (PDB: 6EXS)')	1
('Unnamed: 0', 'Cond vs Enr', 'PC vs Non-Enr', 'PC vs Enr', 'PC vs Cond', 'Cond vs Non-Enr', 'Enr vs Non-Enr')	1
('Exp. ID', 'Reference', 'Feature', 'Set size(s)', 'Probing probability', 'Number of subjects')	1
('Experiment', 'β', 'λ', 'τ')	1
('Model with which the main model is compared', 'AIC difference', 'Cross-validation log likelihood difference')	1
('Study', 'Optimized quantity', 'Performance term', 'Resource cost/constraint')	1
('Reagent type', 'Reagent', 'Source', 'Cat. no.', 'Additional information')	1
('Reagent type', 'Designation', 'Source or reference', 'Identifiers', 'Additional')	1
('Strain Abbreviation*', 'Ancestor (source)†', 'Genotype', '# UAG Codons‡', 'RF1 Status§', 'Ribosomal rescue gene deletion', 'ssrA tag Status#', 'Investigated in')	1
('Library component', 'Example peptides (from Figure 2A)', 'Enables detection of…', 'Complete peptide list')	1
('Reagent type (species) or resource', 'Designation', 'Source or reference', 'Identifiers', 'Additional information', 'Isaacs Lab Reference #', 'Full genotype of strains', '# UAG Codons', 'RF1 status', 'Ribosomal rescue gene knockout', 'ssrA tag status')	1
('Parameter', 'Definition', 'Values')	1
('Agent', 'Company', 'Injection route', 'Volume', 'Concentration (Vehicle)', 'N of mice')	1
('Year', 'Main serotype', 'Reported cases', 'Seroprevalence', 'Source')	1
('Test', 'N', '2013', '2013 (%)', '2015', '2015 (%)', 'Difference')	1
('Variable', 'Number', 'Odds ratio', 'p value')	1
('Age', 'N', 'Propn infected based on ELISA values', 'Seronegative', 'Seroconverted', 'Seroconverted (%)')	1
('Model', 'Serological data', 'AIC', 'ΔAIC', 'DIC', 'ΔDIC')	1
('Parameter', 'MIA', 'ELISA')	1
('Parameter', 'Definition', 'Prior', 'Source')	1
('Model', '$\\overset{¯}{W}\\left( \\overline{z} \\right)$', '$M_{s}\\left( \\overline{z} \\right)$')	1
('GENE', 'Description', 'Ab T', 'Ab C', 'LOG2', 'Funct')	1
('Unnamed: 0', 'Comparison of initial rates* @ 200 µM GTP (µmol product min−1 µmol−1 enzyme2)', 'Unnamed: 2', 'Unnamed: 3')	1
('CRITICAL THINKING SKILLS', 'MILESTONES', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5')	1
('Strain', 'Parent', 'Genotype', 'Gene function', 'Reference')	1
('AC', 'Anterior commissure')	1
('Unnamed: 0', 'Unnamed: 1', 'Region', 'Mean(SEM), p value', 'Unnamed: 4', 'Unnamed: 5')	1
('Unnamed: 0', '3 month', '9 month', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Questionnaire measure', 'β', 'SE', 't', 'p')	1
('Factor analysis-derived symptom score', 'β', 'SE', 't', 'p')	1
('Unnamed: 0', 'Coprolite dimensions', 'Bone dimensions', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10')	1
('Family', 'Genus', 'Species', 'Specimen number')	1
('Position', 'Mutation', 'Role', 'Receptor (PDB ID)')	1
('Mutation', 'CompoMug module', 'aSEC* quality', 'Tm (oC)\xa0±\xa0SEM', 'ΔTm (C)')	1
('Unnamed: 0', 'EC50 (µM) [conf. int.]* Maximal Degree of Modulation (% of control)†', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('Unnamed: 0', 'EC50 (µM) [conf. int.]* Maximal Degree of Modulation (% of control)†', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4')	1
('GluN2C', 'Glu/Gly (µM)', 'Relative agonist Response* (% of maximal response)', 'Modulation by 10 µM† (% of control)')	1
('Unnamed: 0', 'EU1794-2 IC50 (µM) [conf. int.]*', 'EU1794-27 EC50 (µM) [conf. int.]*', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('Unnamed: 0', 'EC50 (µM) [conf. int.]* Maximal Modulation Extent (% of control)', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4')	1
('Plant genotype', 'Used in the following figure')	1
('Unnamed: 0', '129SVsl', 'C57BL/6J', 'Unnamed: 3', 'Unnamed: 4')	1
('Microscopic', 'Physical', 'Associated', 'Relation to')	1
('System', 'Fit parameters', 'Range that fits data')	1
('Scope ID', 'Age', 'Sex', 'Ethnicity', 'CD4 Count', 'Duration of infection (years)', 'ART regimen', 'Duration of ART (years)', 'Peak reporter VL (copies/ml−1)')	1
('Tissue', 'Type', 'Species', 'Sex', 'Replicates', 'Aligned reads (Millions)')	1
('Activated TF', 'Top 25 TFs', 'Interacts with functionally significant muscle genes:')	1
('Name', 'Specificity/Purpose/Phenotype', 'Reference')	1
('Variable', 'Explanation', 'Default value')	1
('Reagent type species or resource', 'Designation', 'Source or reference', 'Identifiers', 'Additional information')	1
('Unnamed: 0', 'Ouelessebougou, Mali', 'Bobo Dioulasso, Burkina Faso', 'Balonghin, Burkina Faso', 'Yaoundé, Cameroon')	1
('Gene target', 'Forward primer', 'Reverse primer')	1
('Model', 'ΔAIC', 'LogLikelihood', 'nParams', 'Stringency', '$\\overline{\\omega}$', 'ωα', 'ωβ', 'Nsites ωr\u2004>\u20041', 'Nsites ωr\u2004<\u20041')	1
('Animal name', 'Labeling attempts from single neurons', 'Modulated neurons', 'Recovered neurons')	1
('Cell name', 'TV58g', 'TV50a*', 'MS14i', 'MS19b', 'AJ50h', 'AJ50j', 'AJ44j', 'MS74b*', 'MS17k**', 'Unnamed: 10')	1
('Marker gene', 'Gene product', 'Expression profile', 'Reference')	1
('Target ID', 'Location', 'PV', 'SATB1', 'mGluR1a', 'Endo-biotin', 'CCK', 'CB', 'nNOS', 'Figure')	1
('Animal name', 'Cell ID', 'Recording conditions', 'Training', 'Monitoring', 'Mouse activity')	1
('Cell name', 'MS17k*', 'MS58i*', 'MS24a', 'MS84f', 'TV78d', 'TV78k', 'TV85e', 'TV86b')	1
('Cell name', 'MS17k*', 'MS58i**', 'MS24a', 'MS84f', 'TV78d', 'TV78k', 'TV85e', 'TV86b', 'Unnamed: 9')	1
('Cell name', 'TV77q', 'TV78l', 'Unnamed: 3')	1
('Molecule', 'Host', 'Dilution', 'Source', 'Specificity information', 'RRID')	1
('Unnamed: 0', 'Fluoresence/Time (V0)', 'Unnamed: 2')	1
('Monkey', 'Left hemisphere remaining volume', 'Right hemisphere remaining volume', 'Bilateral remaining volume', 'Left hemisphere lesion %', 'Right hemisphere lesion %', 'Total lesion %')	1
('Unnamed: 0', 'Unnamed: 1', 'T1-weighted', 'Resting-state', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('Unnamed: 0', 'Unnamed: 1', 'Hippocampus', 'Left', 'Right', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10')	1
('Regional map abbreviation', 'Brain area')	1
('Library', 'Template PDB entry/target', 'Binding interface in template', 'Length of CDR3', 'Number of randomized residues in library', 'Theoretical diversity of library')	1
('Vector name', 'Description', 'Resistance marker', 'Addgene ID')	1
('Unnamed: 0', 'Sb_MBP#1 (PDB: 5M13)', 'Sb_MBP#2 (PDB: 5M14)', 'Sb_MBP#3 (PDB: 5M15)')	1
('Sybody', 'kon [M−1S−1]', 'koff [s−1]', 'KD [M] (kinetics)', 'KD [M] (equilibrium)', 'ΔTm(SPA-TS) [°C]', 'SPA signal (fold increase)')	1
('Primers for library assembly (triplets designated 111, 222 and 333 correspond to the trinucleotide mixtures 1–3 for randomization; all primers in 5’ to 3’ orientation)', 'Unnamed: 1')	1
('Library', 'CDR', 'Randomized primer', 'Megaprimer', 'Assembly primer', 'Outer primers')	1
('Family', 'Target', 'Mode of action', 'Company', 'Structure')	1
('Assays', 'Scope', 'Timing')	1
('PDZ homolog', 'Ligand', 'Ligand sequence', 'Affinity', 'Top ID% (PDZ)', 'No. of single mutants (out of 171)', 'No. of double mutants (out of 12,996)', 'Mean cycles/position pair (out of 361)', 'Sequence readsunsel/sel')	1
('Monophyly Tested', 'Tree file', 'CONSEL p-AUa')	1
('Item', 'Growth stages', 'Pooled SEM', 'P values', 'Unnamed: 4')	1
('Serum component', 'TG (n\xa0=\xa010)', 'WT (n\xa0=\xa022)', 'Pooled SEM', 'P value')	1
('HIV-1NL4-3', 'k1→2 (s−1)', 'k2→1 (s−1)', 'k2→3 (s−1)', 'k3→2 (s−1)')	1
('Unnamed: 0', 'sCD4', 'sCD4D1D2-Igαtp', 'Unnamed: 3', 'Unnamed: 4')	1
('Sample #', 'Sample name', 'Grid type', 'Ice thickness (center, edge, substrate) in nm\xa0±\xa0a few nm', '# of Layers (center, edge, substrate)', 'Apparent preferred orientation in layer?', 'Min. particle/layer distance from air- water interface (nm\xa0±\xa0a few nm)', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10')	1
('Sample #', 'Sample name', 'Air-water interface, particle behavior, and layer/ice angle (bottom, center)', 'Air-water interface, particle behavior, and layer/ice angle (bottom, edge)', 'Ice behavior (bottom)', 'Air-water interface, particle behavior, and layer/ice angle (top, center)', 'Air-water interface, particle behavior, and layer/ice angle (top, edge)', 'Ice behavior (top)', 'Notes')	1
('Reagent type', 'Designation', 'Source or reference', 'Identifier', 'Additional information')	1
('Gene family ID', 'Representative gene name(s)', 'Pathway/Function')	1
('Unnamed: 0', 'r', 'P')	1
('Single-cell, Broad STDP', 'r', 'P')	1
('Reagent type (species ) or resource', 'Designation', 'Source or reference', 'Identifiers', 'Additional information')	1
('Protein', 'Observed m/z', 'Calculated m/z*', '∆obs.- calc.')	1
('Peptidisc', 'Molecular weight measured by ESI-MS (kDa)', 'Measured NSPr stoichiometry (NSPr/disc)', 'Measured lipid stoichiometry (Lipid/Disc)', 'Calculated molecular weight* \xa0(kDa)')	1
('Unnamed: 0', 'Measured molecular weight (kDa)*', 'Measured diameter †', 'Calculated stoichiometry (scaffold/disc)‡')	1
('Genotype', 'Log phase', '7.5 hr', '24 hr', '48 hr')	1
('Reagent type (species)', 'Designation', 'Source or reference', 'Identifiers', 'Add. info.')	1
('Construct', 'For/', 'Sequence', 'Restriction sites', 'Vector', 'Anneal temp (°C)', 'Extend time (s)')	1
('Reagent type (species) or resource', 'Designation', 'Source or reference', 'Identifiers', 'Add. info.')	1
('Unnamed: 0', 'Gene', 'log2 fold_change')	1
('Zebrafish line', 'FW', 'RV', 'Restriction enzymes')	1
('Zebrafish line', 'FW X', 'FW Y', 'RV')	1
('Unnamed: 0', 'Unadjusted', 'Adjusted for age', 'Unnamed: 3', 'Unnamed: 4')	1
('Simulation no.', 'Content', 'Related figures', 'Video no.')	1
('α', '5')	1
('Gene name', '(S/T)x(I/L)P-containing sequence (position)')	1
('Gene locus ID', 'Gene name', 'log2 Fold', 'Identification method', 'Region(s)', 'Description', 'Interacting nucleotides')	1
('Reagent type', 'Designation', 'Source or reference', 'Identifier')	1
('Unnamed: 0', 'mouse Piezo1 (EMDB-7042) (PDB 6B3R)')	1
('Pathway', 'Systems where graded response has been observed', 'References')	1
('Primer name', "Primer sequence (5'−3')", 'Purpose')	1
('Reaction', 'Rate', 'Stoichiometry')	1
('Reaction', 'Rate')	1
('Variable', 'Placebo (n\xa0=\xa041)', '81 mg Aspirin (n\xa0=\xa039)', '1000 mg aspirin (n\xa0=\xa040)')	1
('Unnamed: 0', 'Placebo (n\xa0=\xa041)', 'Aspirin 81 mg (n\xa0=\xa039)', 'Aspirin 1000 mg (n\xa0=\xa040)', 'Absolute risk difference [%] (95% confidence interval)', 'Overall comparison P-value')	1
('Unnamed: 0', 'Placebo (n\xa0=\xa036)', 'Aspirin81mg (n\xa0=\xa031)', 'Aspirin1000mg (n\xa0=\xa031)', 'Absolute risk difference [%] (95% confidence interval)', 'Overall comparison P-value')	1
('Unnamed: 0', 'Placebo (events/n (risk%))', 'Aspirin 81 mg (events/n (risk%))', 'Aspirin 1000 mg (events/n (risk%))', 'P-value comparison', 'P-heterogeneity')	1
('Unnamed: 0', 'Placebo (N\xa0=\xa041)', 'Aspirin 81 mg (N\xa0=\xa039)', 'Aspirin 1000 mg (N\xa0=\xa040)', 'P-value')	1
('Event', 'Placebo (n\xa0=\xa041) No. patients (%) (number of events)', 'Aspirin 81 mg (n\xa0=\xa039) No. patients (%) (number of events)', 'Aspirin 1000 mg (n\xa0=\xa040) No. patients (%) (number of events)', 'P-value comparison')	1
('Protein', 'Replicate 1 (E160307)', 'Replicate 2 (E161126)', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10')	1
('Protein', 'Replicate 1 (E150924)', 'Replicate 2 (E151106)', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10')	1
('Protein', 'Replicate 1 (E160419)', 'Replicate 2 ((E161127)', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10')	1
('Protein', 'Replicate 1 (E170214)', 'Replicate 2 (E170306)', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10')	1
('Data collection and processing', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4')	1
('Group', 'Erev[Cl-]o148.5 mM(mV)', 'Erev[Cl-]o48.5 mM(mV)')	1
('Organism', 'Ref.', 'System name', 'Efficiency')	1
('G3 crosses', 'D', 'T', 'Reference')	1
('G4 larvae', 'D', 'T', 'Reference')	1
('Unnamed: 0', 'Gene names', 'Human Uniprot ID', 'Final Fold Change', 'FMRP targets and ASD genes', 'Unnamed: 5', 'Gene names.1', 'Human Uniprot ID.1', 'Final Fold Change.1', 'FMRP targets and ASD genes.1', 'Unnamed: 10', 'Unnamed: 11')	1
('stereology #', 'Unnamed: 1', '1', '2', '3', '4', '5')	1
('Cell type', 'Wild-type', 'Mutant')	1
('Figure', 'Statistical methods')	1
('Variables', 'Value')	1
('Unnamed: 0', 'Cm (pF)', 'Rm (MΩ)', 'RP (mV)', 'N')	1
('Protein name (Gene ID)', 'Peptide number (Exp1\xa0+\xa0Exp2+Exp3)')	1
('Description', 'Max score', 'Total score', 'Query cover', 'E value', 'Ident', 'Accession')	1
('Regulated gene/region', 'Forward primer', 'Reverse primer')	1
('Node name', 'Monte-Carlo p', 'Sum (t)', 'Cluster volume in mm3', 'Label AAL', 'mm3', '% Area in Cluster', 'Max t', 'MNI of max t', 'EGG-BOLD shared Variance\xa0±\xa0sem', 'Unnamed: 10', 'Unnamed: 11')	1
('Unnamed: 0', 'Gender', 'BMI', 'Stai A', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9')	1
('Unnamed: 0', 'glk', 'elk', 'gNa', 'eNa', 'gKf', 'eKf', 'gKs', 'eKs')	1
('dIN / non−dlN', 'Rate Function', 'A (ms -1)', 'B (ms−1mV−1)', 'C (−)', 'D (mV)', 'E (mV)')	1
('X', 'NMDA', 'AMPA', 'INH')	1
('siRNA gene target M, Mus musculus; h, human', 'ThermoFisher Silencer ID', 'siRNA location', '% Knockdown efficiency')	1
('External solution', 'pIMCD, whole-cilium', 'HEK-293 PKD2-GFP, whole-cilium', 'Unnamed: 3', 'Unnamed: 4')	1
('Gene, m, Mus musculus; H, human', 'Forward primer 5’−3’', 'Reverse primer 5’−3’')	1
('Unnamed: 0', 'Gene', 'Median seed corrected Z-score', 'p-Value', 'Rank')	1
('Unnamed: 0', 'dHP', 'I/vHP', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Reagent type (species) or resource', 'Designation', 'Source of reference', 'Identifiers', 'Additional information')	1
('Group', 'Transfected', 'GNR-710', 'GNR-860', 'Number of animals')	1
('Gene', 'RPKM', 'Unnamed: 2', 'Unnamed: 3')	1
('Analysis method', 'DFREE', 'FBOUND', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Unnamed: 0', 'CPSF160-WDR33', 'Unnamed: 2', 'Unnamed: 3')	1
('CPSF variant', 'KD AAUAAA RNA', 'KD AAGAAA RNA')	1
('Conditions tested', 'Protocol', 'SSII, V30, 30 cycles', 'SSII, T30, 30 cycles', 'SmSc, T30, 30 cycles', 'SSII, T30, 25 cycles', 'SmSc, T30, 25 cycles', 'SmSc, T30, 25 cycles.1', 'SmSc, T30, 25 cycles.2', 'SmSc, T30, 25 cycles.3')	1
('Statistical comparison', 'Ipsi p-Value', 'Contra p-value')	1
('Experimental condition', 'VR (mV)', 'RIN (GΩ)', 'CM (pF)', 'Tau (ms)')	1
('Group', 'Environmental stimulation', 'Compared to')	1
('Unnamed: 0', 'CrIFT801-654 EMP soak', 'CrIFT80 (fl) native')	1
('Data-collection parameters', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5')	1
('Covariate', 'Total', 'Infected (%)', '(95% CI)')	1
('Cluster Number', 'Radius (km)', 'Log-Likelihood', 'P-value', 'Prevalence (%)', 'Relative Risk')	1
('Unnamed: 0', 'Model 0: Univariate', 'Model 1: Community coverage', 'Model 2: Household access', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9')	1
('Unnamed: 0', 'Model 1: Community-level coverage of piped water', 'Model 2: Household level access to piped water', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9')	1
('Primer name', 'Sequence', 'Description')	1
('Unnamed: 0', 'Y0', 'K', 'Tau', 'Doubling time (hours)', 'R∧2')	1
('CDR3aa', 'V-segment', 'J-segment', 'Antigen source', 'Ref.')	1
('CDR3aa', 'V', 'J', 'Ag.source .', 'p-value rank', 'p-value', 'Effect size')	1
('Lineage', 'Maturity', 'Pdb id (Å)')	1
('Unnamed: 0', 'Simulation driven by true subject variability in:', 'Network matrix', 'Amplitude', 'Spatial map', 'Z network matrix', 'R correlation', 'CCA R U-V', 'Cca P U-V', 'CCA R U-Uica')	1
('Average inoculum size', 'Standard deviation', 'Percent variation')	1
('Unnamed: 0', 'HOXB13-DNATCG', 'HOXB13-DNACAA', 'CDX2-DNATCG', 'CDX2-DNACAA')	1
('Zone and condition', 'Tpp (hours)', 'Tpn (hours)', 'Tnn (hours)', 'Tc (hours)')	1
('Unnamed: 0', 'S-phase', 'Unnamed: 2', 'Long G1', 'Unnamed: 4', 'ND', 'Unnamed: 6', 'Total')	1
('Gene', 'SNP id', 'Description', 'Allele', 'p-value', '%YRI', '%TSI')	1
('Population', 'Population compared to', 'Total no. sequences', 'No. sequences with length≥1000bp', 'Total length in sequences with length≥1000 bp', 'No. sequences with length≥200bp', 'Total length in sequences with length≥200bp')	1
('Gene', 'SN id', 'Variant type', 'Allele', 'p-value', '%BEB', '%TSI')	1
('Gene', 'SNP id', 'Variant type', 'Allele', 'p-value', '%BEB', '%TSI')	1
('Treatment', 'Macrophage RAE-1δ induction?')	1
('Locus genotype', 'Early/Mid-s', 'Late S/G')	1
('Description', '% Total Sensations (381 total)', 'Amplitude μA (mode)', 'Amplitude μA (25th, 75th percentile)', 'Intensity (mode)', 'Intensity (25th, 75th percentile)')	1
('Unnamed: 0', 'Y608 peptide complex', 'Y628 peptide complex', 'Y658 peptide complex')	1
('Reagent type (species) or resource', 'Designation', 'Source or reference', 'Indentifiers', 'Additional information')	1
('Signaling pathways', 'Outcome')	1
('Journal', 'Sci-Hub', 'Crossref', 'Coverage')	1
('Immunisation type', 'Strategy name', 'Strategy targets')	1
('CANASTRA', 'Immune ■ and Susceptible ■ Species in the Immunisation Strategies ↓', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('PANTANAL', 'Immune ■ and Susceptible ■ Species in the Immunisation Strategies ↓', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('Parameter', 'Simulation', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('C. elegans gene name', 'Description', 'Mammalian gene name')	1
('Parameter', 'Hs NM2C-ADP⋅VO4')	1
('Myosin', 'Residue', 'Residue.1', 'Residue.2', 'Residue.3', 'Parameter', 'Unnamed: 6', 'Unnamed: 7')	1
('Parameter', 'Signal or calculation', 'NM2C', 'R788K', 'R788E')	1
('Myosin', 'kcat/Kapp', 'k+AD/K1k+2', 'KAD/KD', 'k-AD/ k-D', 'KDA/KA', 'Duty ratio')	1
('Unnamed: 0', 'Total NO subj. (excluded)', 'Age (SD)', 'Gender M /F', 'Experimental task')	1
('Perceived intensity', 'EEG experiment', 'TMS experiment\xa0per session', 'Unnamed: 3', 'Unnamed: 4')	1
('eIF2B subunit', 'Mutation', 'Age of disease onset (years)', 'Disease alleles', 'HEK293T cells generated', 'Recombinant protein generated')	1
('Unnamed: 0', 'Major axis (nm)', 'Minor axis (nm)', 'Feret’s major axis (nm)', 'Feret’s minor axis (nm)', 'Objects counted', 'Cells imaged')	1
('Defocus', 'Unnamed: 1')	1
('Unnamed: 0', 'NADPH/NADP+', 'NAD+ (µM)', 'Unnamed: 3', 'Unnamed: 4')	1
('Unnamed: 0', 'Normalized FRET ratio (TMR/FRET)', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4')	1
('Substrate name', 'Reaction rate constant (M−1 s−1) (±\xa0SD)', 'Excitation maximum (nm)', 'Emission maximum (nm)', 'Lifetime* (ns)')	1
('Localization', 'Concentration (µM) (±\xa0SD)', 'N cells')	1
('Cell lines', '[NADPH]/[NADP+]', '[NAD+] (µM)')	1
('Unnamed: 0', 'Free [NAD+] (µM)', 'Free [NADPH]/[NADP+] ratio', 'Unnamed: 3', 'Unnamed: 4')	1
('Sample', '<τ> (ns)\xa0±\xa0SD', 'E (%)\xa0±\xa0SD')	1
('Sensors', 'Localization', '<τ> (ns)\xa0±\xa0SD', 'E (%)\xa0±\xa0SD (Basal)', 'Emin (%)\xa0±\xa0SD (2 mM SPY)', 'Unnamed: 5', 'Unnamed: 6')	1
('Unnamed: 0', 'First survey', 'Second survey', 'Third survey')	1
('Behavior', 'Train', 'Withheld', 'Test', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12', 'Unnamed: 13', 'Unnamed: 14', 'Unnamed: 15', 'Unnamed: 16', 'Unnamed: 17', 'Unnamed: 18')	1
('Gene', 'Function', 'LR1', 'LR2', 'LR3', 'LR4', 'LR5')	1
('Gene', 'Function', 'LJ2', 'LJ3', 'LJ4', 'LJ5')	1
('Gene', 'Functional group', 'Mutation type')	1
('Antibody', 'Characteristics', 'Producer')	1
('Region (cluster)', 'Z score', 'X', 'Y', 'Z', 'K voxels', 'P')	1
('Genotype', 'Frequency of intercalation (%)', 'n', 'Unnamed: 3', 'Unnamed: 4')	1
('Ligand', 'kobs\xa0±\xa0SEM (min−1)', 't1/2ass (sec)', 'koff (min−1)', 't1/2dis (sec)', 'N')	1
('Morphine (1 µM Nb39)', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5')	1
('Reagent type (species) or resource', 'Designation', 'Sourcor reference', 'Identifiers', 'Additional Information')	1
('m', 'ICC', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4')	1
('None', 'Short RT', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9')	1
('None', 'Short RT', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11')	1
('Unnamed: 0', 'KATP with Mg2+-ATP', 'Unnamed: 2')	1
('Amino acid', 'Codon', 'geCAI codon weight', 'Amino acid.1', 'Codon.1', 'geCAI codon weight.1')	1
('Chr', 'Position', 'Gene', 'cDNA variant', 'Protein variant')	1
('University of Chicago – two postdoc designations – one common experience', 'Unnamed: 1', 'Unnamed: 2')	1
('Week', 'Monday', 'Tuesday', 'Wednesday', 'Thursday', 'Friday', 'Saturday', 'Sunday')	1
('Unnamed: 0', 'Fixation', 'MM', 'Green', 'Red', 'CAx (nm)', 'CAy (nm)', 'CAz (nm)', 'N')	1
('Methods', 'Green', 'Red', 'Delta (nm)', 'S(2D) (nm)', 'S(3D) (nm)', 'ML2D (nm)', 'ML3D (nm)', 'n')	1
('A', 'Unnamed: 1', 'Green', 'Red', 'Delta nm)', 'S(2D)(nm)', 'S(3D) (nm)', 'Z-offset (nm)', 'zS(3D) (nm)', 'Unnamed: 9')	1
('Method', 'Pre-fixation', 'Pre-perme- abilization', 'Fixation', 'Quenching', 'Post-perme- abilization', 'Primary antibody', 'Secondery anitbody', 'References (use for nm-resolution analysis)')	1
('Unnamed: 0', 'Red-Green\xa0= mean ± S.D. nm', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('A', 'Unnamed: 1', 'Unnamed: 2', 'Delta (nm)', 'S(2D) (nm)', 'S(3D) (nm)', 'ML2D (nm)', 'ML3D (nm)', 'α (°)', 'β (°)')	1
('Unnamed: 0', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Delta (Mean\xa0±\xa0SD nm)', '3D separation (Mean\xa0±\xa0SD nm)')	1
('Unnamed: 0', 'Articles reporting that MELK expression is up-regulated in various human cancers', 'Articles reporting an association between increased MELK expression and poor clinical prognosis', 'Articles reporting efficacy of MELK-targeted RNAi in cancer cell lines and/or xenograft tumor models', 'Articles reporting efficacy with small-molecule inhibitors of MELK in cancer cell lines and/or xenograft tumor models', 'Articles that made use of the MELK inhibitor OTS167 (also known as OTSSP167)')	1
('Morphological properties', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3')	1
('Intrinsic electrophysiological properties', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3')	1
('Mouse primers', 'Unnamed: 1', 'Oligonucleotide sequences (5’−3’)')	1
('[ATP] (µM)', 'Force Interval (pN)', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12')	1
('Unnamed: 0', 'MOR1', 'Unnamed: 2', 'Unnamed: 3')	1
('Unnamed: 0', 'Unnamed: 1', 'Unnamed: 2', 'Mouse', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Unnamed: 0', 'Cell type', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4')	1
('Unnamed: 0', 'Unnamed: 1', 'Unnamed: 2', 'Mouse', 'Unnamed: 4', 'Unnamed: 5')	1
('Unnamed: 0', 'Unnamed: 1', 'Unnamed: 2', 'Trial type', 'Unnamed: 4')	1
('Unnamed: 0', 'Postnatal day', 'Rin (MΩ)', 'Threshold (mV)', 'Amplitude (mV)', 'Half-width (ms)', 'AHP (mV)')	1
('Gene symbol', 'Gene name', 'Function', 'cNPC-enriched in', 'Occurrence', 'Features')	1
('Image size', 'Object', 'Histogram and', 'Point with most uniform distribution', 'Unnamed: 4')	1
('Primer name', 'Sequence')	1
('Strain or plasmid', 'Relevant genotype or description', 'Source or reference')	1
('siRNA id', 'Position', 'SS sequence (Passenger)', 'AS sequence (Guide)', 'Corrected score')	1
('siRNA _id', 'Position', 'SS sequence (Passenger)', 'AS sequence (Guide)', 'Corrected score')	1
('siRNA name and sequence', 'Oligo name', 'Oligo sequence (5’ – 3’)')	1
('Unnamed: 0', 'Grade', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5')	1
('Variable name', 'Units', 'Died', 'Survived', 'Association with death', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10')	1
('Clinicopathological investigation (per MR feature)', 'Number of cases analysed', 'Number of retinal layers analysed', 'Number of vessels counted')	1
('Case n.', 'MR* Grade', 'Eye†', 'Vessel changes', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11')	1
('Unnamed: 0', 'Orange discolouration', 'Unnamed: 2', 'Unnamed: 3')	1
('Retinal vessel', 'Sequestration', 'Died*', 'Survived*', 'Association with death', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10')	1
('Antigen', 'Specificity', 'MR feature', 'Manufacturer (clone); RRID*', 'Host† (class)', 'Ag retrieval‡', 'Dilution§', 'Chromogen#', 'Staining quantification', 'Ref')	1
('Unnamed: 0', 'Concentration (nM)', 'Polymerase exchange (%)*', 'Lag time (s)†', 'Lifetime (s)‡', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('Unnamed: 0', 'Unnamed: 1', 'Unnamed: 2', 'Polymerase exchange (%) *', 'Unnamed: 4', 'Unnamed: 5')	1
('Unnamed: 0', 'Lifetime (s)', 'Polymerase exchange† (%)', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5')	1
('DNA', 'Concentration (nM)', 'Polymerase exchange (%)', 'Lifetime', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Structure', 'Head angle (°)', 'Arm angle (°)', 'Antero-post (mm)', 'Medio-lateral (mm)', 'Depth\xa0(mm)')	1
('Gender', 'n', '%', 'Ten-gene multiplex positive', 'TERT positive', 'Aneuploidy positive', 'UroSEEK positive', 'Cytology positive*', 'Uroseek or cytology positive*')	1
('Unnamed: 0', 'N', '%', 'Ten-gene multiplex positive', 'TERT positive', 'Aneuploidy positive', 'UroSEEK positive')	1
('Characteristics', 'CoQhigh (n\xa0=\xa011)', 'CoQlow (n\xa0=\xa022)', 'P value')	1
('Unnamed: 0', 'Gene ID', 'Short name', 'Annotation from', 'Description', 'Enrichment', 'Unnamed: 6')	1
('Unnamed: 0', 'Gene ID', 'Short name', 'Annotation from', 'Description', 'Cluster', 'Enrichment', 'Unnamed: 7')	1
('Media', 'Time', 'Sucrose range (Density)*', 'Average density ±StDev', 'High buoyancy fractions (Density)', 'Median buoyancy fractions (Density)', 'Low buoyancy fractions (Density)')	1
('Peak #', 'Compound identification', 'Retention time (min)', 'Modified Kovats index')	1
('Peak #', 'Compound', 'KW H (df\xa0=\xa02)', 'Corrected KW p\xa0value', 'Post-hoc comparison', 'Adjusted p\xa0value')	1
('Post-hoc comparison', 'Corrected p\xa0value', 'Unnamed: 2')	1
('Primer', 'Sequence', 'Amplicon length', 'Annealing temperature')	1
('Strain', 'Relevant Genotype/markers', 'Source')	1
('Plasmid', 'Relevant genotype/markers', 'Source')	1
('Oligonucleotide name', 'Sequence (5’ to 3’)')	1
('Unnamed: 0', 'DL-GluK1', 'DL-GluK2', 'DL-GluK3', 'DL-GluK4', 'DL-GluK5')	1
('Unnamed: 0', 'EGFP-GluA1', 'DL-GluA2', 'UL-GluA3', 'EGFP-GluA4')	1
('Symbol', 'Definition', 'Value')	1
('Unnamed: 0', 'Estimate', 'Units')	1
('Medium', 'Dilution', 'Latent period', 'Burst size', 'Burst size/hour')	1
('Parameter', 'Unnamed: 1', 'Value', 'Units', 'Comment')	1
('Variable', 'Lower bound', 'Upper bound')	1
('Model', 'Cluster', 'Figure', 'BX', 'βX', 'αX', 'KAX', 'HAX', 'KBX', 'HBX', 'KYX', 'HYX', 'Error')	1
('Part name', 'Digikey part number', 'Current price ($)', 'Quantity')	1
('Line', 'Connection')	1
('Pin', 'Connection')	1
('Strain', 'Genotype', 'Reference or source')	1
('Plasmid', 'Description', 'Reference or source')	1
('Chromatin States', 'Total number of states', 'T2D log2FE (CI)', 'FG log2FE (CI)')	1
('Variant', 'Locus', 'DIAGRAM P-value', 'Fgwas \xa0T2D\xa0PPA', 'Allelic imbalance Allele Ratio (Allele #)', 'Allelic imbalance WASP P-value', 'Direction of effect (T2D)')	1
('Classification', 'N', 'Genome length (kb)', 'Percent noncoding (DNA/RNA)', 'Median gene length (bases)', 'Unnamed: 5')	1
('Model (Options)', 'Data fitted (sessions)', 'Parameters', 'Mean', 'Std', 'Initial states')	1
('Model (Options)', 'Data fitted', 'Parameters', 'Mean', 'Std', 'Initial states')	1
('Experiment', 'Rating type', 'Rating timing', 'Avg # of ratings per subject')	1
('Experiment 1 (Instrumental sessions)', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3')	1
('Case', 'Age/Gender', 'Surgical center', 'Disease duration (Years)', 'Predominant symptoms', 'UPDRS med ON/OFF', 'Δ UPDRS [%] Stim ON/OFF*', 'Medication decrease*')	1
('Region', 'Cluster extent', 'Peak z-value', 'X', 'Y', 'Z')	1
('Cluster', 'Perturbation(s)', 'Annotation', 'P-value', 'Proteins with annotation', 'Examples')	1
('Perturbation', 'Direct effect', 'Effect on tuning')	1
('Unnamed: 0', 'Monkey ba', 'Monkey ax', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Unnamed: 0', 'Monkey ba', 'Monkey ax')	1
('Column in Table 2', 'Name', 'Accession', 'NI', 'Subtype')	1
('Immunogen', 'ID', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Env', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12', 'Unnamed: 13', 'Unnamed: 14', 'Unnamed: 15', 'Unnamed: 16', 'NP', 'P', 'Breadth', 'gmID50')	1
('ID#', 'Name', 'Sequence', 'Purpose')	1
('Unnamed: 0', 'MP', 'PW', 'TO')	1
('Adj R2', 'Fibrosis', 'α-tubulin', 'β-tubulin', 'DT-tubulin', 'DT-/α-tubulin', 'MLR (fibrosis/DT)', 'MLR (fibrosis/ratio)')	1
('Adj R2', 'Fibrosis', 'MLR (fibrosis/trans)', 'MLR (fibrosis/long)', 'MLR (fibrosis/long/trans)')	1
('Unnamed: 0', 'WT', 'mdx', 'p47-/-/mdx')	1
('Decision rate model', 'Factor', 'Coefficient', '95% CI', 'R2', 'Unnamed: 5')	1
('Experiment type', 'Colony', '# Ants', 'Starvation period', '# Major Workers', '# Foragers')	1
('Assay', 'Wildtype activity', 'Effect of mutation to:', 'Unnamed: 3', 'Unnamed: 4')	1
('Assay', '[enzyme]', '[nucleotide]', '[DNA]')	1
('Gen', 'Cross', 'Subline', 'Progeny', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11')	1
('Characteristic', 'Autism spectrum disorder', 'Typically developing', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5')	1
('Name', 'Gene symbol', 'NCBI accession number, protein', 'NCBI accession number, mRNA', 'Composite ribosome density', 'Mouse knockout phenotype', 'Other actin isoforms upregulated upon knockout')	1
('Instrument', 'Type', 'Objective', 'Field of view', 'Nominal Resolution*')	1
('Antibody name', 'Target protein', 'Performance', 'Vendor', 'Catalog no.', 'Clone', 'Fluorophore', 'Research resource Identifier')	1
('Step', 'Reagent', 'Supplier', 'Incubation (min)', 'Temp. (°C)')	1
('pene', 'Primer F/R', "Sequence 5' to 3'")	1
('Unnamed: 0', 'Unnamed: 1', 'Natural', '8-channel', '1-channel', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('Unnamed: 0', 'Unnamed: 1', 'Unnamed: 2', 'MNI-coordinates (mm)', 'Unnamed: 4')	1
('Unnamed: 0', 'T. ni', 'B. mori')	1
('Comparison', 'Mean', '95 % c.i.', 'p', 'n', 'Unnamed: 5')	1
('Methyl group', 'Mg2+-free state (0 mM Mg2+)', 'Mg2+-bound state (5.0 mM Mg2+)', 'Unnamed: 3', 'Unnamed: 4')	1
('Clinical outcome', 'Sl2\xa0aORs (95% CI)*', 'P value', 'McCb aORs (95% CI)', 'P value.1')	1
('Clinical Outcomes', 'Sl2\xa0aIRRs† (95% CI)', 'P value', 'McCb aIRRs (95% CI)', 'P value.1')	1
('Unnamed: 0', 'Sl1/Sl1', 'Sl1/Sl2', 'Sl2/Sl2', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Unnamed: 0', 'Controls (Uncomplicated malaria)', 'Cases (Cerebral malaria)', 'P value')	1
('Unnamed: 0', 'Unnamed: 1', 'Sl1/Sl1', '%', 'Sl1/Sl2', '%.1', 'Sl2/Sl2', '%.2', 'P value', 'McCa/McCa', '%.3', 'McCa/McCb', '%.4', 'McCb/McCb', '%.5', 'P value.1')	1
('Adverse events', 'Total', 'LD-SP/SP', 'LD-SP/PIP', 'LD-PIP/PIP', 'LD-PIP/SP', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12', 'Unnamed: 13')	1
('Unnamed: 0', 'LD-SP/SP', 'LD-SP/PIP', 'LD-PIP/PIP', 'LD-PIP/SP', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12')	1
('Unnamed: 0', 'Linear track', 'Rest', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12', 'Unnamed: 13', 'Unnamed: 14', 'Unnamed: 15', 'Unnamed: 16')	1
('Gene name', 'Driver', 'N', 'PhTX', 'RMP', 'Rin', 'mEPSP amplitude (mV)', 'EPSP amplitude (mV)', 'Quantal content')	1
('Wavelength', '0.9724')	1
('Phenotype', 'Age', 'Sex', 'Chr. 14', 'Variant', 'Consequence', 'Code', 'Frequency', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11')	1
('Unnamed: 0', 'Unnamed: 1', 'Value-selective neurons', 'Positively tuned neurons', 'Negatively tuned neurons', 'Visually responsive neurons', 'Total# neurons recorded')	1
('Measurement', 'Value', 'N', 'Unnamed: 3', 'Unnamed: 4')	1
('Amino acid sp2group*', '# PDBs', '# Ligand Groups', 'Ligand Pi-Pi\xa0Contact Frequency (%)', '# Protein Groups', 'Protein contact frequency (%)', 'O/E (Ligand/Protein)')	1
('Residue type', 'Non-catalytic contact frequency (%)', 'Catalytic residue contact frequency (%)', 'N catalytic', 'Enrichment', 'Non-catalytic percent of VDW (%)', 'Catalytic residue percent of VDW (%)', 'Percent of VDW ratio (cat./non)')	1
('Sample', 'Concentration at which phase separation is observed (conditions)', '# F', '# R', 'Total #', 'Mw (Da)')	1
('Positive set', 'AUC (vs. PDB)', 'AUC (vs. Human)', 'AUC (vs. Disprot)')	1
('Training step', 'AUC at training step', 'Sidechain contacts only', 'Backbone contacts only', 'Short-range sidechain only', 'Long-range sidechain only', 'Short-range backbone only', 'Long-range backbone only')	1
('Protein Name', 'Dipeptide enrichment (Percentage of human proteome with lower frequency)', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12', 'Unnamed: 13', 'Unnamed: 14', 'Unnamed: 15')	1
('Phosphosite+ PTM annotation type', 'PTM count threshold', 'Above threshold (N)', 'PScore\xa0>\xa04 (%)', 'Enrichment')	1
('Modification', 'Initial tails', 'Rg (Å)', 'ΔGDNA-tail (kcal/mol)', '% Helicity', '% Sheet', 'Solvent exposed area (Å2)')	1
('Collection/Refinement Parameters', 'T=3', 'T=4')	1
('Parameter name', 'Symbol', 'Model M', 'Model D')	1
('Unnamed: 0', 'UtrCH-stabilized', 'Lat A-treated*', 'SMIFH2-treated', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Unnamed: 0', 'UtrCH injection', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4')	1
('Unnamed: 0', 'Control', 'SMIFH2')	1
('Reagent type or resource', 'Designation', 'Source or reference')	1
('Genotype', 'Novel track cells', 'Familiar track cells', 'Unnamed: 3', 'Unnamed: 4')	1
('Gel slice number', 'Protein', 'Accession', 'Molecular weight', 'Score')	1
('Reagent type', 'Designation', 'Source', 'Identifiers')	1
('Construct', 'Activity', 'Construct.1', 'Activity.1')	1
('Unnamed: 0', 'F80Y', 'F80M', 'F83M', 'T114S')	1
('Plasmid', 'Description', 'Source or reference')	1
('Strain', 'Genotype', 'Source')	1
('Nanodisc', 'Lipid composition')	1
('Parameter', 'Term', 'Response variables', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('Response variable', 'Term', 'Estimate\xa0±\xa0SD', 't-value', 'p-value')	1
('Variable', 'Time', 'Group', 'Mean\xa0±\xa0SD')	1
('Response variable', 'Term', 'Parameters', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5')	1
('Unnamed: 0', 'Unnamed: 1', 'Regulatory Success (RS) in Food Task', 'Unnamed: 3', 'Unnamed: 4')	1
('Attributes', 'Sample\xa0size\xa0(N)', 'Regulation Conditions in Food Task', 'Unnamed: 3', 'Unnamed: 4')	1
('Brain region', 'Side', 'T', 'k', 'MNI', 'Unnamed: 5', 'Unnamed: 6')	1
('Attribute', 'Brain region', 'Side', 'T', 'k', 'MNI', 'Unnamed: 6', 'Unnamed: 7')	1
('Clade', 'H0 lnL*', 'H1 lnL†', '2ΔL‡', 'P value§', 'ω ratio in background branches in H1 model#', 'ω ratio in foreground branches in H1 model¶')	1
('Microtubule dynamics', 'Spindle', 'Monopole', 'MCAK-inhibited monopole')	1
('Parameter', 'Symbol', 'Value', 'Procedure')	1
('Category', 'Non-demented', 'Demented', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5')	1
('Data set', 'Brain region', 'Count (Control|AD)', 'RIN/pH in control', 'RIN/pH in AD', 'P-value')	1
('Data collection', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5')	1
('Unnamed: 0', 'Rigor', 'ADP', 'ADP starting from 2BKI', '2BKI (rigor-like)', '4PFO (PiR)')	1
('Unnamed: 0', '5 hr', '16 hr', 'Unnamed: 3', 'Unnamed: 4')	1
('Unnamed: 0', 'Unnamed: 1', 'Gene symbol', 'Accession number', 'Gene name', '0.1 kPa', '1 kPa', '20 kPa', 'Glass')	1
('Category', 'Protein ID', 'Score', 'MW', 'MWobs')	1
('Reagent type (species) or resource', 'Designation', 'Source or reference', 'Identifiers', 'Unnamed: 4')	1
('Unnamed: 0', 'Normalized phase differences', 'Unnamed: 2', 'Unnamed: 3')	1
('Statistical test', 'Power (1-β error probability)')	1
('Experiment', 'Region sampled (Hoechst\xa0+\xa0cells/Section)', 'Significantly different?', 'Test statistic', 'P value', 'Power (1-β error probability)')	1
('Unnamed: 0', 'Monkey G', 'Monkey J')	1
('Evoked Response Measure', 'Change in Connectivity during Control Sessions', 'Change in Connectivity during Long Latency Stim Sessions', 'Change in Connectivity in Control Sessions Vs. Change in Connectivity in Stim Sessions', 'Correlation Between Coherence (Across Freqs) and Evoked Response Connectivity Measure')	1
('Gene name', 'Sample', 'Category', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5')	1
('Gene name', 'F primer', 'R primer')	1
('Parameter', 'Otof\xa0C2C/+', 'Otof\xa0C2C/C2C')	1
('Conditional knockout (L/L, cre)', 'Twnk', 'Tfam', 'Polrmt', 'Lrpprc', 'Mterf4')	1
('Pathway', 'Gene symbol', 'Protein name', 'Fold', 'P value')	1
('Unnamed: 0', 'Atarashi et al., 2013', 'Bucci et al., 2016', '11-str. I', '11-str. II', '11-str. III', 'H1', 'H2', 'M1', 'M2', 'L')	1
('Cluster', 'Chromosome', 'Count', 'Expected', 'log2[FE]', 'Adjusted p-value')	1
('Biotype', 'e89', 'e90')	1
('Feature name', 'Description')	1
('Root mean square deviation between CP subunits', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5')	1
('A. 80α procapsid. contacts (≤4 Å) between SP (subunit C) and CP', 'B. SaPI1 procapsid. contacts (≤4 Å) between CpmB (subunit C) and CP', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11')	1
('Strain', 'Phage', 'SaPI1', 'Phage titer', 'SaPI1 titer')	1
('Unnamed: 0', 'WSC (TX, OK, AR, LA)', 'ESC (MS, AL, TN, KY)', 'SA (FL, GA, SC, NC, VA, WV, MD, DC)', 'Country-at-large', 'WNC (ND, SD, NE, KS, MO, IA, MN) (not in South/Southeast) this is the second most social region following ESC (MS, AL, TN, KY)')	1
('YR', 'dh', 'dh.1', 'dt', 'h⋆', 't⋆', 'u⋆', 'M1⋆', 'M2⋆', 'V', 'V.1', 'a⋆', 'p-value', 'Odds ratio', 'Lower 99% cnf. bnds.', 'Upper 99% cnf. bnds.')	1
('(a)', 'Unnamed: 1', 'Unnamed: 2')	1
('(b)', 'Unnamed: 1', 'Unnamed: 2')	1
('Variable name', 'physical effect')	1
('Equation used in Poisson regression', 'DIC')	1
('Experiment', 'VPC fates (fate or % 1°, 2°, 3°)', 'References', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Parameter', 'Description', 'Main model', 'Parameter values from Corson and Siggia (2012)', 'Model with EGF/Notch coupling (Figure 7)', 'Alternate models of Figure 2—figure supplements 3 and 4')	1
('EGF perturbation lines', 'Unnamed: 1')	1
('Experiment', 'VPC fates (% 1°, 2°, 3°)', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5')	1
('Unnamed: 0', 'Unnamed: 1', 'Unnamed: 2', 'Band number on the SDS-PAGE (with peptides)', 'Band number on the SDS-PAGE (without peptides)', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12', 'Unnamed: 13', 'Unnamed: 14', 'Unnamed: 15')	1
('Infection sites', 'Relation of nose-colonizing to infecting bacteria', 'Unnamed: 2', 'Unnamed: 3')	1
('Unnamed: 0', 'Number of variants (Neutrality index)', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5')	1
('Gene group', 'No. protein-altering B-class variants', 'Cumulative lengthof genes (kb)', 'Enrichment', 'Significance (-log10 p value)', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('Genotype', 'No. of cells analyzed', 'No. of SCEs (SCEs/cell)', 'No. of SCEs at rDNA', 'SCEs/Gb (outside rDNA)', 'SCEs/Gb (within rDNA)')	1
('Strain name', 'Relevant genotype', 'Source')	1
('Unnamed: 0', '[Ca2+]\xa0(µM)', 'PI(4,5)P2%', 'DOPS%', 'Equilibrium force (pN)', 'Binding energy with tether (Eb) (kBT)', 'Binding energy without tether (Eon) (kBT)', 'Log10[kb (s−1)]', 'Log10[kon (M−1s−1)]', 'Log10[kub (s−1)]')	1
('Case', 'Menstrual cycles', 'Age at evaluation', 'BMI (Height cm/ weight Kg)', 'FSH IU/l', 'LH IU/l', 'E2 nmol/l', 'AMH ng/ml', 'T nmol/l', 'PRL mU/l', 'TSH mU/l', 'Ovarian surface (R/L) mm', 'Presence of follicles at US')	1
('WES metrics', 'mother', 'POI 1', 'POI 2')	1
('Variants called in', 'Mother', 'POI 1', 'POI 2')	1
('Gene name', 'Alias', 'Mean depth in targeted exons (1)', 'Nb variants in', 'Htz variants', 'Mean ratio for htz allelic', 'Presence of htz variants (5)', 'Nbr of rare variants (6)', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12', 'Unnamed: 13', 'Unnamed: 14')	1
('PilQ Domain', 'Size (aa)', 'Consensus Secondary structural motif', 'Template protein (PDB code)', 'Sequence identity/similarity', 'Resolution (Å)/Method', 'DOPE score (z-score)')	1
('PilQ domain fits', 'Total no. of fits', 'No. of unique fits', 'Top 5 solutions', 'Initial chosen protomer fit. CC (Cluster #)', 'Fit after MDFF. CC (RMSD, Å)', 'CC for C13 oligomeric ring model', 'CC after MDFF run with masked density map', 'Unnamed: 8', 'Unnamed: 9')	1
('Time point (tp)', 'Elapsed imaging time (hr:min:s)', 'Calculated developmental time (T) at 18˚C (hr:min:s)', 'Corresponding developmental stage at 18˚C (Fischer et al., 2010)')	1
('Allele', 'PCR conditions and comments', 'Genotping methods', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9')	1
('Name', 'Application', 'Sequence')	1
('Unnamed: 0', 'TFIIAs-c')	1
('TAF11', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3')	1
('Unnamed: 0', 'TAF11/TAF13/TBP', 'TAF11/TAF13')	1
('TAF11-TBP', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3')	1
('Interactor', 'Interface (Å2)')	1
('Parameter name', 'Parameter value', 'Unnamed: 2', 'Unnamed: 3')	1
('Parameter', 'Physical interpretation', 'Default value')	1
('Sequence', 'FCR*', 'NCPR†', 'Fraction of disorder promoting residues', 'UNIPROT identifier of protein from which the sequence was drawn')	1
('Unnamed: 0', 'SNAREΔ60-Sx253', 'SNAREΔ60-Sx259', 'SNAREΔ60-Sx265', 'His6-SNAREΔ60-Sx265')	1
('Protein', 'pMST2 peptide', 'Kd (µM)', 'ΔH (kcal/mol)', 'ΔS (cal/mol·K)')	1
('Genes', 'Comparison', 'Study', 'Z value', 'P value', 'Sample size (n)')	1
('Genes', 'Comparison', 'Study', 'W value', 'P value', 'Sample size (n)')	1
('Comparison', 'Study', 'W value', 'P value', 'Sample size (n)')	1
('Name', 'Features', 'Promoter/Vector', 'Details')	1
('Antibody', 'Source', 'Company', 'Catalog number', 'Dilutions used')	1
('Sample name', 'Western blot', 'Nuclear BAP1-IHC', 'Sensitivity')	1
('Network', 'r\u2004=\u2004∞', 'r\u2004=\u20041')	1
('Strain', 'Number', 'Description', 'Source')	1
('Primer number', 'Sequence', 'used to make plasmid number')	1
('Figure 2B', 'Number of values (biological replicates)', 'mean', 'median', 'SD', 'SEM', 'Lower 95% confidence interval of mean', 'Upper 95% confidence interval of mean')	1
('Mouse line', 'Primer sequence', 'Source')	1
('Gene symbol', 'Uniprot symbol', 'Protein', 'co-IP with')	1
('Anti-LigB mAbs', 'KD (μM)', 'Cell binding (MFI)', 'LD50 (μg/ml)', 'LigB domain specificity', 'Unnamed: 5')	1
('Unnamed: 0', 'Control group', 'Dyslexic group', 'Mann-Whitney z value')	1
('Strain #', 'Strain name', 'Genotype', 'Reference')	1
('Plasmid #', 'Plasmid name', 'Description', 'Bacterial selection', 'Reference')	1
('Name', 'Dilution', 'Reference')	1
('Unnamed: 0', 'TcPINK1 (Native)')	1
('List of SYBR green primers for real-time PCR', 'Unnamed: 1', 'Unnamed: 2')	1
('Antibodies used in western blots', 'Unnamed: 1', 'Unnamed: 2')	1
('Data set', 'Unnamed: 1', 'Partition', 'Total length', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9')	1
('Substitution', 'Hippidion', 'Haringtonhippus', 'Equus')	1
('Outgroup', 'Partitions', 'Hippidion?', 'Tips', 'Analysis method', 'Topology', 'Support', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11')	1
('Partitions', 'Outgroup', 'Hippidion?', 'Included', 'Excluded', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Hippidion?', 'Partition', 'Published sample', 'Sequence length (bp)', 'Locality', 'Placement', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10')	1
('Sample', 'Museum accession', 'Chromosome ratio', 'Inferred sex')	1
('Name', 'Background', 'Genotype')	1
('Unnamed: 0', 'Element', '# of atoms', 'Mole fraction', '# atoms/nm3')	1
('Scattering cross-sections per atom (>5 mrad)', 'Unnamed: 1')	1
('Component', 'Threshold level in tomogram', 'Ratio to water', 'Ratio to TCP')	1
('Interval', '# Bursts†', '#spikes/burst', 'ISI (ms)', 'Duration (ms)')	1
('Purpose', 'Plasmid', 'Description', 'Host strain/ Injection marker', 'Transgene', 'Strain')	1
('Strain', 'Genotype', 'Purpose/Notes', 'Figure/Video')	1
('Unnamed: 0', 'Mechanism', 'System', 'P274R', 'I201T', 'Unnamed: 5')	1
('Transgene', 'Plasmid or reference', 'Description', 'Purpose', 'Strain')	1
('Strain', 'Transgenes', 'Description', 'Purpose')	1
('Unnamed: 0', '1', '2', '3', '4', '5', '6', '7', '8', '9', '10', '11', '12', '13')	1
('Protein', 'PDB', 'SIPRIS', 'Focal', 'BPPS-SIPRIS‡', 'SIPRIS.1', 'Tree', 'Interpretive comments#', 'Unnamed: 8', 'Unnamed: 9')	1
('Superfamily', 'structures*', 'RMSD†\xa0(Å)', 'Domain length‡', 'Resolution (Å)', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11')	1
('Superfamily', 'Subgroup', '# Sequences', '% Identity*', '# Nodes in subtree', 'Minimum subtree size')	1
('Superfamily', '# subgroups', 'BPPS', 'Annotated by SFLD', 'BSG‡', 'BPPS conflicts§', 'Maximum', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11')	1
('Subgroup IDs', 'SFLD&', 'SFLD#', 'Unnamed: 3', 'Unnamed: 4')	1
('BPPS', 'SG1129', '% matches to BPPS pattern†', 'Mean score vs other seqs:‡', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('BSG', 'SG1135', '% matches to each BSG pattern for SG1135 sequences*:', 'Mean score†\xa0vs others', 'new‡', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12', 'Unnamed: 13', 'Unnamed: 14', 'Unnamed: 15')	1
('Protein', 'MSA*', 'SIPRIS†', 'BPPS-SIPRIS†', 'SIPRIS', 'Tree', 'Optimal BPPS pattern ∩ SIPRIS cluster#', 'Unnamed: 7', 'Unnamed: 8')	1
('Go.id', 'Term', 'N', 'Odds ratio', 'P value', 'FDR corrected P value')	1
('Unnamed: 0', 'Unnamed: 1', 'EB1 density (puncta/100 µm2)', 'Mean growth distance (µm)', 'Mean growth speed (µm/min)', 'Mean growth duration (s)')	1
('Notation', 'Description')	1
('Notation', 'Value', 'Description', 'References')	1
('Parameter/Function', 'Values and ranges reported', 'References')	1
('Notation', 'Description', 'Ranges / priors')	1
('Reagent or Resource', 'Source', 'Identifier')	1
('Unnamed: 0', 'E', 'PV', 'SST', 'VIP')	1
('Source', 'Parameter', 'Group\xa01 (mean\xa0±\xa0SD)', 'Group\xa02 (mean\xa0±\xa0SD)', 'Test statistics', 'Statistical test')	1
('General health observations', 'VEH/VEH [n\xa0=\xa08]', 'VEH/PTX [n\xa0=\xa020]', 'A20 (20)/VEH [n\xa0=\xa08]', 'A20 (20)/PTX [n\xa0=\xa08]', 'A20 (6.6)/PTX [n\xa0=\xa08]', 'A20 (2.2)/PTX [n\xa0=\xa08]', 'S321 (20)/VEH [n\xa0=\xa08]', 'S321 (20)/PTX [n\xa0=\xa08]', 'S321 (6.6)/PTX [n\xa0=\xa08]', 'S321 (2.2)/PTX [n\xa0=\xa08]')	1
('Wild type*', 'In locked contexts†', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5')	1
('Helix-helix', 'Correlation value')	1
('Unnamed: 0', 'Rozellomycota', 'Microsporidia', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Unnamed: 0', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Phenotype', 'Unnamed: 6')	1
('PC', '%var', 'Heritability per PC', 'Error', 'Molar herit')	1
('QTL', 'Chr', 'Position', 'Best SNP', 'p-value', 'Effect size', 'PC\xa0axis', 'Genes*')	1
('Unnamed: 0', 'N', '% of Total')	1
('Unnamed: 0', 'Median duty factor', 'Median phase (%)', 'N', 'SD duty factor', 'SD phase (%)')	1
('Unnamed: 0', 'ANP', 'Kd (µM)', '∆G (kcal/mol)', '∆H (kcal/mol)', '-T∆S (kcal/mol)')	1
('AMPylated haBiP28-549', 'Apo', 'Apo.1', 'Apo.2', 'ADP', 'ADP.1', 'Unnamed: 6')	1
('Unnamed: 0', 'Cell properties', 'Synapse properties', 'Distribution of electrodes', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('Quantity', 'Value', 'Unit')	1
('Unnamed: 0', 'Children measured at Year 1', 'Children measured at Year 2', 'Unnamed: 3', 'Unnamed: 4')	1
('Unnamed: 0', 'WASH Benefits Main Trial', 'Telomere substudy: Had telomere outcomes at Year 1', 'Telomere substudy: Lost to follow-up at Year 2 (from those who had telomere outcomes at Year 1)', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Arm', 'N', 'Mean', 'Unadjusted difference: Intervention vs. Control (95% CI)', 'Age- and sex- adjusted difference: Intervention vs. Control (95% CI)', 'Fully adjusted † difference: Intervention vs. Control (95% CI)', 'Inverse probability of censoring † difference: Intervention vs. Control (95% CI)')	1
('Arm', 'Female children', 'Male children', 'Female children\xa0Unadjusted difference: Intervention vs. Control (95% CI)', 'Male children Unadjusted difference: Intervention vs. Control (95% CI)', 'Interaction term sex by treatment (95% CI)', 'Unnamed: 6', 'Unnamed: 7')	1
('Knockout and rescue with NuMA version:', 'Recruits dynactin', 'Localizes to lattice (no end preference)', 'Localizes to preferentially\xa0to\xa0minus-ends', 'Rescues pole focusing')	1
('Unnamed: 0', 'Unnamed: 1', '2PLSM measurements', 'EM measurements', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Gene name', 'Outer forward', 'Outer reverse', 'Inner forward', 'Inner reverse')	1
('Product\xa0or\xa0resource', 'Supplier', 'Reference No')	1
('Unnamed: 0', 'Fast time constant', 'Slow time constant', 'Amplitude fast component', 'Amplitude slow component', 'R')	1
('Unnamed: 0', 'Forward masking', 'All tone bursts – global fit', 'Unnamed: 3', 'Unnamed: 4')	1
('Unnamed: 0', 'Buried surface [Å2]', 'ΔGsol [kcal/mol]', 'ΔGdiss [kcal/mol]')	1
('Substrate*', 'Strain', 'Doubling time (h)†', 'p-value', 'Maximum OD600†', 'p-value.1')	1
('Unnamed: 0', 'Pf pos.', 'Pf neg.')	1
('Key resources table', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4')	1
('Gene', 'F', 'R')	1
('Lysine site', 'Peptide from mass spectrometry', 'Predicted protein')	1
('Unnamed: 0', 'mUbRab5K116', 'mUbRab5K140', 'mUbRab5K165')	1
('Unnamed: 0', 'GDP dissociation rate\xa0±\xa0SD* (10−4 s−1)', 'GTP association rate\xa0±\xa0SD (10−4 s−1)', 'Unnamed: 3')	1
('Unnamed: 0', 'Rabaptin5', 'EEA1', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Unnamed: 0', 'AnkB', 'AnkG')	1
('Compound', 'Library', 'Target/category')	1
('Use', 'Gene', 'Forward', 'Reverse', 'Reference')	1
('Parameter', 'Variable name', 'Normal', 'Apaf1 KO', 'Shh KO', 'Apaf1;Shh DKO')	1
('Kinase', 'ML168', 'NCT-504')	1
('Oligo name', 'Sequence (5’ to 3’)', 'Modification(s)')	1
('Region', 'Sequence composition', 'Abbreviation', 'G\xa0+\xa0C content', 'Total CpG (Change)*', 'Total UpA (Change)*', 'Ratio† CpG', 'Ratio† UpA')	1
('RD cells', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('BHK cells', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('Unnamed: 0', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Transversions', 'Transitions', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11')	1
('Unnamed: 0', 'Very preterm-perinatal brain injury', 'Very preterm-no diagnosed injury', 'Controls', 'Test statistic', 'Significance')	1
('Striatal subregion', 'Anova, group differences', 'Very preterm-perinatal brain injury vs controls', 'Very preterm-perinatal brain injury vs Very preterm-no diagnosed injury', 'Very preterm-no diagnosed injury vs controls')	1
('Unnamed: 0', 'Very preterm-perinatal brain injury mean (sd)', 'Very preterm-no diagnosed injury mean (sd)', 'Control mean (sd)', 'Anova', 'Very preterm-perinatal brain injury vs Control', 'Very preterm-perinatal brain injury vs very preterm-no diagnosed injury', 'Very preterm-no diagnosed injury vs Control')	1
('PDB code', 'Number of residues', 'Crystal structure', 'Model structure', 'Fnat', 'TM-score', 'Number of docking decoys', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12', 'Unnamed: 13')	1
('Target', 'Species', 'CDR-L1', 'L2', 'L3', 'H1', 'H2', 'CDR-H3', 'TM-score', 'Unnamed: 9', 'Unnamed: 10')	1
('Target', 'Template', 'Template chain', 'Seq. ID.', 'TM-score')	1
('Target', 'Crystal structure', 'Model structure', 'Target.1', 'Crystal structure.1', 'Model structure.1', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9')	1
('Patch', 'Predicted patch residue positions', 'Patch score', 'Disruptive EpiScope design mutation positions')	1
('Target', 'Crystal structure of ag', 'Modeled structure of ag', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Unnamed: 0', 'Estimated pKa values', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Unnamed: 0', '1. what did you think the study was about?', '2. what were you doing during the scans? (Ask about each day if applicable)', '3. how hard were you trying to solve the puzzles, on a scale of 1–10, for each day?')	1
('Unnamed: 0', 'ERASMOS (n\xa0=\xa060)', 'PMP/NECC (n\xa0=\xa0119*)', 'p-value')	1
('Unnamed: 0', 'Training (n\xa0=\xa0135)', 'Testing (n\xa0=\xa044)', 'p-value')	1
('Significance-based selection', 'Correlation-based feature subset selection', 'Expression fold change selection')	1
('Unnamed: 0', 'Variable selection method', 'Unnamed: 2', 'Unnamed: 3')	1
('Characteristic', 'qPCR model set (N\xa0=\xa0325)')	1
('Characteristic', 'Polish external validation set (N\xa0=\xa051)')	1
('Quantity', 'Value', 'Description')	1
('G', 'wBG(I)', 'wBG(I)/wBG(E)')	1
('Unnamed: 0', 'Unnamed: 1', 'Effects of mutations in trans', 'Unnamed: 3', 'Unnamed: 4')	1
('Unnamed: 0', 'Actual system (mutations in cis and trans)', 'Experimental prediction (based on partition libraries)', 'Convolution (no knowledge of genetic structure)', 'Convolution (accounting for cis effects in the absence of CI)', 'Null prediction (based on sorting accuracy)')	1
('tRNA #', 'Codon(s)', 'Anticodon', 'AA', 'AA.1', 'Read count', 'Unnamed: 6', 'Total bin', 'Fxn total')	1
('CRD:', 'ctAI', 'Comments')	1
('Ion-exchange- HPLC Elution time (min)', 'Reversed-phase- HPLC Retention time (min)', 'Observed\xa0mass (MH+)', 'Theoretical\xa0mass (MH+)', 'Sequence', 'Precursor gene', 'Peptide name*', 'Unnamed: 7')	1
('Gene description', 'Gene ID', 'Log2')	1
('Protein name', 'ID', 'CCMS experiment/CCMS competition*', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5')	1
('Response variable', 'Stage', 'Parameters (fixed effects)', 'Estimate', '95% CI', 'p Value')	1
('Response variable', 'Social phenotype', 'Parameters (fixed effects)', 'Estimate', '95% CI', 'p alue')	1
('Response variable', 'Model', 'Parameters (fixed effects)', 'Estimate', '95% CI', 'p-Value')	1
('Response variable', 'SF treatment', 'Parameters (fixed effects)', 'Estimate', '95%', 'P value')	1
('Social status', 'Unnamed: 1', 'D', 'D.1', 'S', 'S.1')	1
('Primer', 'Unnamed: 1', 'Primer sequence 5’−3’', 'Master mix', 'PCR', 'Source')	1
('Brain region', 'Correlation between mGluR5 availability and EEG\xa0<\xa01 Hz activity', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5')	1
('Name', 'Description', 'Domain')	1
('Name', 'Description', 'Default values', 'Used in')	1
('Dataset', 'Striatum', 'PFC', 'Hippocampus', 'BNST')	1
('Data collection', 'tSH2-Rpb1pS1493', 'tSH2-Rpb1pT1471,pS1493')	1
('Unnamed: 0', 'Subtype', 'Overall', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('Unnamed: 0', 'Patients', 'Transmission chains')	1
('Subtypes', 'Parameter number', 'Parameter name', 'Parameter estimate', 'Wald-type 95%-CI', 'Profile likelihood 95%-CI')	1
('Parameter', 'Abbreviation', 'Value')	1
('Bacterium', 'Strain', 'Relevant characteristics', 'Reference/source')	1
('Construct', 'kdes (s-1)', 'P', 'Iss (%)', 'P.1', 'Superact. (%)', 'P.2')	1
('Unnamed: 0', 'No. of children (%)', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9')	1
('Loci', 'Rank orders', 'Imply epistasis', 'Fraction')	1
('Interaction', 'p-value', 'Result', 'From rank order')	1
('Rank', 'fwn', 'arg', 'pyr', 'leu', 'phe', '#mutations', 'o/ e', '#o cumul.', '#e cumul.', 'neg. vs pos.')	1
('Unnamed: 0', 'Unnamed: 1', 'Sequence')	1
('X-link', 'Lowest e-value', 'Sequence of X-linked peptides and location of X-linked residues', 'Theoretical precursor mass (Da)', 'Deviation from theoretical mass (Da)', 'Number of precursors')	1
('Unnamed: 0', 'non-rotated', 'rotated', 'ΔS1')	1
('Alpha V segment', 'Putative # Sub-families', 'All cloned sequences', 'Complete CDR3-J junction*', 'Unique V Region †', 'Unique V segment‡', 'Unique CDR3-J§', 'Groups with identical CDR3-J#', 'CDR3-J groups in Study**', 'Sequences in each dataset††', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12')	1
('Unnamed: 0', 'Unnamed: 1', 'FR1', 'FR2', 'FR3', 'FR Means', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12', 'Unnamed: 13', 'Unnamed: 14', 'Unnamed: 15', 'Unnamed: 16', 'Unnamed: 17', 'Unnamed: 18', 'Unnamed: 19', 'Unnamed: 20', 'Unnamed: 21', 'Unnamed: 22')	1
('Unnamed: 0', 'Unnamed: 1', 'CDR1', 'CDR2', 'CDR3', 'CDR Means', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12', 'Unnamed: 13', 'Unnamed: 14', 'Unnamed: 15', 'Unnamed: 16', 'Unnamed: 17', 'Unnamed: 18', 'Unnamed: 19', 'Unnamed: 20', 'Unnamed: 21', 'Unnamed: 22')	1
('Unnamed: 0', 'Unnamed: 1', 'FR', 'CDR', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12', 'Unnamed: 13')	1
('Mutated base', 'Hotspot motif', 'Region', 'Total nucleotides', 'Observed # Mutations', 'Expected # Mutations', 'Mutation freq (%)', 'χ2 p', 'T-test P')	1
('a', 'ALL', 'Base', 'Occurrence', 'Probability of occurrence', 'OBS', 'EXP', 'MI*', 'ChiSq')	1
('Tissue type', 'Mut type', 'FR Mutations (#)', 'CDR Mutations (#)', 'FR mutation frequency', 'CDR mutation frequency', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12', 'Unnamed: 13', 'Unnamed: 14', 'Unnamed: 15')	1
('Primer', 'F/R', 'ID', 'Location', "Nucleotide sequence (5' to 3')", 'Amino acid', 'Tm')	1
('Item', 'S. nigrum', 'S. quitoense', 'H. niger', 'S. sinuata')	1
('Dros. AA# Change', '(Rat AA#)', '# Hits', 'Location', 'Stability')	1
('Refinement and validation', 'Unnamed: 1')	1
('Unnamed: 0', 'No. of WT mice', 'No. of Triaka mice', 'p-value')	1
('Tissue type', 'Number of cases', 'ESRP1 expression (%)', 'p-value', 'Unnamed: 4')	1
('SetID', 'Database', 'Description', 'Change Triaka vs. WT')	1
('yYB number', 'Mating type', 'Genotype')	1
('pYB number', 'Backbone', 'Description')	1
('Gene', 'Histone', 'Single exon', 'Genetype')	1
('Unnamed: 0', 'Complete data set', 'Intermediate survival', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('Baranyi model', 'Unnamed: 1')	1
('Unnamed: 0', 'Linear', 'van der\xa0Pol', 'Lorenz', 'Arm', 'Non-linear feedforward')	1
('Unnamed: 0', 'Number of peaks', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5')	1
('Overlaps with Vienna Tile-GAL4 reporters', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4')	1
('Overlaps of peak classes with active enhancers and transcription start sites', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Bcd peak class', 'Overlaps with TSS', 'Total bcd peaks', 'Unnamed: 3')	1
('Peak list', 'Bcd Dependent', 'Zld Dependent', 'Bcd\xa0+\xa0Zld dependent', 'Total')	1
('Genotype', 'Protein level relative to WT', 'Estimated number of molecules', 'Estimated nuclear concentration')	1
('Primers', 'Unnamed: 1', "Sequence (5'-\xa0>\xa03')")	1
('Protein name', 'UniProt ID', 'Spectral ratio', 'MaxP', 'ES', 'IS', 'P5', 'P50', 'pS940')	1
('mRNA co-injected with 20 pg vg1-sfGFP', 'Intracellular', 'Extracellular puncta', 'Extracellular diffuse', 'Extracellular puncta\xa0+\xa0diffuse', 'Unnamed: 5')	1
('Unnamed: 0', 'RT (ms)', 'Hits (%)', 'Misses (%)', 'False alarms (%)')	1
('Unnamed: 0', 'Early time window', 'Late time window', 'Unnamed: 3', 'Unnamed: 4')	1
('Stimuli', 'Proportion', 'Condition (number of trials)')	1
('A', 'Stimuli', 'Proportion', 'Condition (number of trials)')	1
('B', 'Stimuli', 'Proportion', 'Condition (number of trials)')	1
('Unnamed: 0', 'Left thalamic infarct patients (n\xa0=\xa012)', 'Healthy control participants (n\xa0=\xa025)', 'P value', 'dMTT subgroup (n\xa0=\xa07)', 'iMTT subgroup (n\xa0=\xa05)', 'P value.1')	1
('Tasks', 'Subtests', 'Patients N\xa0=\xa012', 'Controls N\xa0=\xa025', 'P value')	1
('Model', 'Number of parameters', 'QAICc', 'Delta AICc (Δi)', 'Weights (ωi)', 'Deviance')	1
('Computational self-esteem parameters', 'Mean (SD)')	1
('Symptom questionnaires', 'Mean (SD)')	1
('Plasmid', 'Genotype', 'Genome location')	1
('Unnamed: 0', 'Reaction time (ms)', 'Peak velocity (m/s)', 'Endpoint error (cm)')	1
('Unnamed: 0', 'Gains during EVAR', 'Gains during tilt', 'Notes', 'Unnamed: 4')	1
('Unnamed: 0', 'Gains', 'Notes', 'Unnamed: 3')	1
('Statistic', 'E71A-OM', 'Y82A-OM', 'Y82A-F103A closed')	1
('Unnamed: 0', 'Mean IC50 in nM\xa0±\xa0SD (fold-change)', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('Drug', 'Mean IC50(nM)\xa0±\xa0SD', 'CC50 (μM)', 'Selectivity index*', 'Unnamed: 4', 'Unnamed: 5')	1
('Unnamed: 0', 'Unnamed: 1', 'Mean IC50 in nM\xa0±\xa0SD (fold-change)', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Unnamed: 0', 'Unnamed: 1', 'Mean IC50\xa0±\xa0SD (nM)', 'Unnamed: 3', 'Unnamed: 4')	1
('Unnamed: 0', 'GRL-142', 'DRV')	1
('Virus before selection', 'Mean IC50 in nM\xa0±\xa0SD', 'Virus after selection', 'Mean IC50 in nM\xa0±\xa0SD.1', 'Fold-change')	1
('Unnamed: 0', 'PRWT\xa0+\xa0GRL-121', 'PRWT\xa0+\xa0GRL142')	1
('Unnamed: 0', 'PRWT\xa0+\xa0GRL-121', 'PRWT\xa0+\xa0GRL-142')	1
('Experiment', 'Target gene', 'Sequence')	1
('Measure', 'Mean (SD)')	1
('Model name', 'Number of learning rate parameters', 'Number of inverse temperature parameters', 'Notes')	1
('Experiment', 'N', '% efficiency\xa0±\xa0SD')	1
('Genomes', 'Features', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Alternative protein accession', 'Detection method*', 'Gene', 'Amino acid sequence', 'AltORF localization')	1
('Gene', 'Polypeptides*', 'Reference', 'altORF localization', 'altORF size aa', 'Conservation', 'Summary of functional relationship with the annotated protein')	1
('Data collection', 'Native IlCysZ', 'IlCysZ w/SeO42- (SAD)', 'SeMet PfCysZ (six crystals, refinement)', 'SeMet PfCysZ (15 crystals, SAD)', 'Native PdCysZ (MR-SAD)')	1
('Databases:', 'Restrictions to access', 'Dataset URL:')	1
('Monomeric motor', 'MT-stimulated ATPase', 'MT affinity; Kd (μM)', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Nucleotide state', 'Templates used for homology modelling', 'QMEAN scores', 'Global Cross-correlation scores', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Fluorophore', 'Size (nm)', 'Tag', 'Diffusion coefficient (μm2/s)', 'Trajectory range (nm) (±width)', 'Synaptic receptors (%)')	1
('Metric', 'Model', 'dAIC', 'dBIC', 'beta', 'CI 95%', 't', 'df', 'p')	1
('Metric', 'Subset', 'n', 'Random Effect', 'beta', 'CI 95%', 't', 'df', 'p')	1
('Metabolite', 'Human male plasma reference range* [µM]', 'RPMI-1640 with 10% dialyzed fetal bovine serum [µM]', 'DMEM with 10% dialyzed fetal bovine serum [µM]', 'Adult bovine serum†\xa0[µM]', 'Adult bovine heparinized plasma†\xa0[µM]', 'Adult human serum†\xa0[µM]')	1
('Activity metric', 'Dorsolateral striatum', 'Motor cortex', 'Unnamed: 3', 'Unnamed: 4')	1
('Step', 'Parameter', 'Details', 'Recommended value')	1
('Event', 'Status', 'Effect', 'Probability per unit time')	1
('Age range (Years)', 'Relative risk')	1
('Parameter', 'SOR estimate', 'SORI estimate')	1
('Age range (Days)', 'Probability of VL/Culture')	1
('Time from vaccination (Days)', 'SICCT interpretation', 'Probability classified as reactor')	1
('Effect size (Total Vaccine Efficacy)', 'Experimental reproductive ratio R', 'Group size', 'Power')	1
('Model', 'Transmission parameter β', 'Transmission parameter q', 'Occult period TO', 'Reactive period TR')	1
('Unnamed: 0', 'Simple correlation', 'Two linear components', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('ToxoDB gene name', 'Position in master protein', 'Annotated peptide sequence', 'Atc+/Atc- Ratio\xa0≤\xa00.22', '(log2) Atc+/Atc- Ratio\xa0≤\xa0−2.18')	1
('Days', 'Number of cells', 'Number of Septa', 'Percentage')	1
('Unnamed: 0', 'day 1', 'day 8', 'day 15', 'day 8+15')	1
('Unnamed: 0', 'Unnamed: 1', 'SNVs', 'Indels', 'Insertions', 'Deletions')	1
('Variants', '#')	1
('Time', '# of colonies w/phenotype', '18°C', '37°C', 'KCl 1M', 'Ca(NO3)2 0.15M', 'CaCl20.3M', 'TBZ 15 μg/ml', 'HU 4 mM', 'SDS 0.01%')	1
('Parameter', 'Genotype', 'Literature', 'Unnamed: 3', 'Unnamed: 4')	1
('Background', 'Plasmids', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4')	1
('Plasmid', 'Product', 'System', 'Ind', 'Res', 'Source')	1
('Parameter', 'Start value (Mello and Tu, 2007)', 'Final value')	1
('Parameter', 'Value', 'Literature', 'Source')	1
('Unnamed: 0', 'Rh of S11', 'Rh of S5')	1
('Strain name', 'Background', 'Genotype', 'Source/Reference')	1
('Plasmid name', 'Description', 'Source/Reference')	1
('Unnamed: 0', 'Mig1-GFP', 'Msn2-GFP', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Unnamed: 0', 'Mig1-GFP', 'Msn2-GFP', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12')	1
('Unnamed: 0', 'Mig1-GFP snf1Δ', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Chromosome', 'Length (bp)', 'N sites identified', 'N promoter sites')	1
('Msn2:', 'Unnamed: 1')	1
('Mig1:', 'Unnamed: 1')	1
('Lacl:', 'Unnamed: 1')	1
('Phosphorylation sites of Mig1 and Msn2 (uniprot.org, accessed February, 2016):', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3')	1
('Proteins', 'Total protein conc. (nM)', 'Mg2+ + polyphosphate', 'Readout channel', 'Component 1', 'Component 2', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9')	1
('GPCR', 'Uniprot accession number', 'Tested residues', 'BBSome binding: trend from microarray', 'Validated peptides', 'Peptide sequences', 'KD [µM]')	1
('Parameter', 'Horizon dependent?', 'Uncertainty dependent?', 'TMS dependent?')	1
('Parameter', 'Prior', 'Hyperparameters', 'Hyperpriors')	1
('Gene name', 'Modified sequence', 'Position', 'Upregulation')	1
('Primary antibody', 'Company')	1
('Strain/plasmid', 'Description/genotype', 'Reference/source')	1
('Construct', 'Fusion', 'Tag(s)', 'Epitope', 'Variants', 'Promoter', 'Signal peptide', 'Source', 'Gift from')	1
('GC3 predictors', 'Pairwise R2', 'p-value', 'Model R2', 'F statistic', 'p-value.1')	1
('Phenotype', 'Average speed, μm/s', 'Tracks to Posterior, %', 'Mobile fraction, %')	1
('Sample', 'Tissue', 'Age', 'Sex', '# of mice', 'Mapped reads', '% mapped')	1
('Gene symbol', 'Gene', 'ΔPSI', 'Size of exon (bp)', 'In frame?', 'Alt. exon position', 'Effect on coding')	1
('Unnamed: 0', 'Fitnessat OT', 'Fitnessat HT', 'Adaptabilityat OT', 'Adaptabilityat HT', 'PleiotropyHT pops at OT', 'PleiotropyOT pops at HT')	1
('Unnamed: 0', 'Kre33 -RM', 'Kre33 -BY', 'Unnamed: 3', 'Unnamed: 4')	1
('Unnamed: 0', 'Overall 38 pts', 'Bag-1 negative 9 pts', 'Bag-1 positive 29pts', 'p-value', 'Unnamed: 5')	1
('Unnamed: 0', 'Phenotype', 'cKO', 'cKO transplant', 'vKO', 'vKO transplant')	1
('Unnamed: 0', 'β-galactosidase (Bartesaghi et al., 2015)', 'TRPV1 Channel (Liao et al., 2013)', 'RNA polymerase III (Hoffmann et al., 2015)', 'γ-secretase (Bai et al., 2015)', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Unnamed: 0', 'β-galactosidase', 'TRPV1 channel', 'RNA polymerase III', 'γ-secretase')	1
('Sample', 'Fragmentation', 'AFM image analysis', 'Prion transfection', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('Unnamed: 0', 'Kd (nM hexamer)', 'Hill coefficient', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('RNA or DNA oligomers', 'Sequences (5’ to 3’)')	1
('Transcribed RNAs', 'Unnamed: 1')	1
('Peptides', 'Unnamed: 1')	1
('Parameter', 'Anisotropy', 'Complex/complexes')	1
('Unnamed: 0', 'Parameter', 'Unit', 'Description', 'Acceptable range', 'Default', 'Unnamed: 6')	1
('NIP5;1 exon probes', 'NIP5;1 intron 1 probes', 'PP2A mRNA')	1
('Name', 'Sequence', 'Description')	1
('Unnamed: 0', 'CORE', 'SHELL', 'Unnamed: 3', 'Unnamed: 4')	1
('Unnamed: 0', 'Positive slope (r > 0)', 'Negative slope (r < 0)', 'Unnamed: 3')	1
('Regeneration factor', 'Regeneration factors were measured as below when a neuron was categorized as regeneration')	1
('Unnamed: 0', 'Average rate of convergence (μm/min) (n)', 'Average rate of convergence (%/hr) (n) (SEM)', 'Strain of dorsal tissue (%/hr) (n) (SEM)', 'Strain of LV tissue (%/hr) (n) (SEM)', 'Shear w.r.t. attachment strips (%/hr)')	1
('Time from onset of gastrulation (hours)', 'Force (μN (n,±SEM))', 'Effective SSA (mm2 (n,±SEM))', 'Estimated force/cell (nN)', 'Force per effective SSA (Pascals)')	1
('Position', 'Phospho (STY) Probabilities', 'Position in peptide', 'Charge', 'Mass error [ppm]')	1
('PKC isoform', 'CAT domain (aa)', 'DN mutation')	1
('Target', 'Sequence 5’−3’')	1
('Dataset', 'Endophilin', 'Dynamin GMPPCP', 'Co-complex GDP')	1
('Cell type', 'Category', 'Gene symbol', 'Protein/Subunit')	1
('Parameter', 'Value', 'Reference')	1
('Unnamed: 0', 'preS1-2H5 scFv')	1
('2h5 scFv', 'HCDR1', 'HCDR2', 'HCDR3', 'CDR-L1', 'CDR-L3', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11')	1
('Metanode', 'Abbr', 'Nodes', 'Disconnected', 'Metaedges')	1
('Metaedge', 'Abbr', 'Edges', 'Sources', 'Targets')	1
('Abbrev.', 'Len.', 'Δ auroc', '−log₁₀(P)', 'Coef.', 'Metapath')	1
('Resource', 'Components', 'License', 'Cat.', 'References')	1
('Parameter', 'Value', 'Source', '+20% effect on slope, thresh', 'Parameter.1', 'Value.1', 'Source.1', '+20% effect on slope, thresh.1')	1
('Unnamed: 0', 'Biochemical IC50 (nM)', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5')	1
('Kinase', '% activity remaining (1 µM)', 'Enzymatic IC50* (nM)')	1
('Unnamed: 0', '3-day antiproliferative IC50 (μM)', 'Note', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Unnamed: 0', '7-day antiproliferative IC50 (μM)', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Brain regions', 'X', 'Y', 'Z', 'Brain Activity (T-score)', 'Unnamed: 5', 'Unnamed: 6')	1
('Unnamed: 0', 'Contrast difference condition (monkey M1)', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9')	1
('Strains', 'Relevant genotype or phenotype', 'Reference')	1
('Plasmids', 'Relevant genotype', 'Resistance', 'Replication origin', 'Induction', 'Reference')	1
('Turn', 'Population (%)', 'Lifetime (ns)', 'Unnamed: 3', 'Unnamed: 4')	1
('Name', 'Soma', 'Axon', 'AIS', 'GCL', 'IML', 'MML', 'OML', 'Reference', 'Ion channel model')	1
('Intrinsic properties', 'Experiment', 'Model reconstr. morphologies', 'Model synth. morphologies')	1
('Channel name', 'Cell type and Reference', 'Downregulation in the model [%]')	1
('Unnamed: 0', 'Phage Duts', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4')	1
('Unnamed: 0', 'Unnamed: 1', 'Unnamed: 2', 'SSAPs', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Cell type', 'Genes markers')	1
('Patient', 'Age (years)', 'Gender', 'Tissue')	1
('Family', 'Parameters', '# Param', 'Likelihood', 'Pseudo-R²', 'iBIC')	1
('Unnamed: 0', 'Minimum', '25th percentile', 'Median', '75th percentile', 'Maximum')	1
('Phosphoepitope', 'Clone (Supplier)')	1
('Gene', 'Protein', 'Allele', 'NT change', 'AA change', 'Inheritance', 'Primers', 'Note')	1
('Abundance', 'Culture positive', 'Number')	1
('Factor', 'Effect on carriage duration (days)')	1
('Serotype', 'Sojourn time (days)', 'Expected number of infections')	1
('Co-ordinate', 'Nearest annotation', 'Effect size', 'P-value', 'Significance level')	1
('Source', 'Of which is', 'Total variance explained', 'Proportion of total heritability explained')	1
('Figure', 'Cells', 'Slices', 'Mice')	1
('Construct', 'Calculated MW (kDa) (monomer: dimer)', 'Observed MW (kDa)')	1
('Strain or plasmid', 'Relevant genotype', 'Source')	1
('Ensembl gene ID', 'Ensembl transcript ID', 'Gene name')	1
('Mature ID', 'Fold regulation S1 vs T4-2', 'Fold regulation T4 rev vs T4', 'P value')	1
('Mature ID', 'Fold regulation T4 vs Control', 'Fold regulation T4 Rev vs T4', 'p-value', '# Targets / 60 genes', 'Gene locus', 'Type', 'Unnamed: 7')	1
('miR-144 (12 targets)', 'miR-30e (11 targets)', 'mir-34c-5p (10 targets)')	1
('miRNA', 'Seed', 'miRNA binding site in 3′UTR of mRNA')	1
('miRNA promoter', 'TXN bound', 'Start from TSS', 'End from TSS', 'Predicted binding sequence', 'Wt decoy sequence (5′ → 3′) (Ds DNA)', 'Mt decoy sequence (5′→ 3′) (Ds DNA)', 'Transfected T4-2 cells', 'Unnamed: 8', 'Unnamed: 9')	1
('Northern probes', 'Unnamed: 1')	1
('Unnamed: 0', 'Cell', 'Cancer', 'TP53', 'FXR2', 'FXR1 KD efficiency (%)', 'FXR1 KD induced anti-proliferation (%)')	1
('Light- Point', 'Peak1 wavelength (nm)', 'Peak1 intensity (106 photons/s)', 'Peak2 wavelength (nm)', 'Peak2 intensity (106 photons/s)')	1
('Significance t-test 2-tail', 'hdcJK910 R1', 'hdcJK910 R2', 'hdcJK910 R3', 'hdcJK910 R4', 'hdcJK910 R5', 'hdcJK910 R6')	1
('Animal', 'Flash response time-to-peak (ms)', 'Peaks corresponding to the receptive field center', 'Peaks corresponding to the light-point No.22', 'Unnamed: 4', 'Unnamed: 5')	1
('Animal', 'Flash response time-to-peak (ms)', 'Front-to-back', 'Back-to-front', 'Unnamed: 4', 'Unnamed: 5')	1
('Trigger zone: trig', 'Starting RF half-width: ∆ρstart', 'Delay before rhabdomere motion: lag', 'Rhabdomere motion: (time-to-peak) Phase 1', 'Resulting parallel RF shift: RFshift', 'RF shift direction: α (front-to-back)', 'Rhabdomere motion: Phase 2', 'Ending RF half-width: ∆ρend')	1
('Source of variation', 'DF', 'Sum of squares', 'Mean square', 'F-value', 'P-value')	1
('Symbol', 'Meaning', 'Value', 'Value used by Simon et al. (1999)')	1
('Position 26', 'SP probability', 'Absolute occurrence')	1
('Genes', 'Sequences')	1
('Antigen', 'Reference', 'Company', 'Ig type', 'Dilution')	1
('Unnamed: 0', 'Unnamed: 1', 'T1 (0–333 ms)', 'T2 (333–667 ms)', 'T3 (667–1000 ms)', 'T4 (1000–1334 ms)')	1
('Treatments', 'MT (revealed by EB1-NG)', 'EB1-NG')	1
('Parameter', 'Description', 'Value', 'Source')	1
('Table 1A – Factors deriving segments and segment profile summaries (Zimbabwe)', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('Table 1B – Factors deriving segments and segment profile summaries (Zambia)', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('Country', 'Segment', 'All men in segment*', 'Uncircumcised men in segment†', 'Unnamed: 4', 'Unnamed: 5')	1
('Gene', 'P-value', 'Tissues', 'Description')	1
('Functional annotation', 'Fold enrichment', 'p-value', 'FDR q-value')	1
('Unnamed: 0', 'Model 1 Graded source-sink (mobile BMP)', 'Model 2 Graded source-sink (immobile BMP)', 'Model 3 Long-range accumulation and feedback', 'Model 4 Self-regulating reaction-diffusion system', 'Model 5 Shuttling', 'Experimental findings')	1
('Mutant*', 'Hill fit', 'pH sensor 1 (H25)', 'pH sensor 2 (E118)', 'Intrinsic gating', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7')	1
('Multivariate Tests (Pillai’s Trace)', 'value', 'F', 'p-value')	1
('Multivariate tests (Pillai’s Trace)', 'Value', 'F', 'p-value')	1
('Tests of Within-Subjects effects', 'df', 'F', 'p-value')	1
('Tests of Within-Subjects Effects', 'df', 'F', 'p-value')	1
('TFs', 'Fold up in mutants', 'Neural related Factors', 'Fold up in mutants.1', 'TFs.1', 'Fold down in mutants', 'Neural related Factors.1', 'Fold down in mutants.1')	1
('Parameters', 'Values')	1
('Parameters', 'Figure 10, Figure 10—figure supplements 1,2', 'Figure 10—figure supplement 4', 'Figure 10—figure supplement 5', 'Figure 10—figure supplement 6', 'Unnamed: 5', 'Unnamed: 6')	1
('Transgenic line', 'Sample size (brain hemispheres)', 'Fluorescent-neurons co-expressing npvf', 'npvf neurons co-expressing fluorescent-tagged transgene')	1
('Name', 'Antigen', 'Company', 'Clone')	1
('Compound', 'Molar ratio PTX/Conjugate', 'Molecular weight (Da)', 'Hydro-dynamic diameter (nm)', 'PDI', 'Diameter by SEM (nm)', 'Zeta potential (mV)')	1
('# KV', 'Total number of cilia observed', 'Central-pair', 'Dynein arms', 'Microns covered')	1
('Measure', 'CC', 'WM', 'Uniqueness')	1
('Unnamed: 0', 'HIT', 'Control', 'Unnamed: 3', 'Unnamed: 4')	1
('Unnamed: 0', 'HIT', 'Controls', 'Total')	1
('Characteristics', 'EHR-Documented evidence', 'LiteratureHomozygous children', 'LiteratureHomozygous Adults', 'BioMeHomozygousAdults', 'BioMeHeterozygousAdults <55yoa', 'BioMeControlsAdults <55yoa')	1
('Disease category', 'ICD9 code', 'Short description', 'Number of diagnoses among carriers N (%)', 'Number of diagnoses among non-carriers N (%)', 'Odds ratio (5% confidence intervals)', 'P-value')	1
('Origin', 'Source of samples*', 'Initial evidence', 'Gene deletion analysis by PCR', 'Antigen analysis', 'Ref', 'Prevalence (no. of samples, year of collection)', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12')	1
('Process', 'Transition', 'Hazard')	1
('Parameter', 'Symbol', 'Estimate')	1
('Proportion of population only infected with pfhrp2-deleted mutants', 'Concern classifier')	1
('Equation', 'Parameter', 'Value', 'Reference')	1
('PP2Atot', '2 µM')	1
('Rank', 'Kinase', 'IC50 (nM)')	1
('Compound', 'R1', 'R2', 'R3', 'IC50 (μM)', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12', 'Unnamed: 13')	1
('Name', 'Genotype/species/construction', 'Source or reference')	1
('Dataset', 'Population', 'Number of individuals', 'Number of SNPs')	1
('S1(m)', 'P1\u2005−\u2005S1(m)')	1
('S1(mi)', '$\\sum_{j = {i + 1}}^{96}S_{1}^{(m_{j})}$')	1
('S1(m96)', 'S1(m95)')	1
('Total study N', 'Δμ', 'No. of studies in MA', 'Effect measure', '% of simulations with Egger’s p<0.05', 'No. of studies filled by T&F (mean(min - max))', 'Overall effect size (mean(min - max))', 'Overall effect size after T&F (mean(min - max))')	1
('Unnamed: 0', 'Unnamed: 1', 'Precision estimate SE', 'Precision estimate 1/√n', 'Unnamed: 4', 'Unnamed: 5')	1
('Unnamed: 0', 'Unnamed: 1', 'Unnamed: 2', 'Precision estimate', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Unnamed: 0', 'Small studies', 'Large studies', 'RMD', 'SMD', 'NMD', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9')	1
('Gene name', 'Uniprot recommendedprotein name(s)', 'Uniprot ID', 'PDZ-domains', 'Number of unique peptides', 'LFQ intensity', 'Average KO LFQ intensity', 'Average WT LFQ intensity', 'Average KO/WT LFQ intensity', 'Average WT/KO LFQ intensity', 'T-test significant FDR0.01 = ++ DR0.05 = +', 'T-test q-value', 'Percent cover-age', 'Unnamed: 13', 'Unnamed: 14', 'Unnamed: 15', 'Unnamed: 16', 'Unnamed: 17', 'Unnamed: 18', 'Unnamed: 19', 'Unnamed: 20', 'Unnamed: 21', 'Unnamed: 22')	1
('Assay', 'Forward primer', 'Reverse primer')	1
('Allele', 'Mutations', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Village', 'N', '% female', 'Mean age (±SD)', 'Mean weight (±SD)', '% LLIN use at enrolment*', 'Mean LLIN use during follow-up† (%, range)', 'Mean Hb (±SD)')	1
('Village', 'P. falciparum', 'P. vivax', 'P. malariae', 'P. ovale', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12', 'Unnamed: 13', 'Unnamed: 14', 'Unnamed: 15', 'Unnamed: 16')	1
('Variable', 'P. vivax', 'P. falciparum', 'P. malariae', 'P. ovale', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12')	1
('Variable', 'P. vivax', 'P. falciparum', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9')	1
('Variable', 'P. vivax', 'P. falciparum', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Unnamed: 0', 'P. falciparum episode', 'Unnamed: 2', 'Unnamed: 3')	1
('Factors influencing population resilience', 'Prediction', 'Rock oyster', 'Tropical periwinkle')	1
('Unnamed: 0', 'Exponential model of source numbers', 'Unnamed: 2')	1
('Unnamed: 0', 'Logistic model of normalised source chimerism', 'Unnamed: 2')	1
('Unnamed: 0', 'Resistant memory model', 'Unnamed: 2', 'Unnamed: 3')	1
('Unnamed: 0', 'Declining recruitment model', 'Unnamed: 2', 'Unnamed: 3')	1
('Parameter', 'Units', 'Value', 'Description')	1
('Receptor (ECD)', 'Signal sequence', 'Tag', 'ECD start', 'ECD end', 'NCBI reference seq')	1
('Reaction - Diffusion System', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5')	1
('Figures', 'λA\u2004=\u2004λI', 'Others')	1
('Time and geometry', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3')	1
('Unnamed: 0', 'Activator', 'Inhibitor', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5')	1
('Ligand production', 'Unnamed: 1', 'HF growth', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6')	1
('Primers', 'gRNA targets', 'Unnamed: 2', 'Unnamed: 3')	1
('Parameter', 'Units', 'Symbol', 'Lower bound', 'Upper bound')	1
('Mosquito species', 'Sources')	1
('Virus', 'Sources')	1
('Unnamed: 0', 'Expected influence on', 'Unnamed: 2')	1
('Notation', 'Description', 'Formulation')	1
('Notation', 'Description', 'Value', 'Source')	1
('Primer name', "5' seq", "3' seq")	1
('Unnamed: 0', 'Ot', 'Sc', 'Ds', 'Ss')	1
('Species', 'V', 'SAC', 'SAMI', 'SAMI\u2005+\u2005MO', 'MI/MO', 'References')	1
('Unnamed: 0', 'Unnamed: 1', 'Unnamed: 2', 'F0F 1 copies per cell', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12', 'Unnamed: 13', 'Unnamed: 14')	1
('Species', 'Unnamed: 1', 'V', 'NR,\u2006direct', 'NR,\u2006raw', 'References')	1
('Unnamed: 0', 'GPL cost', 'Composition', 'Mean cost', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10')	1
('Rt (min)', 'MW', 'Proposed MF', 'Proposed structure', 'RI(a)', 'Peak ID')	1
('Driver name', 'Description', 'Reference')	1
('Name', 'Description', 'Reference')	1
('Genotype', 'Description', 'Reference / Source if otherwise')	1
('Label', 'Genotype / description', 'Reference(s)')	1
('Antigen and clone ID', 'Species', 'Concentration', 'Fixative', 'Reference / Source')	1
('Antigen and clone ID', 'Species', 'Concentration', 'Reference / Source')	1
('Antigen', 'Concentration', 'Source')	1
('Label', 'Description / reference')	1
('Figure', 'Condition/genotype', '# of NMJs (also indicated in each figure)', '# of animals')	1
('Gene', 'Allele', 'Strain')	1
('Experiment', 'Plasmid', 'Description (injection marker)', 'Background', 'Transgene', 'Strain')	1
('Gene name', 'Forward primer', 'Reverse primer')	1
('Position', 'Function', 'AtGTR1', 'AtGTR2', 'AtGTR3', 'CpGTRL1', 'CpGTRL2', 'Me14g74000', 'MeCGTR1', 'Unnamed: 9', 'NPF6.3', 'Unnamed: 11', 'PepT1', 'PepTSt', 'PepTGK', 'PepTS0')	1
('Symbol', 'Physical quantity', 'Values used in simulation', 'Sources / References', 'Notes')	1
('Strain', 'Genotype or description', 'Reference, source or construction*')	1
('Plasmid', 'Description')	1
('Primer', 'Sequence†')	1
('Channel', 'Highest conductance Gmax\xa0(S/cm2)')	1
('Other type', 'Other cell to pyr', 'Pyr to other cell', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Type', 'Other cell to pyr', 'Pyr to other cell', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Type', 'Other cell to pyr', 'Pyr to other cell', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10')	1
('Other type', 'Other cell to axo', 'Axo to other cell', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Type', 'Other cell to axo', 'Axo to other cell', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Type', 'Other cell to axo', 'Axo to other cell', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10')	1
('Other type', 'Other cell to bis', 'Bis to other cell', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Type', 'Other cell to bis', 'Bis to other cell', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Type', 'Other cell to bis', 'Bis to other cell', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10')	1
('Other type', 'Other cell to CCK+B', 'CCK+B to other cell', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Type', 'Other cell to CCK+B', 'CCK+B to other cell', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Type', 'Other cell to CCK+B', 'CCK+B to other cell', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10')	1
('OtherType', 'Other cell to ivy', 'Ivy to other cell', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Type', 'Other cell to ivy', 'Ivy to other cell', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Type', 'Other cell to ivy', 'Ivy to other cell', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10')	1
('Other type', 'Other cell to NGF', 'NGF to other cell', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Type', 'Other cell to NGF', 'NGF to other cell', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Type', 'Other cell to NGF', 'NGF to other cell', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10')	1
('Other type', 'Other cell to O-LM', 'O-LM to other cell', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Type', 'Other cell to O-LM', 'O-LM to other cell', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Type', 'Other cell to O-LM', 'O-LM to other cell', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10')	1
('Other type', 'Other cell to PV+B', 'PV+B to other cell', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Type', 'Other cell to PV+B', 'PV+B to other cell', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Type', 'Other cell to PV+B', 'PV+B to other cell', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10')	1
('Other type', 'Other cell to SC-A', 'SC-A to other cell', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Pre type', 'Exp. ref.', 'Hold (mV)', 'Erev (mV)', 'Amp. (pA,mV)', 'Diff. %', 't10\u2005−\u200590 (ms)', 'Diff. %.1', 'τdecay (ms)', 'Diff.%')	1
('Post\xa0type', 'Exp.\xa0ref.', 'Hold\xa0(mV)', 'Erev (mV)', 'Amp. (pA,mV)', 'Diff. %', 't10\u2005−\u200590 (ms)', 'Diff. %.1', 'τdecay (ms)', 'Diff. %.2')	1
('Unnamed: 0', 'Other cell to SC-A', 'SC-A to other cell', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Type', 'Other cell to SC-A', 'SC-A to other cell', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10')	1
('Ion', 'Unnamed: 1', 'Model', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11')	1
('Identification number', 'Vector', 'Expression system', 'Expressing', 'Published')	1
('Name', 'Genotype', 'Background', 'Source')	1
('Ensembl gene ID', 'Accession number', 'Gene name', 'Rationale')	1
('Gene', 'Number of loci', 'Unnamed: 2', 'Gene.1', 'Number of loci.1')	1
('Gene', 'Ensembl gene ID', 'Ensembl transcript ID', 'Assay ID', 'Target location', 'Fwd Tm', 'Rev Tm', '% GC', 'Coordinates (GRCm38/mm10)')	1
('Method', 'Mean', 'Std dev')	1
('Trait', 'Adaptation')	1
('Unnamed: 0', 'Avian receptor preference', 'Mixed receptor preference', 'Human receptor preference')	1
('Unnamed: 0', 'Avian-adapted for transmissibility', 'Human-adapted for transmissibility')	1
('Unnamed: 0', 'Avian-adapted', 'Human-adapted')	1
('Protein group', 'Accession', '-lgP', 'Coverage (%)', '#Unique', 'Description')	1
('Parameter', 'Set 1', 'Set 2', 'Interpretation', 'Reference')	1
('Compound', 'ER binding∗', 'Transcription†', 'Cell viability‡', 'ERα degradation§', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8')	1
('Adverse events*', 'TILA-TACE', 'cTACE†')	1
('Adverse events*', 'TILA-TACE', 'cTACE')	1
('Variable and parameter labels', 'Unnamed: 1', 'Unnamed: 2')	1
('Unnamed: 0', 'OCRE', 'OCRE + SmN')	1
('Primers used for semi-quantitative PCR (amplifying multiple isoforms)', 'Unnamed: 1', 'Unnamed: 2', 'Unnamed: 3')	1
('Protein', 'Clone', 'WB dilution', 'IF dilution', 'Company', 'Reference')	1
('Unnamed: 0', 'Immunization peptide', 'Control peptide')	1
('Chromatin mark', 'Hypo HS-DMRs', 'Hyper HS-DMRs', 'MRs')	1
('Unnamed: 0', 'ERα LBD D538G Apo', 'ERα LBD D538G-E2', 'ERα LBD D538G-4OHT')	1
('HIS residue number', 'Monomer A', 'Monomer B')	1
('Sample', 'Time', 'Mean', 'SEM', 'SD')	1
('Sample', 'Time', 'Original_Value_Mean', 'SEM', 'SD')	1
('Sample', 'Mean intracellular 2-HG/glutamate', 'Assumed N')	1
('Sample', '2HG/glutamate', 'log(2HG/glut)')	1
('Constant', 'Group', 'Effect size d', 'A priori power', 'Group sample size')	1
('Unnamed: 0', 'A', 'B', 'C')	1
('Unnamed: 0', 'A=\xa00.4\xa0Hzmean ± sem (n = 5)', 'A=\xa00.86 Hzmean ± sem (n = 5)')	1
('Unnamed: 0', 'REVERSE', 'FORWARD', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12', 'Unnamed: 13', 'Unnamed: 14', 'Unnamed: 15', 'Unnamed: 16', 'Unnamed: 17', 'Unnamed: 18', 'Unnamed: 19', 'Unnamed: 20')	1
('Unnamed: 0', 'HYP', 'DEP', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5', 'Unnamed: 6', 'Unnamed: 7', 'Unnamed: 8', 'Unnamed: 9', 'Unnamed: 10', 'Unnamed: 11', 'Unnamed: 12', 'Unnamed: 13', 'Unnamed: 14', 'Unnamed: 15', 'Unnamed: 16', 'Unnamed: 17', 'Unnamed: 18', 'Unnamed: 19', 'Unnamed: 20')	1
('Subspace', 'Cropping', 'Dwelling', 'Ranging', 'Coverage')	1
('Experiment', 'Figure', 'Strains and genotypes')	1
('siRNA', 'Luciferase activity', 'SD', 'N')	1
('siRNA', 'mRNA expression', 'SD', 'Assumed N')	1
('Group', 'Effect size d', 'A priori power', 'Sample size')	1
('Group', 'Effect size d', 'A priori power', 'sample size')	1
('siRNA', 'Luciferase Activity', 'SD', 'N')	1
('siRNA', 'Cell type', 'PTEN expression', 'SD', 'N')	1
('siRNA', 'Cell Type', 'mRNA expression', 'SD', 'N')	1
('Unnamed: 0', 'Unnamed: 1', 'Cell Proliferation (Optical Density)', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5')	1
('Cell Type', 'siRNA', 'Area under the curve', 'SD', 'N')	1
('Unnamed: 0', 'Unnamed: 1', 'pAkt/Total Akt', 'Unnamed: 3', 'Unnamed: 4')	1
('Groups', 'Variance estimate', 'F test statistic F(3,24) (siRNA main effect)', 'Partial η2', 'Effect size f', 'A priori power', 'Total sample size')	1
('Cells', 'Group 1 across time', 'Group 2 across time', 'Estimated variance', 'Effect size f', 'A priori power', 'Samples per group')	1
('Groups', 'Variance Estimate', 'F test statistic F(3,48) (cell line, siRNA interaction)', 'Partial η2', 'Effect size f', 'A priori power', 'Total sample size')	1
('Unnamed: 0', 'Mouse numbers', 'Percentages', 'Unnamed: 3', 'Unnamed: 4', 'Unnamed: 5')	1
(0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18)	1
('Unnamed: 0', 'Abbreviation', 'Paxinos atlas (mm)', 'Unnamed: 3', 'Unnamed: 4')	1
('Vector', 'Mean # of colonies >200\xa0μm diameter', 'Stdev', 'N')	1
('Vector', 'Mean # of colonies >100\xa0μm diameter', 'Stdev', 'N')	1
('Variant', 'Normalized pJNK band intensity to WT', 'Normalized pMBP band intensity to WT')	1
('Parameter', 'Description', 'Fitting status')	1
('Parameter', 'Range', 'Default value', 'Parameter description and function')	1
('Parameters', 'Values (‘*’: non-defined values)', 'Dimension (‘-’: dimensionless)', 'Host function')	1
('Season 1', 'Value', 'Std. error', 'DF', 't', 'p', '(Intr)', 'X2lx2l', 'Position2Edge')	1
('Season 2', 'Value', 'Std. error', 'DF', 't', 'p', '(Intr)')	1
('Correlation of fixed effects', '(Intr)', 'GenotypeTPS10', 'Genotypelox2/3', 'Unnamed: 4')	1
('Linear hypotheses', 'Estimate', 'Std. error', 'z', 'p')	1
('Correlation of fixed effects', '(Intr)', 'GenotypTPS10', 'PositionEdge', 'PositionCenter', 'GTPS10:PE')	1
('4E: Mean macroscopic tumor diameter at 18 weeks', 'Mean', 'SD', 'N')	1
('Unnamed: 0', 'F876 mutation*', 'Treatment')	1
('Treatment', 'Frequency (%)', 'Mutation', 'Endogenous or exogenous locus')	1
('Unnamed: 0', 'EGFP', 'rsEGFP', 'rsEGFP2')	1
('Interaction', 'Steady-state occupancy', 'Steady-state condition', 'Stability')	1